current user: public

Query: d1xsva_ a.4.13.3 (A:) Hypothetical protein SAV1236 {Staphylococcus aureus, strain Mu50 / ATCC 700699 [TaxId: 1280]}, from SCOP175

Results of FFAS03 search in SCOP175
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
1 -54.700d1xsva_ a.4.13.3 (A:) Hypothetical protein SAV1236 {Staphylococcus aureus, strain Mu50 / ATCC 700699 [TaxId: 1280]}  ali model 3D-neighbors  100  1DLVKTLRMNYLFDFYQSLLTNKQRNYLELFYLEDYSLSEIADTFNVSRQAVYDNIRRTGDLVEDYEKKLELYQKFEQRREIYDEMKQHLSNPEQIQRYIQQLEDLE 106
2 -18.500d1rp3a2 a.4.13.2 (A:164-234) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]}  ali model 3D-neighbors follow..  15  22..................LPEREKLVIQLIFYEELPAKEVAKILETSVSRVSQLKAKALERLRE.......................................... 67
3 -14.300d1or7a1 a.4.13.2 (A:120-187) SigmaE factor (RpoE) {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  23  19..................LPEDLRMAITLRELDGLSYEEIAAIMDCPVGTVRSRIFRAREAIDN.......................................... 64
4 -12.500d1tc3c_ a.4.1.2 (C:) Transposase tc3a1-65 {Caenorhabditis elegans [TaxId: 6239]}  ali model 3D-neighbors follow..  22  3...............GSALSDTERAQLDVMKLLNVSLHEMSRKISRSRHCIRVYLKDPVS.............................................. 47
5 -11.300d1p4wa_ a.4.6.2 (A:) Transcriptional regulator RcsB {Erwinia amylovora [TaxId: 552]}  ali model 3D-neighbors follow..  23  23..................LSPKESEVLRL-FAEGFLVTEIAKKLNRSIKTISSQKKSAMMKL............................................ 65
6 -10.400d1ijwc_ a.4.1.2 (C:) HIN recombinase (DNA-binding domain) {Synthetic}  ali model 3D-neighbors follow..  6..................INKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASS............................................... 46
7 -10.100d1l3la1 a.4.6.2 (A:170-234) Quorum-sensing transcription factor TraR, C-terminal domain {Agrobacterium tumefaciens [TaxId: 358]}  ali model 3D-neighbors follow..  25  5..................LDPKEATYLR-WIAVGKTMEEIADVEGVKYNSVRVKLREAMKRF............................................ 47
8 -9.840d1fsea_ a.4.6.2 (A:) Germination protein GerE {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  28  3................PLLTKREREVFEL-LVQDKTTKEIASELFISEKTVRNHISNAMQKL............................................ 47
9 -9.120d1a04a1 a.4.6.2 (A:150-216) Nitrate/nitrite response regulator (NarL) {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  18  7..................LTPRERDILKL-IAQGLPNKMIARRLDITESTVKVHVKHMLKKM............................................ 49
10 -8.970d1yioa1 a.4.6.2 (A:131-200) Response regulatory protein StyR, C-terminal domain {Pseudomonas fluorescens [TaxId: 294]}  ali model 3D-neighbors follow..  15  13..................LTGREQQVLQL-TIRGLMNKQIAGELGIAEVTVKVHRHNIMQKLN........................................... 56

FFAS is supported by the NIH grant R01-GM087218-01
6 0 4 6 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ginalski K, Grishin NV, Godzik A., Rychlewski L. Practical lessons from protein structure prediction. Nucleic Acids Res. 2005 Apr 1;33(6):1874-91.