current user: public




d1wjza_
Query: d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]}, from SCOP175

Results of FFAS03 search in SCOP175
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90
# Score Template Links and tools%idFirst GSSGSSGMALEQTLKKDWYSILGADPSANMSDLKQKYQKLILLYHPDKQSADVPAGTMEECMQKFIEIDQAWKILGNEETKKKYDLQRSGPSSGLast
1 -63.400d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors  100  1GSSGSSGMALEQTLKKDWYSILGADPSANMSDLKQKYQKLILLYHPDKQSADVPAGTMEECMQKFIEIDQAWKILGNEETKKKYDLQRSGPSSG 94
2 -49.100d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  31  1.............AKQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGD------KEAEAKFKEIKEAYEVLTDSQKRAAYDQYGHAAFE. 74
3 -44.000d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  18  6.....HHLVPRGSILKEVTSVVEQAWKLPESERKKIIRRLYLKWHPDKNPEN-----HDIANEVFKHLQNEINRL---EKQAFLDQNADRASRR 86
4 -36.800d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]}  ali model 3D-neighbors follow..  21  4........VLSRADKERLLELLKLPRQLWGDFMQQAYKQQSLLLHPDKGGS----------HALMQELNSLWGTFKTEVYNLRMNLGGTG.... 77
5 -35.400d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]}  ali model 3D-neighbors follow..  23  23.....STMHTVLWAGETKWKPVGMADLVTPEQVKKVYRKAVLVVHPDKATGQ---PYEQYAKMIFMELNDAWSEFENQGQKPLY.......... 98
6 -32.100d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]}  ali model 3D-neighbors follow..  16  4...........REESLQLMDLLGLERSAWGNLMRKAYLKKCKEFHPDKGG----------DEEKMKKMNTLYKKMEDGVKYAHQPDFGGFWDAT 78
7 -31.300d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  25  2................DYFTLFGLPARYQLDALSLRFQDLQRQYHPDKFASG-SQAEQLAAVQQSATINQAWQTLRHPLMRAEY.......... 70
8 -7.570d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]}  ali model 3D-neighbors follow..  11  8GYGTVGKRVADAIAQQDDMKVIGVSKTRPDFEARMALKKGYDLYVAIPERVKLFEKAGIEVAGTVDDMLDEADIVIDAKNLKMYKEKG...... 102
9 -7.000g1o7d.1 a.8.3.1 (B:385-422,C:431-487) Lysosomal alpha-mannosidase {Cow (Bos taurus) [TaxId: 9913]}  ali 3D-neighbors follow..  16  29...................NQLEALAGPAXGDSAPLNEAMAVLQHHDAVSGTSRQHVANDYARQLSEMSNALAHLSGLK............... 96
10 -6.140d2fug51 d.307.1.1 (5:1-196) NADH-quinone oxidoreductase chain 5, Nqo5 {Thermus thermophilus [TaxId: 274]}  ali model 3D-neighbors follow..  12  115..............EREVYDLFGI---EGHPDLRKILTPEDLEGHPLRKDYPLGETPTLFREGRYIIPAEFRAALTGKDPGLTFYKGG...... 187

FFAS is supported by the NIH grant R01-GM087218-01
5 9 9 7 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Doukhanina EV, Chen S, van der Zalm E, Godzik A, Reed J, Dickman MB. Identification and functional characterization of the BAG protein family inArabidopsis thaliana. Biol Chem. 2006 Jul 7;281(27):18793-801. Epub 2006 Apr 24.