current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]}, from SCOP206

Results of FFAS03 search in SCOP206
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
2 -58.500d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  28  1EHAPATTGPLPSAPRD--VVASLVSTRFIKLTWRTPSDPHGDNLTYSVFYTKEGIARERVENTSHPGEMQVTIQNLMPATVYIFRVMAQNKHGSGESSAPLRVETQPE 107
3 -56.900d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  23  6.....VPPELPGPPTN--LGISNIGPRSVTLQFRPGYDGKTSISRWLVEAQVGVVGEGEEWLLIEPDARSMEVPDLNPFTCYSFRMRQVNIVGTSPPSQPSRKIQTLQ 111
4 -54.700d2kbga_ b.1.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  2............EPSPPSIHGQPSSGKSFKLSITKQDDGGAPILEYIVKYRSKDKEDQWLEKKVQGNKDHIILEHLQWTMGYEVQITAANRLGYSEPTVYEFSMPPKP 97
5 -53.800d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}  ali model 3D-neighbors follow..  22  1.....IVQDVPNAPKLTGI---TCQADKAEIHWEQQGDNRSPILHYTIQFNTSFTPAWDAAYEKVPNTDSSFVVQMSPWANYTFRVIAFNKIGASPPSAHSDSCTTQ. 100
6 -53.600d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  24  1SQPDHGRLSPPEAPDRP--TISTASETSVYVTWIPRGNGGFPIQSFRVEYKKLKKVWILATSAIPPSRLSVEITGLEKGISYKFRVRALNMLGESEPSAPSRPYVVS. 107
7 -53.400d1ueya1 b.1.2.1 (A:8-121) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  24  2..TPAPVYDVPNPPFD--LELTDQLDKSVQLSWTPGDDNNSPITKFIIEYEDAHKPGLWHHQTEVSGTQTTAQLNLSPYVNYSFRVMAVNSIGKSLPSEASEQYLTKA 106
8 -53.200d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  22  2.EIFTTLSCEPDIPNPP--RIANRTKNSLTLQWKAPSDNGSKIQNFVLEWDEGKGNGEF-CQCYMGSQKQFKITKLSPAMGCKFRLSARNDYGTSGFSEEVLYYTSG. 104
9 -51.400d2vkwa2 b.1.2.1 (A:601-691) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  21  1..........PSAPKLE--GQMGEDGNSIKVNLIKQDDGGSPIRHYLVRYRALSSEWK-PEIRLPSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVFRT.... 91
10 -51.200d1v5ja1 b.1.2.1 (A:8-102) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  27  2...........SPPRGLVA---VRTPRGVLLHWDPPELVPKRLDGYVLEGRQGSQGWEVLDPAVAGTETELLVPGLIKDVLYEFRLVAFAGSFVSDPSNTANVSTS.. 93
11 -51.200d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  27  1RVETQPEVQLPGPAPN--LRAYAASPTSITVTWETPVSGNGEIQNYKLYYMEKGTDKE---QDVDVSSHSYTINGLKKYTEYSFRVVAYNKHGPGVSTPDVAVRTLSD 103
12 -51.200d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  21  16.....TLDDVPGPPMG--ILFPEVRTTSVRLIWQPPAAPNGIILAYQITHRLNTTTNTATVEVLAPSARQYTATGLKPESVYLFRITAQTRKGWGEAAEALVVTTEKR 117
13 -51.100d2e7ha1 b.1.2.0 (A:8-103) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  16  1..........PPAVSD--IRVTRSSPSSLSLAWAVPRAPSGAVLDYEVKYHEKGAEGPSSVRFLKTSENRAELRGLKRGASYLVQVRARSEAGYGPFGQEHHSQTQLD 96
14 -50.600d2yrza1 b.1.2.1 (A:8-112) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  25  6.....LTAGVPDTPTR--LVFSALGPTSLRVSWQEP-RCERPLQGYSVEYQLLNGGELHRLNIPNPAQTSVVVEDLLPNHSYVFRVRAQSQEGWGREREGVITIESQ. 104
15 -50.000d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  1........EVPSEPGR--LAFNVVSSTVTQLSWAEPAETNGEITAYEVCYGLVNDDNMKKVLVDNPKNRMLLIENLRESQPYRYTVKARNGAGWGPEREAIINLATQ. 102
16 -49.800d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  22  6.....THEDVPGPVGH--LSFSEILDTSLKVSWQEPGEKNGILTGYRISWEEYNRTNTRVTHYLPNVTLEYRVTGLTALTTYTIEVAAMTSKGQGQVSASTISSGVP. 105
17 -49.100d2dm4a1 b.1.2.0 (A:8-102) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  23  1..........PDAPRNLQLSLPREAEGVIVGHWAPPIHTHGLIREYIVEYSRSGSKMW---ASQRAASNFTEIKNLLVNTLYTVRVAAVTSRGIGNWSDSKSITTIK. 94
18 -49.100d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  24  1..........PDQCKPP--QVTCRSATCAQVNWEVPLSNGTDVTEYRLEWGGVEGSMQIC---YCGPGLSYEIKGLSPATTYYCRVQALSVVGAGPFSEVVACVTPPS 93
19 -49.100d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  30  1..........PSMPASP--VLTKAGITWLSLQWSKPSTPSDEGISYILEMEEETSGYGFKPKY-DGEDLAYTVKNLRRSTKYKFKVIAYNSEGKSNPSEVVEFTTCPD 96
20 -48.500d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  24  1..........PGRPT---MMISTTAMNTALLQWHPPKELPGELLGYRLQYCRADEARPNTI-DFGKDDQHFTVTGLHKGTTYIFRLAAKNRAGLGEEFEKEIRTPED. 93
21 -48.400d1wfta1 b.1.2.1 (A:8-117) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  16  1..........PGAPSTVRIS---KNVDGIHLSWEPPTSPSGNILEYSAYLAIRTAQMQDTSCTVTAGQLANAHIDYTSRPAIVFRISAKNEKGYGPATQIRWLQGNSK 110
22 -48.300d2dlha1 b.1.2.1 (A:8-115) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  16  2....VLTQTSEQAPSSADVQARMLSSTTILVQWKEPEEPNGQIQGYRVYYTMDPTQHVNNMKHNVADSQITTIGNLVPQKTYSVKVLAFTSIGDGPLSSDIQVITQT. 107
23 -48.000d4n68a1 b.1.2.0 (A:874-971) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  1........EPSAAPTD--VKATSVSVSEILVAWKHIKESLGRPQGFEVGYWKDMEQEDTETVKTRGNESFVILTGLEGNTLYHFTVRAYNGAGYGPPSSEVSATTKK. 98
24 -47.800d2doca1 b.1.2.0 (A:8-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  23  1QEYILALADVPSSPYGV--KIIELSQTTAKVSFNKPSHGGVPIHHYQVDVKEVASEIWKIVRS-HGVQTMVVLNNLEPNTTYEIRVAAVNGKGQGDYSKIEIFQTLP. 105
25 -47.600d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  1..........PSTVPI--MHQVSATMRSITLSWPQPEQPNGIILDYEIRYYEKEHN-EFNSSMARSQTNTARIDGLRPGMVYVVQVRARTVAGYGKFSGKMCFQTLTD 95
26 -47.600d4n5ua1 b.1.2.0 (A:602-705) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  2.......QSTPSAPPQ-KVMCVSMGSTTVRVSWVPPDSRNGVITQYSVAYEAVDGEDRHVVDGISREHSSWDLVGLEKWTEYRVWVRAHTDVGPGPESSPVLVRTDE. 104
27 -47.400d2db8a1 b.1.2.0 (A:8-104) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  25  2.........VPATPI-LQLEECCTHNNSATLSWKQPPLSTVPADGYILELDDGNGGQFREVYV--GKETMCTVDGLHFNSTYNARVKAFNKTGVSPYSKTLVLQTSE. 96
28 -47.200d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  21  3.....TEEAAPDGPP-MDVTLQPVTSQSIQVTWKAPKKENGVIRGYQIGYRENSPGYSIVEMKATGDSEVYTLDNLKKFAQYGVVVQAFNRAGTGPSSSEINATTLE. 109
29 -46.700d1wfua1 b.1.2.1 (A:8-114) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  19  1..MEPHKVVPLSKPHPP--VVGKVTHHSIELYWDLEKEKRQGPQEQWLRFEEEDPKMHSYGVIYTGYATRHVVEGLEPRTLYKFRLKVTSPSGEYEYSPVVSVATTRE 107
30 -46.500d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  23  1........DTPSSPSIDQV---EPYSSTAQVQFDEPATGGVPILKYKAEWRAVGEEVWHSKAKEASMEGIVTIVGLKPETTYAVRLAALNGKGLGEISAASEFKTQP. 100
31 -46.500d3lpwa1 b.1.2.0 (A:4-102) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  30  1........DTPGPPQDL--KVKEVTKTSVTLTWDPPLDGGSKIKNYIVEKRESTRKAYSTVAT-NCHKTSWKVDQLQEGCSYYFRVLAENEYGIGLPAETAESVKASE 98
32 -46.000d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  2..........LGAPQN--PNAKAAGSRKIHFNWLPP---SGKPMGYRVKYWIQGDSES-EAHLLDSKVPSVELTNLYPYCDYEMKVCAYGAQGEGPYSSLVSCRTHQ. 92
33 -45.900d1wk0a1 b.1.2.1 (A:8-131) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  1DEETKAFEALLSNIVKP--VASDIQARTVVLTWSPPSSLINELYGYEVLISSTGKDGKYKSV-YVGEETNITLNDLKPAMDYHAKVQAEYNSIKGTPSEAEIFTTLSC 114
34 -45.600d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  6.....TFELVPTPPKDVTVVSKEGKPKTIIVNWQPPSEANGKITGYIIYYSTDVNIHDWVIEPVVGNRLTHQIQELTLDTPYYFKIQARNSKGMGPMSEAVQFRTPK. 110
35 -45.600d3lpwa2 b.1.2.0 (A:103-197) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  32  1..........PLPPGK--ITLMDVTRNSVSLSWEKPHDGGSRILGYIVEMQTKGSDKWATCATV--KVTEATITGLIQGEEYSFRVSAQNEKGISDPRQLSVPVIAKD 95
36 -45.500d1ujta1 b.1.2.1 (A:8-114) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  12  5.......KELGDVLVR-LHNPVVLTPTTVQVTWTVD-RQPQFIQGYRVMYRQTSGLQWQNLDAKVPTERSAVLVNLKKGVTYEIKVRPYFNEFQGMDSESKTVRTTEE 107
37 -45.400d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  21  12.ESDLDETRVPEVPSSLHVR---PLVTSIVVSWTPPENQNIVVRGYAIGYGIGSPHA--QTIKVDYKQRYYTIENLDPSSHYVITLKAFNNVGEGIPLYESAVTRPHT 113
38 -45.100d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  18  5....TTCPDKPGIPVKP-SVKGKIHSHSFKITWDPPDNGGATINKYVVEMAEGSNGNKWEMIY-SGATREHLCDRLNPGCFYRLRVYCISDGGQSAVSESLLVQT... 104
39 -44.800d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  1...DVAVRTLSDVPSAANLSLEVRNSKSIMIHWQPPAPANGQITGYKIRYRKASRKSDVTETLVSGTQLSQLIEGLDRGTEYNFRVAALTINGTGPATDWLSAETFES 109
40 -44.600d2yuxa1 b.1.2.0 (A:8-120) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  22  2.SIDIQIIDRPGPPQIV--KIEDVWGENVALTWTPPDDGNAAITGYTIQKADKKSMEWFTVIEH--HRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIA 106
41 -44.500d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  30  1.........PPGPCLPPRL-QGRPKAKEIQLRWGPPVDGGSPISCYSVEMSPIEKDEPREVYQ--GSEVECTVSSLLPGKTYSFRLRAANKMGFGPFSEKCDITTAP. 96
42 -44.500d3wiha_ b.1.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  21  1...........APPQGVTVSKNDGNGTAILVSWQPPPEDNGMVQEYKVWCLGNETRYHIN-KTVDGSTFSVVIPFLVPGIRYSVEVAASTGAGSGVKSEPQFIQL... 95
43 -44.500d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  23  1.........PTSAPQH--LTVEDVTDTTTTLKWRPPRIGAGGIDGYLVEYCLEGSEEWVPANKEPVERCGFTVKDLPTGARILFRVVGVNIAGRSEPATLLQPVTIRE 98
44 -44.400d1uena1 b.1.2.1 (A:8-119) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  18  2.....SGEDLPMAPGN--VRVNVVNSTLAEVHWDPVKSIRGHLQGYRIYYWKTQSSSEKKILTFQGSKTHGMLPGLEPFSHYTLNVRVVNGKGEGPASPDRVFNTPE. 111
45 -44.300d3n1fc_ b.1.2.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  1..........PTGPHI--AYTEAVSDTQIMLKWTYISNNNTPIQGFYIYYRPTDSDNDSKRDVVEGSKQWHMIGHLQPETSYDIKMQCFNEGGESEFSNVMICET... 98
46 -44.200d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  21  6.....TQTGVPGQPLN--FKAEPESETSILLSWTPPR--SDTIANYELVYKDGEHGEEQRI--TIEPGTSYRLQGLKPNSLYYFRLAARSPQGLGASTAEISARTMQ. 101
47 -43.900d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  1...........SGPVEVFITETPSQPNSHPIQWNAP--QPSHISKYILRWRPKNSVGRWKEATIPGHLNSYTIKGLKPGVVYEGQLISIQQYGHQEVTRFDFTTTS.. 93
48 -43.400d2dmka1 b.1.2.0 (A:8-121) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  19  2...GLDYLTAPNPPS-IREELCTASHDTITVHWIS--DDEFSISSYELQYTIFTGQANFISLYNSVKQNHYTVHGLQSGTRYIFIVKAINQAGSRNSEPTRLKTNSQ. 111
49 -43.400d2ee2a1 b.1.2.0 (A:8-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  6.....SAQDAPSAPTE--VGVKVLSSSEISVHWEHVL--EKIVESYQIRYWAAHDEEAANRVQVTSQEYSARLENLLPDTQYFIEVGACNSAGCGPPSDMIEAFTKK. 105
50 -43.200d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}  ali model 3D-neighbors follow..  15  1..........PDVPFKNNVVGQGTEPNNLVISWTPEIEHNAPNFHYYVSWKRDIPAAAWENNNIDWRQNNIVIADQPTFVKYLIKVVAINDRGESNVAAEEVVGYSGE 103
51 -43.000d1wj3a1 b.1.2.1 (A:8-111) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  14  1...TVNVTTKKTPPSQPPGNVVNATDTKVLLNWEQVMENESEVTGYKVFYRTSSQNNVQVLNT----NKTSAELVLPIKEDYIIEVKATTDGGDGTSSEQIRIPRITS 104
52 -42.500d2edya1 b.1.2.0 (A:8-103) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  1.........PSGFPQN--LHVTGLTTSTTELAWDPPAERNGRIISYTVVFRDINSQQEL---QNITTDTRFTLTGLKPDTTYDIKVRAWTSKGSGPLSPSIQSRTMP. 95
53 -42.400d1bpva1 b.1.2.1 (A:1-103) Type I titin module {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  22  1.........PIDPPGKP--VPLNITRHTVTLKWAKPYTGGFKITSYIVEKRDLPNGRWLKANFSNILENEFTVSGLTEDAAYEFRVIAKNAAGASPPSEPSDAITCRD 99
54 -42.400d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  2.......AKADDIVGP--VTHEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEELHLTRKHFALERGCRLRGLSPGN-YSVRIRATSLAGNGSWTEPTYFYVTDY 101
55 -42.100d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}  ali model 3D-neighbors follow..  17  4.......LDPMPVPEL--LEIEEYSETAVVLHWSLADADEHLITGYYAYYRPSSSAGEYFKATIGAHARSFKIAPLETATMYEFKLQSFSAASASEFSA......... 95
56 -42.100d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  1.........PMMPPVG--VQASILSHDTIRITWADNHQKITDSRYYTVRWKTNIPAN-TKYKNANATTLSYLVTGLKPNTLYEFSVMVTKGRRSSTWSMTAHGTTFE. 99
57 -41.600d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  21  1........AESLSGLS--LKLVKKEPRQLELTWAGSPRNPGGNLSYELHVLNQDEE-----WHQMVLEPRVLLTKLQPDTTYIVRVRTLTPLGPGPFSPDHEFRTSP. 93
58 -41.500d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}  ali model 3D-neighbors follow..  18  2.........PPTPP-----NVTRLSDESVMLRWMVPRNDGLPIVIFKVQYRMVGKRKN-KWNSELGKSFTASVTDLKPQHTYRFRILAVYSNNDNKESNTSAKFYLQ. 106
59 -41.400d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  24  4.........KPNPPHNLSVINSEELSSILKLTWTNPSIKSVIILKYNIQYRTKDASTWSQIEDTASTRSSFTVQDLKPFTEYVFRIRCMKEDGKGYWSDWSEEASG.. 102
60 -40.600d2dbja1 b.1.2.0 (A:8-118) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  6.....TTEGAPSVAPLNVTVFLNESSDNVDIRWMKPKQQDGELVGYRISHVWQSAGISKELEEVGQNGSRARISVQVHNATCTVRIAAVTRGGVGPFSDPVKIFIPAH 111
61 -36.700d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  12  5.....TLPAGPPAPPQDVTVQAGVTPATIRVSWRPPVTPTGLSNGANVTGYGAKGQRVAEVIFPTADSTAVELVRLRSLEAKGVTVRTLSAQGESVDSAVAAVPPELL 110
62 -34.100d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  14  3.............NELLKFSYIRTSFDKILLRWEPYWPDFRDLLGFMLFYKEAPYQNVTSNDPKSQNHPGWLMRGLKPWTQYAIFVKTLVTFSDGAKSDIIYVQT... 123
63 -33.400d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  18  1........TNPSVPLD--PISVSNSSSQIILKWKPPSDPNGNITHYLVFWERQAEDEEHRPFEKVVNKESLVISGLRHFTGYRIELQACNQDTPEERCSVAAYVSART 194
64 -32.200d2mnua_ b.1.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  18  4..........VPQLTD--LSFVDITDSSIGLRWTPLN--SSTIIGYRITVVAAGEGIPIFEDFVDSSVGYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQT.... 93
65 -31.300d4lxoa2 b.1.2.1 (A:1418-1509) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  1...........DVPRD--LEVVAATPTSLLISWDAPA---VTVRYYRITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYACRARGDNPDCSKPISINYR. 91
66 -30.600d4lxoa1 b.1.2.1 (A:1326-1417) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  14  2..........LDSPTG--IDFSDITANSFTVHWIAP---RATITGYRIRHHPEHFSGRPREDRVPHSRNSITLTNLTPGTEYVVSIVALNGREESPPLIGQQSTVS.. 92
67 -29.900d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  3...........DRPKG--LAFTDVDVDSIKIAWESP---QGQVSRYRVTYSSPEDGIHELFPAPDGEEDTAELQGLRPGSEYTVSVVALHDDMESQPLIGTQSTAIP. 93
68 -29.800d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  2...........PPPTD--LRFTNIGPDTMRVTWAPPP--SIDLTNFLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYVVSVSSVYEQHESTPLRGRQKT.... 90
69 -29.700d2rb8a_ b.1.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  4...........DAPSQ--IEVKDVTDTTALITWMPP---SQPVDGFELTYGIKDVPGDRTTIDLTEDENQYSIGNLKPDTEYEVSLISRRGDMSSNPAKETFTTGL.. 93
70 -29.100d3r8qa1 b.1.2.0 (A:1-92) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  21  3...........PAPTD--LKFTQVTPTSLSAQWTPP---NVQLTGYRVRVTPKEKTGPMKEINLAPDSSSVVVSGLMVATKYEVSVYALKDTLTSRPAQGVVTT.... 90
71 -28.500d4lpva1 b.1.2.0 (A:1-91) automated matches {Artificial gene [TaxId: 32630]}  ali model 3D-neighbors follow..  21  3.............PAPKNLVVSEVTEDSLRLSWTAPD---AAFDSFMIQYQESEKVGEAINLTVPGSERSYDLTGLKPGTEYTVSIYGVLVVHKLTFPLSAEFTT... 91
72 -28.100d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  18  1..........PDGPTQ--LRALNLTEGFAVLHWKPP---QNPVDTYDIQVTAPGAP--PLQAETPGSAVDYPLHDLVLHTNYTATVRGLRGPNLTSPASITFTTGLE. 90
73 -27.500d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  1.........QPDPPANITVTAVARNPRWLSVTWQDPHNSSFYRLRFELRYRAERSKTFTTW-MVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGT. 99
74 -27.300d2cuia1 b.1.2.1 (A:8-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  1...........SRPRLSQLSVTDVTTSSLRLNWEAPP---GAFDSFLLRFGVPSPSLLQRELMVPGTRHSAVLRDLRSGTLYSLTLYGLRGPHKADSIQGTART.... 98
75 -26.700d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  21  1.........KPRAPGN--LTVHTNVSDTLLLTWSNPYPPDNYLLTYAVNIWSENDPADFRIYNVTYLEPSLRISTLKSGISYRARVRAWAQAYNTTWSEWSPSTK... 99

FFAS is supported by the NIH grant R01-GM087218-01
1 0 8 9 2 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ginalski K, Grishin NV, Godzik A., Rychlewski L. Practical lessons from protein structure prediction. Nucleic Acids Res. 2005 Apr 1;33(6):1874-91.