current user: public

Query: d1xsva_ a.4.13.3 (A:) Hypothetical protein SAV1236 {Staphylococcus aureus, strain Mu50 / ATCC 700699 [TaxId: 1280]}, from SCOP206

Results of FFAS03 search in SCOP206
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
1 -63.500d1xsva_ a.4.13.3 (A:) Hypothetical protein SAV1236 {Staphylococcus aureus, strain Mu50 / ATCC 700699 [TaxId: 1280]}  ali model 3D-neighbors  100  1DLVKTLRMNYLFDFYQSLLTNKQRNYLELFYLEDYSLSEIADTFNVSRQAVYDNIRRTGDLVEDYEKKLELYQKFEQRREIYDEMKQHLSNPEQIQRYIQQLEDLE 106
2 -11.900d1rp3a2 a.4.13.2 (A:164-234) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]}  ali model 3D-neighbors follow..  15  22..................LPEREKLVIQLIFYEELPAKEVAKILETSVSRVSQLKAKALERLRE.......................................... 67
3 -10.400d1tc3c_ a.4.1.2 (C:) Transposase tc3a1-65 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}  ali model 3D-neighbors follow..  22  3...............GSALSDTERAQLDVMKLLNVSLHEMSRKISRSRHCIRVYLKDPVS.............................................. 47
4 -9.870d2ao9a1 a.4.1.17 (A:13-132) Phage protein BC1890 {Bacillus cereus [TaxId: 1396]}  ali model 3D-neighbors follow..  18  12..................LTAKQIQAAYLLVENELTQDEMANELGINRTTLWEWRTKNQDFIAFKSE....................................... 69
5 -9.320d1ijwc_ a.4.1.2 (C:) HIN recombinase (DNA-binding domain) {Synthetic}  ali model 3D-neighbors follow..  6..................INKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASS............................................... 46
6 -9.130d1nr3a_ d.236.1.1 (A:) DNA-binding protein Tfx {Methanobacterium thermoautotrophicum [TaxId: 145262]}  ali model 3D-neighbors follow..  20  4................................RGWSQKKIARELKTTRQNVSAIERKAMENIEKSRNTLDFVKSL............................... 46
7 -8.140d1xnpa_ a.4.5.64 (A:) Transcriptional regulatory protein PF1790 {Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  23  5..........LNRLLDVLGNETRRRILFLLTKRPYFVSELSRELGVGQKAVLEHLRILEEA............................................. 55
8 -7.980d3q0wa1 a.4.1.0 (A:22-94) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}  ali model 3D-neighbors follow..  20  8..................ILATAENLLEDRPLADISVDDLAKGAGISRPTFYFYFPSKEAVLLTLLDR...................................... 57
9 -7.890d2hyja1 a.4.1.9 (A:8-82) Putative transcriptional regulator SCO4940 {Streptomyces coelicolor [TaxId: 1902]}  ali model 3D-neighbors follow..  10  8................GRILGRAAEIASEEGLDGITIGRLAEELEMSKSGVHKHFGTKETLQ............................................ 53
10 -7.680d1hlva1 a.4.1.7 (A:1-66) DNA-binding domain of centromere binding protein B (CENP-B) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  10..................FREKSRIIQEVEENPDLRKGEIARRFNIPPSTLSTILKNKRAILASERKY...................................... 59

FFAS is supported by the NIH grant R01-GM087218-01
8 3 0 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Lesley SA, Kuhn P, Godzik A., Deacon AM, Mathews I, Kreusch A, Spraggon G, Klock HE, McMullan D, Shin T, Vincent J, Robb A, Brinen LS, Miller MD, McPhillips TM, Miller MA, Scheibe D, Canaves JM, Guda C, Jaroszewski L, Selby TL, Elsliger MA, Wooley J, Taylor SS, Hodgson KO, Wilson IA, Schultz PG, Stevens RC. Structural genomics of the Thermotoga maritima proteome implemented in a high-throughput structure determination pipeline. Proc Natl Acad Sci U S A. 2002 Sep 3;99(18):11664-9. Epub 2002 Aug 22.