current user: public

Announcement: our server is upgraded to a faster system. If you experience any issues during this period please let us know.

Query: d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]}, from SCOP175

Results of FFAS03 search in SCOP175
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90
1 -60.600d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors  100  1GSSGSSGMALEQTLKKDWYSILGADPSANMSDLKQKYQKLILLYHPDKQSADVPAGTMEECMQKFIEIDQAWKILGNEETKKKYDLQRSGPSSG 94
2 -44.900d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  31  2..............KQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGD------KEAEAKFKEIKEAYEVLTDSQKRAAYDQYGHAAFE. 74
3 -37.900d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  15..............LKEVTSVVEQAWKLPESERKKIIRRLYLKWHPDKNPEN-----HDIANEVFKHLQNEINRL---EKQAFLDQNADRASRR 86
4 -31.400d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]}  ali model 3D-neighbors follow..  21  4........VLSRADKERLLELLKLPRQLDFGRMQQAYKQQSLLLHPDKGGS----------HALMQELNSLWGTFKTEVYNLRMNLGGTG.... 77
5 -29.700d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]}  ali model 3D-neighbors follow..  16  6.............ESLQLMDLLGLERSAWGNLMRKAYLKKCKEFHPDKGGD----------EEKMKKMNTLYKKMEDGVKYAHQPDFGGFWDAT 78
6 -29.500d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]}  ali model 3D-neighbors follow..  23  23.....STMHTVLWAGETKWKPVGMADLVTPEQVKKVYRKAVLVVHPDKATGQ---PYEQYAKMIFMELNDAWSEFENQGQKPLY.......... 98
7 -20.100d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  26  2................DYFTLFGLPAQLDTQALSLRFQDLQRQYHPDK--ASGSQAEQLAAVQQSATINQAWQTLRHPLMRAEY.......... 70
8 -6.470d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]}  ali model 3D-neighbors follow..  11  8GYGTVGKRVADAIAQQDDMKVIGVSKTRPDFEARMALKKGYDLYVAIPERVKLFEKAGIEVAGTVDDMLDEADIVIDAKNLKMYKEKG...... 102
9 -6.130d1l9xa_ c.23.16.1 (A:) gamma-glutamyl hydrolase {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  13  181...............KKFFNVLTTNTDGKIEFISYKYPVYGVQWHPEKAPYEWKNLDGISHAPNAVKTAFYLAEFFVNEARKNNHHFKSE.... 259
10 -6.000g1o7d.1 a.8.3.1 (B:385-422,C:431-487) Lysosomal alpha-mannosidase {Cow (Bos taurus) [TaxId: 9913]}  ali 3D-neighbors follow..  16  29...................NQLEALAGPAXGDSAPLNEAMAVLQHHDAVSGTSRQHVANDYARQLSEMSNALAHLSGLK............... 96

FFAS is supported by the NIH grant R01-GM087218-01
6 1 0 4 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Nika K, Tautz L, Saito K, Cerignoli F, Friedberg I, Godzik A, Mustelin T. Identification and characterization of DUSP27, a novel dual-specific protein phosphatase. FEBS Lett. 2007 May 29;581(13):2527-33. Epub 2007 Apr 30.