current user: public

Query: d1x9fb_ a.1.1.2 (B:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit II (globin B) {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}, from SCOP175

Results of FFAS03 search in SCOP175
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
1 -70.700d1x9fb_ a.1.1.2 (B:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit II (globin B) {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}  ali model 3D-neighbors  100  1KKQCGVLEGLKVKSEWGRAYGSGHDREAFSQAIWRATFAQVPESRSLFKRVHGDDTSHPAFIAHADRVLGGLDIAISTLDQPATLKEELDHLQVQHEGRKIPDNYFDAFKTAILHVVAAQLGRCYDREAWDACIDHIEDGIKGHH 145
3 -55.600d1x9fc_ a.1.1.2 (C:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit III (globin C) {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}  ali model 3D-neighbors follow..  30  2EHCCSEEDHRIVQKQWDILWRSSKIKIGFGRLLLTKLAKDIPEVNDLFKRVDIEHAEGPKFSAHALRILNGLDLAINLLDDPPALDAALDHLAHQHEREGVQKAHFKKFGEILATGLPQVLDDYDA-LAWKSCLKGILTKISS.. 147
4 -54.500d1hlba_ a.1.1.2 (A:) Hemoglobin, different isoforms {Caudina arenicola, also known as Molpadia arenicola [TaxId: 7698]}  ali model 3D-neighbors follow..  20  9QGDLTLAQKKIVRKTWHQL---MRNKTSFVTDVFIRIFAYDPSAQNKFPQMAGMSASSRQMQAHAIRVSSIMSEYVEELDS-DILPELLATLARTHDLNKVGADHYNLFAKVLMEALQAELGSDFNEKAWAKAFSVVQAVLLVKH 156
5 -54.300d1x9fa_ a.1.1.2 (A:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit IV (globin A) {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}  ali model 3D-neighbors follow..  25  1.DCCSYEDRREIRHIWDDVWSFTDRRVAIVRAVFDDLFKHYPTSKALFERVKIDEPESGEFKSHLVRVANGLKLLINLLDDTLVLQSHLGHLADQHIRKGVTKEYFRGIGEAFARVLPQVLSCF-NVDAWNRCFHRLVARIAKDL 146
7 -53.600d3d1ka1 a.1.1.2 (A:1-142) Hemoglobin, alpha-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]}  ali model 3D-neighbors follow..  19  1..SLSDKDKAAVRALWSKI---GKSSDAIGNDALSRMIVVYPQTKIYFSHWPDVTPGSPNIKAHGKKVMGGIALAVSKIDD---LKTGLMELSEQHAKLRVDPSNFKILNHCILVVISTMFPKEFTPESLDKFLSGVALALAERY 141
9 -52.900d1cg5b_ a.1.1.2 (B:) Hemoglobin, beta-chain {Cartilaginous fish akaei (Dasyatis akajei) [TaxId: 31902]}  ali model 3D-neighbors follow..  15  1.VKLSEDQEHYIKGVWKDV-----DHKQITAKALERVFVVYPWTTRLFSKLQGFSANDIGVQQHADKVQRALGEAIDDLKK---VEINFQNLSGKHQEIGVDTQNFKLLGQTFMVELALHYKKTFRPKAAYKFFRLVAEALSSNY 140
14 -50.400d1cg5a_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Cartilaginous fish akaei (Dasyatis akajei) [TaxId: 31902]}  ali model 3D-neighbors follow..  17  2...LSSQNKKAIEELGNLI---KANAEAWGADALARLFELHPQTKTYFSKFSGFEACNEQVKKHGKRVMNALADATHHLDN---LHLHLEDLARKHGNLLVDPHNFHLFADCIVVTLAVNLQA-FTPVAVDKFLELVAYELSSCY 140
15 -49.800d1it2a_ a.1.1.2 (A:) Hagfish hemoglobin {Inshore hagfish (Eptatretus burgeri) [TaxId: 7764]}  ali model 3D-neighbors follow..  11  8LPTLTDGDKKAINKIWPKI---YKEYEQYSLNILLRFLKCFPQAQASFPKFSSNLEQDPEVKHQAVVIFNKVNEIINSMDNQEEIIKSLKDLSQKHKVFKVDSIWFKELSSIFVSTID-------GGAEFEKLFSIICILLRSAY 146
17 -49.500d1jl7a_ a.1.1.2 (A:) Glycera globin {Marine bloodworm (Glycera dibranchiata) [TaxId: 6350]}  ali model 3D-neighbors follow..  19  1..GLSAAQRQVVASTWKDIAG-ADNGAGVGKECLSKFISAHPEMAAVFGFSGA---SDPGVAELGAKVLAQIGVAVSHLGDEGKMVAEMKAVGVRHKGYGIKAEYFEPLGASLLSAMEHRIGGKMNAAAWAAAYGDISGALIS.. 143
18 -49.200d2qfka1 a.1.1.2 (A:1-137) Dehaloperoxidase {Amphitrite ornata [TaxId: 129555]}  ali model 3D-neighbors follow..  15  2...........FKQDIATI---RGDLRTYAQDIFLAFLNKYPDERRYFKNYVGKSDQMAKFGDHTEKVFNLMMEVADRATDCVPLASDANTLVQMKQHSSLTTGNFEKLFVALVEYMRASGQSFDS-QSWDRFGKNLVSALSS.. 133
19 -49.000d3d1kb1 a.1.1.2 (B:1-146) Hemoglobin, beta-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]}  ali model 3D-neighbors follow..  15  1.VEWTDKERSIISDIFSHM-----DYDDIGPKALSRCLVVYPWTQRYFSGFGNLYMSNANVAAHGIKVLHGLDRGMKNMDN---IADAYTDLSTLHSKLHVDPDNFKLLSDCITIVLAAKMGHAFTAEAFQKFLAAVVSALGKQY 145
20 -49.000d1gcvb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Houndshark (Mustelus griseus) [TaxId: 89020]}  ali model 3D-neighbors follow..  17  1.VHWTQEERDEISKTFQGT-----DMKTVVTQALDRMFKVYPWTNRYFQKR-----TDFRSSIHAGIVVGALQDAVKHMDD---VKTLFKDLSKKHADLHVDPGSFHLLTDCIIVELAYLRKDCFTPHIWDKFFEVVIDAISKQY 135
21 -48.900d1ecda_ a.1.1.2 (A:) Erythrocruorin {Midge (Chironomus thummi thummi), fraction III [TaxId: 7154]}  ali model 3D-neighbors follow..  17  1...LSADQISTVQASFDKV-------KGDPVGILYAVFKADPSIMAKFTQFAGKDLGTAPFETHANRIVGFFSKIIGELPN---IEADVNTFVASHKPRGVTHDQLNNFRAGFVSYMKAHTDFAGAEAAWGATLDTFFGMIFSK. 135
23 -47.100d1asha_ a.1.1.2 (A:) Ascaris hemoglobin, domain 1 {Pig roundworm (Ascaris suum) [TaxId: 6253]}  ali model 3D-neighbors follow..  13  1....ANKTRELCMKSLEHAKDTSNEARQDGIDLYKHMFENYPPLRKYFKSREEYTAEDPFFAKQGQKILLACHVLCATYDDRETFNAYTRELLDRHARDHVPPEVWTDFWKLFEEYLGKKTTDEPTKQAWHEIGREFAKEINK.. 147
24 -40.900d1cqxa1 a.1.1.2 (A:1-150) Flavohemoglobin, N-terminal domain {Alcaligenes eutrophus [TaxId: 106590]}  ali model 3D-neighbors follow..  14  2...LTQKTKDIVKAT---APVLAEHGYDIIKCFYQRMFEAHPELKNVFNMAHQEQGQQQQA------LARAVYAYAENIEDPNSLMAVLKNIANKHASLGVKPEQYPIVGEHLLAAIKEVLGNAATDDAWAQAYGNLADVLMGM. 136
25 -34.900d1kr7a_ a.1.1.4 (A:) Nerve tissue mini-hemoglobin (neural globin) {Milky ribbon-worm (Cerebratulus lacteus) [TaxId: 6221]}  ali model 3D-neighbors follow..  15  2.............VNWAAV----------VDDFYQELFKAHPEYQNKFGFKGGSLKGNAAYKTQAGKTVDYINAAIGGSAD-------AAGLASRHKGRNVGSAEFHNAKACLAKACSAHGAPDLGHAILSHL............ 110
26 -32.200d1tu9a_ a.1.1.2 (A:) Hypothetical protein PA3967 {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  17  1......NAADRVMQSYGRC----CASTGFFDDFYRHFLASSPQIRAKFA--------TTDMTAQKHLLRAGIMNLVMYARGMSDSKLRALGASHSRAALDIRPELYDLWLDALLMAVAEHDRDCDAEDAWRDVMGRGIAVIKSYY 129
27 -15.900d1or4a_ a.1.1.2 (A:) Heme-based aerotactic transducer HemAT, sensor domain {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  33..RLGDAELYVLEQLQPLI---QENIVNIVDAFYKNLDH-ESSLMDIINDHSSVDRLKQTLKRHIQEMFAG------VIDD--EFIEKRNRIASIHLRIGLLPKWYMGAFQELLLSMIDIYEASINQQELLKAIKATTKIL.... 160

FFAS is supported by the NIH grant R01-GM087218-01
7 5 6 4 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ye Y, Godzik A. Database searching by flexible protein structure alignment. Protein Sci. 2004 Jul;13(7):1841-50.