current user: public




d1x9fb_
Query: d1x9fb_ a.1.1.2 (B:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit II (globin B) {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}, from SCOP175

Results of FFAS03 search in SCOP175
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
# Score Template Links and tools%idFirst KKQCGVLEGLKVKSEWGRAYGSGHDREAFSQAIWRATFAQVPESRSLFKRVHGDDTSHPAFIAHADRVLGGLDIAISTLDQPATLKEELDHLQVQHEGRKIPDNYFDAFKTAILHVVAAQLGRCYDREAWDACIDHIEDGIKGHHLast
1 -68.700d1x9fb_ a.1.1.2 (B:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit II (globin B) {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}  ali model 3D-neighbors  100  1KKQCGVLEGLKVKSEWGRAYGSGHDREAFSQAIWRATFAQVPESRSLFKRVHGDDTSHPAFIAHADRVLGGLDIAISTLDQPATLKEELDHLQVQHEGRKIPDNYFDAFKTAILHVVAAQLGRCYDREAWDACIDHIEDGIKGHH 145
2 -56.700d1h97a_ a.1.1.2 (A:) Trematode hemoglobin/myoglobin {Paramphistomum epiclitum [TaxId: 54403]}  ali model 3D-neighbors follow..  13  1..TLTKHEQDILLKELGPHVDTPAHIVETGLGAYHALFTAHPQYISHFSRLEGHTIESEGIKHYARTLTEAIVHMLKEISNDAEVKKIAAQYGKDHTSRKVTKDEFMSGEPIFTKYFQNLVKDAEGKAAVEKFLKHVFPMMAAE. 146
3 -54.200d1q1fa_ a.1.1.2 (A:) Neuroglobin {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  18  1.....RPESELIRQSWRVV---SRSPLEHGTVLFARLFALEPSLLPLFQYNGEDSLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLTSLGRKHRAVGVRLSSFSTVGESLLYMLEKSLGPDFTPAAWSRLYGAVVQAMSRGW 146
4 -53.600d1hlba_ a.1.1.2 (A:) Hemoglobin, different isoforms {Caudina arenicola, also known as Molpadia arenicola [TaxId: 7698]}  ali model 3D-neighbors follow..  20  9QGDLTLAQKKIVRKTWHQL---MRNKTSFVTDVFIRIFAYDPSAQNKFPQMAGMSRSSRQMQAHAIRVSSIMSEYVEELDS-DILPELLATLARTHDLNKVGADHYNLFAKVLMEALQAELGSDFNEKAWAKAFSVVQAVLLVKH 156
5 -53.600d1x9fc_ a.1.1.2 (C:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit III (globin C) {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}  ali model 3D-neighbors follow..  30  2EHCCSEEDHRIVQKQWDILWRSSKIKIGFGRLLLTKLAKDIPEVNDLFKRVDIEHAEGPKFSAHALRILNGLDLAINLLDDPPALDAALDHLAHQHEREGVQKAHFKKFGEILATGLPQVLDDYDA-LAWKSCLKGILTKISS.. 147
6 -53.100d3d1ka1 a.1.1.2 (A:1-142) Hemoglobin, alpha-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]}  ali model 3D-neighbors follow..  19  1..SLSDKDKAAVRALWSKI---GKSSDAIGNDALSRMIVVYPQTKIYFSHWPDVTPGSPNIKAHGKKVMGGIALAVSKIDD---LKTGLMELSEQHAKLRVDPSNFKILNHCILVVISTMFPKEFTPESLDKFLSGVALALAERY 141
7 -52.800d1mbaa_ a.1.1.2 (A:) Myoglobin {Slug sea hare (Aplysia limacina) [TaxId: 6502]}  ali model 3D-neighbors follow..  16  1..SLSAAEADLAGKSWAPV---FANKNANGLDFLVALFEKFPDSANFFADFKGKSKASPKLRDVSSRIFTRLNEFVNNAANAGKMSAMLSQFAKEHVGFGVGSAQFENVRSMFPGFVASVAAPAGADAAWTKLFGLIIDALKAAG 145
8 -52.400d3sdha_ a.1.1.2 (A:) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}  ali model 3D-neighbors follow..  20  6AAQLTADVKKDLRDSWKVI---GSDKKGNGVALMTTLFADNQETIGYFKRLGNQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL.... 145
9 -52.400d1urva_ a.1.1.2 (A:) Cytoglobin {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  23  1..ELSEAERKAVQAMWARL---YANSEDVGVAILVRFFVNFPSAKQYFSQFKHEMERSPQLRKHASRVMGALNTVVENLHDPDKVSSVLALVGKAHAKHKVEPVYFKILSGVILEVVAEEFASDFPPEAWAKLRGLIYSHVTAAY 149
10 -52.200d2gdma_ a.1.1.2 (A:) Leghemoglobin {Yellow lupin (Lupinus luteus) [TaxId: 3873]}  ali model 3D-neighbors follow..  21  2..ALTESQAALVKSSWEEF---NANIPKHTHRFFILVLEIAPAAKDLFSFLKGTSQNNPELQAHAGKVFKLVYEAAIQLEVTGVVVATLKNLGSVHVSKGVADAHFPVVKEAILKTIKEVVGAKWSEEAWTIAYDELAIVIKKEM 149
11 -52.200d1cg5b_ a.1.1.2 (B:) Hemoglobin, beta-chain {Cartilaginous fish akaei (Dasyatis akajei) [TaxId: 31902]}  ali model 3D-neighbors follow..  15  1.VKLSEDQEHYIKGVWKDV-----DHKQITAKALERVFVVYPWTTRLFSKLQGFSANDIGVQQHADKVQRALGEAIDDLKK---VEINFQNLSGKHQEIGVDTQNFKLLGQTFMVELALHYKKTFRPKAAYKFFRLVAEALSSNY 140
12 -52.000d1x9fa_ a.1.1.2 (A:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit IV (globin A) {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}  ali model 3D-neighbors follow..  26  1.DCCSYEDRREIRHIWDDVWSFTDRRVAIVRAVFDDLFKHYPTSKALFERVKIDEPESGEFKSHLVRVANGLKLLINLLDDTLVLQSHLGHLADQHIQRGVTKEYFRGIGEAFARVLPQVLSCF-NVDAWNRCFHRLVARIAKD. 145
13 -51.900d1b0ba_ a.1.1.2 (A:) Hemoglobin I {Clam (Lucina pectinata) [TaxId: 29163]}  ali model 3D-neighbors follow..  17  1..SLSAAQKDNVKSSWAKA---SAAWGTAGPEFFMALFDAHDDVFAKFSGLKGTVKNTPEMAAQAQSFKGLVSNWVDNLDNAGALEGQCKTFAANHKARGISAGQLEAAFKVLAGFMKSYGGDE---GAWTAVAGALMGMIRPD. 141
14 -51.700d1jl7a_ a.1.1.2 (A:) Glycera globin {Marine bloodworm (Glycera dibranchiata) [TaxId: 6350]}  ali model 3D-neighbors follow..  18  1..GLSAAQRQVVASTWKDIAG-ADNGAGVGKECLSKFISAHPEMAAVFGFSGA---SDPGVAELGAKVLAQIGVAVSHLGDEGKMVAEMKAVGVRHKGYGIKAEYFEPLGASLLSAMEHRIGGKMNAAAWAAAYGDISGALISGL 145
15 -50.300d1cg5a_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Cartilaginous fish akaei (Dasyatis akajei) [TaxId: 31902]}  ali model 3D-neighbors follow..  17  2...LSSQNKKAIEELGNLI---KANAEAWGADALARLFELHPQTKTYFSKFSGFEACNEQVKKHGKRVMNALADATHHLDN---LHLHLEDLARKHGNLLVDPHNFHLFADCIVVTLAVNLQA-FTPVAVDKFLELVAYELSSCY 140
16 -50.100d3d1kb1 a.1.1.2 (B:1-146) Hemoglobin, beta-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]}  ali model 3D-neighbors follow..  15  1.VEWTDKERSIISDIFSHM-----DYDDIGPKALSRCLVVYPWTQRYFSGFGEGIMSNANVAAHGIKVLHGLDRGMKNMDN---IADAYTDLSTLHSKLHVDPDNFKLLSDCITIVLAAKMGHAFTAEAFQKFLAAVVSALGKQY 145
17 -49.600d2qfka1 a.1.1.2 (A:1-137) Dehaloperoxidase {Amphitrite ornata [TaxId: 129555]}  ali model 3D-neighbors follow..  15  1..........GFKQDIATI---RGDLRTYAQDIFLAFLNKYPDERRYFKNYVGKSDQMAKFGDHTEKVFNLMMEVADRATDCVPLASDANTLVQMKQHSSLTTGNFEKLFVALVEYMRASGQSF-DSQSWDRFGKNLVSALSSAG 135
18 -49.500d1it2a_ a.1.1.2 (A:) Hagfish hemoglobin {Inshore hagfish (Eptatretus burgeri) [TaxId: 7764]}  ali model 3D-neighbors follow..  11  8LPTLTDGDKKAINKIWPKI---YKEYEQYSLNILLRFLKCFPQAQASFPKFSSNLEQDPEVKHQAVVIFNKVNEIINSMDNQEEIIKSLKDLSQKHKVFKVDSIWFKELSSIFVSTIDGG-------AEFEKLFSIICILLRSAY 146
19 -48.800d1a6ma_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}  ali model 3D-neighbors follow..  20  2...LSEGEWQLVLHVWAKV---EADVAGHGQDILIRLFKSHPETLEKFDRFKHEMKASEDLKKHGVTVLTALGAILKKKGH---HEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAMNKALELFRKDIAAKY 146
20 -48.800d1itha_ a.1.1.2 (A:) Hemoglobin {Innkeeper worm (Urechis caupo) [TaxId: 6431]}  ali model 3D-neighbors follow..  15  2...LTAAQIKAIQDHWFLN--IKGCLQAAADSIFFKYLTAYPGDLAFFHKFSSVPRSNPAYKAQTLTVINYLDKVVDALGGNAG--ALMKAKVPSHDAMGITPKHFGQLLKLVGGVFQEEFSADPTVAAWGDAAGVLVAAMK... 141
21 -48.200d1ecda_ a.1.1.2 (A:) Erythrocruorin {Midge (Chironomus thummi thummi), fraction III [TaxId: 7154]}  ali model 3D-neighbors follow..  17  1...LSADQISTVQASFDKV-------KGDPVGILYAVFKADPSIMAKFTQFAGKDLETAPFETHANRIVGFFSKIIGELPN---IEADVNTFVASHKPRGVTHDQLNNFRAGFVSYMKAHTDFAGAEAAWGATLDTFFGMIFSK. 135
22 -48.000d1gcvb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Houndshark (Mustelus griseus) [TaxId: 89020]}  ali model 3D-neighbors follow..  17  2..HWTQEERDEISKTFQGT-----DMKTVVTQALDRMFKVYPWTNRYFQKR-----TDFRSSIHAGIVVGALQDAVKHMDD---VKTLFKDLSKKHADLHVDPGSFHLLTDCIIVELAYLRKDCFTPHIWDKFFEVVIDAISKQY 135
23 -47.900d1asha_ a.1.1.2 (A:) Ascaris hemoglobin, domain 1 {Pig roundworm (Ascaris suum) [TaxId: 6253]}  ali model 3D-neighbors follow..  14  1....ANKTRELCMKSLEHAKDTSNEARQDGIDLYKHMFENYPPLRKYFKSREEDVQNDPFFAKQGQKILLACHVLCATYDDRETFNAYTRELLDRHARDHVPPEVWTDFWKLFEEYLGKKTTDEPTKQAWHEIGREFAKEINK.. 147
24 -47.100d1cqxa1 a.1.1.2 (A:1-150) Flavohemoglobin, N-terminal domain {Alcaligenes eutrophus [TaxId: 106590]}  ali model 3D-neighbors follow..  13  2...LTQKTKDIVKATAPVL---AEHGYDIIKCFYQRMFEAHPELKNVFNM------AHQEQGQQQQALARAVYAYAENIEDPNSLMAVLKNIANKHASLGVKPEQYPIVGEHLLAAIKEVLGNAATDDAWAQAYGNLADVLMGM. 136
25 -35.900d1tu9a_ a.1.1.2 (A:) Hypothetical protein PA3967 {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  18  1......NAADRVMQSYGRC----CASTGFFDDFYRHFLASSPQIRAKFA--------TTDMTAQKHLLRAGIMNLVMYARGMSDSKLRALGASHSRAALDIRPELYDLWLDALLMAVAEHDRD-CDAEAWRDVMGRGIAVIKSYY 129
26 -35.100d1kr7a_ a.1.1.4 (A:) Nerve tissue mini-hemoglobin (neural globin) {Milky ribbon-worm (Cerebratulus lacteus) [TaxId: 6221]}  ali model 3D-neighbors follow..  15  2.............VNWAAV----------VDDFYQELFKAHPEYQNKFGFKGGSLKGNAAYKTQAGKTVDYINAAIGGSAD-------AAGLASRHKGRNVGSAEFHNAKACLAKACSAHGAPDLGHAILSHL............ 110
27 -14.900d1or4a_ a.1.1.2 (A:) Heme-based aerotactic transducer HemAT, sensor domain {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  33..RLGDAELYVLEQLQPLI---QENIVNIVDAFYKNLDH-ESSLMDIINDHSSVDRLKQTLKRHIQEMFAG-----------DEFIEKRNRIASIHLRIGLLPKWYMGAFQELLLSMIDIYEASITNQATTKILNLEQQLVLE.. 169
28 -9.420d1ngka_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Mycobacterium tuberculosis, HbO [TaxId: 1773]}  ali model 3D-neighbors follow..  16  1............KSFYDAV-GGAKTFDAIVSRFYAQV-AEDEVLRRVYP--------EDDLAGAEERLRMFLEQYWGGPRTYSE-----PRLRMRHAPFRISLIERDAWLRCMHTAVASIDSETLDDEHRRELLDYLEMA..... 117
29 -9.380d1idra_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Mycobacterium tuberculosis, HbN [TaxId: 1773]}  ali model 3D-neighbors follow..  10  3...LSRLRKREPISIYDKI-GGHEAIEVVVEDFYVRV-LADDQLSAFFS--------GTNMSRLKGKQVEFFAAALGGPEPYTG-----APMKQVHQGRGITMHHFSLVAGHLADALTAAGVPSETITEILGVIAPLAVDVTS.. 127

FFAS is supported by the NIH grant R01-GM087218-01
6 1 0 2 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Godzik A. Functional differentiation of proteins: implications for structural genomics. Structure. 2007 Apr;15(4):405-15.