current user: public



Announcement: our server is upgraded to a faster system. If you experience any issues during this period please let us know.

d1xsva_
Query: d1xsva_ a.4.13.3 (A:) Hypothetical protein SAV1236 {Staphylococcus aureus, strain Mu50 / ATCC 700699 [TaxId: 1280]}, from SCOP175

Results of FFAS03 search in SCOP175
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
# Score Template Links and tools%idFirst DLVKTLRMNYLFDFYQSLLTNKQRNYLELFYLEDYSLSEIADTFNVSRQAVYDNIRRTGDLVEDYEKKLELYQKFEQRREIYDEMKQHLSNPEQIQRYIQQLEDLELast
1 -62.800d1xsva_ a.4.13.3 (A:) Hypothetical protein SAV1236 {Staphylococcus aureus, strain Mu50 / ATCC 700699 [TaxId: 1280]}  ali model 3D-neighbors  100  1DLVKTLRMNYLFDFYQSLLTNKQRNYLELFYLEDYSLSEIADTFNVSRQAVYDNIRRTGDLVEDYEKKLELYQKFEQRREIYDEMKQHLSNPEQIQRYIQQLEDLE 106
2 -10.900d1rp3a2 a.4.13.2 (A:164-234) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]}  ali model 3D-neighbors follow..  15  22..................LPEREKLVIQLIFYEELPAKEVAKILETSVSRVSQLKAKALERLRE.......................................... 67
3 -10.300d1tc3c_ a.4.1.2 (C:) Transposase tc3a1-65 {Caenorhabditis elegans [TaxId: 6239]}  ali model 3D-neighbors follow..  23  3...............GSALSDTERAQLDVMKLLNVSLHEMSRKISRSRHCIRVYLKD................................................. 44
4 -9.270d2ao9a1 a.4.1.17 (A:13-132) Phage protein BC1890 {Bacillus cereus [TaxId: 1396]}  ali model 3D-neighbors follow..  20  12..................LTAKQIQAAYLLVEEKRTQDEMANELGINRTTLWEWRTKNQDFIAFKSE....................................... 69
5 -9.130d1nr3a_ d.236.1.1 (A:) DNA-binding protein Tfx {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}  ali model 3D-neighbors follow..  20  4................................RGWSQKKIARELKTTRQNVSAIERKAMENIEKSRNTLDFVKSL............................... 46
6 -9.070d1ijwc_ a.4.1.2 (C:) HIN recombinase (DNA-binding domain) {Synthetic}  ali model 3D-neighbors follow..  6..................INKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASS............................................... 46
7 -8.180d2p4wa1 a.4.5.64 (A:1-194) Transcriptional regulatory protein PF1790 {Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  23  5..........LNRLLDVLGNETRRRILFLLTKRPYFVSELSRELGVGQKAVLEHLRILEEA............................................. 55
8 -8.030d2oi8a1 a.4.1.9 (A:8-86) Putative regulatory protein Sco4313 {Streptomyces coelicolor [TaxId: 1902]}  ali model 3D-neighbors follow..  17  14..................IKDHAWEQIATAGASALSLNAIAKRMGMSGPALYRYFDGRDELITE.......................................... 59
9 -7.940d1t56a1 a.4.1.9 (A:22-94) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]}  ali model 3D-neighbors follow..  19  8..................ILATAENLLEDRPLADISVDDLAKGAGISRPTFYFYFPSKEAVLLTLLDRV..................................... 58
10 -7.700d2hyja1 a.4.1.9 (A:8-82) Putative transcriptional regulator SCO4940 {Streptomyces coelicolor [TaxId: 1902]}  ali model 3D-neighbors follow..  10  8................GRILGRAAEIASEEGLDGITIGRLAEELEMSKSGVHKHFGTKETLQ............................................ 53

FFAS is supported by the NIH grant R01-GM087218-01
6 1 0 5 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Nika K, Tautz L, Saito K, Cerignoli F, Friedberg I, Godzik A, Mustelin T. Identification and characterization of DUSP27, a novel dual-specific protein phosphatase. FEBS Lett. 2007 May 29;581(13):2527-33. Epub 2007 Apr 30.