current user: public

Query: d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]}, from SCOP175

Results of FFAS03 search in SCOP175
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
2 -60.800d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  28  1EHAPATTGPLPSAPRD--VVASLVSTRFIKLTWRTPSDPHGDNLTYSVFYTKEGIARERVENTSHPGEMQVTIQNLMPATVYIFRVMAQNKHGSGESSAPLRVETQPE 107
3 -58.700d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  25  7.GKNYDLSDLPGPPSKPQVT--DVTKNSVTLSWQPGTPGTLPASAYIIEAFSQSVSNSWQTVANHVKTTLYTVRGLRPNTIYLFMVRAINPQGLSDPSPMSDPVRTQD 111
4 -56.200d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  24  6.....VPPELPGPPTN--LGISNIGPRSVTLQFRPGYDGKTSISRWLVEAQVGVVGEGEEQLSNEPDARSMEVPDLNPFTCYSFRMRQVNIVGTSPPSQPSRKIQTLQ 111
5 -56.100d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]}  ali model 3D-neighbors follow..  22  1.....IVQDVPNAPKLTGI---TCQADKAEIHWEQQGDNRSPILHYTIQFNTSFTPSWDAAYEKVPNTDSSFVVQMSPWANYTFRVIAFNKIGASPPSAHSDSCTTQ. 100
6 -55.800d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  22  2.EIFTTLSCEPDIPNPPRIA--NRTKNSLTLQWKAPSDNGSKIQNFVLEWDEGKGNGEF-CQCYMGSQKQFKITKLSPAMGCKFRLSARNDYGTSGFSEEVLYYTSG. 104
7 -55.400d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  22  1.........PTSAPQHLTVE--DVTDTTTTLKWRPPRIGAGGIDGYLVEYCLEGSEEWVPANKEPVERCGFTVKDLPTGARILFRVVGVNIAGRSEPATLLQPVTIRE 98
8 -55.400d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  22  2.......SSGSSGLSPPRGLVAVRTPRGVLLHWDPPELVPKRLDGYVLEGRQGSQGWEVLDPAVAGTETELLVPGLIKDVLYEFRLVAFAGSFVSDPSNTANVSTSGL 102
9 -54.300d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  21  1SQPDHGRLSPPEAPDRPTIS--TASETSVYVTWIPRGNGGFPIQSFRVEYKKLKKVGDLATSAIPPSRLSVEITGLEKGISYKFRVRALNMLGESEPSAPSRPYVVS. 107
10 -54.000d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  1..........PSAPKL--EGQMGEDGNSIKVNLIKQDDGGSPIRHYLVRYRALSSE-WKPEIRLPSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTAA.. 93
11 -53.900d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  31  1..........PSMPASPVLT--KAGITWLSLQWSKPGTPSDEGISYILEMEEETSGYGFKPK-YDGEDLAYTVKNLRRSTKYKFKVIAYNSEGKSNPSEVVEFTTCPD 96
12 -53.400d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  22  1...PQLVRTHEDVPGPVGLSFSEILDTSLKVSWQEPGEKNGILTGYRISWEEYNRTNTRVTHYLPNVTLEYRVTGLTALTTYTIEVAAMTSKGQGQVSASTISSGVP. 105
13 -53.000d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  24  1...RVETQPEVQLPGPAPLRAYAASPTSITVTWETPVSGNGEIQNYKLYYMEKGTDKEQ---DVDVSSHSYTINGLKKYTEYSFRVVAYNKHGPGVSTPDVAVRTLSD 103
14 -53.000d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  1........EVPSEPGR--LAFNVVSSTVTQLSWAEPAETNGEITAYEVCYGLVNDDNMKKVLVDNPKNRMLLIENLRESQPYRYTVKARNGAGWGPEREAIINLATQ. 102
15 -52.400d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  23  7GPTPAPVYDVPNPPFD--LELTDQLDKSVQLSWTPGDDNNSPITKFIIEYEDAMHKPGLWHHQTESGTQTTAQLNLSPYVNYSFRVMAVNSIGKSLPSEASEQYLTKA 113
16 -52.000d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  1..........PSTVPI--MHQVSATMRSITLSWPQPEQPNGIILDYEIRYYEKEHNEFNSS-MARSQTNTARIDGLRPGMVYVVQVRARTVAGYGKFSGKMCFQTLTD 95
17 -52.000d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  25  1..........PDQCKPPQVT--CRSATCAQVNWEVPLSNGTDVTEYRLEWGGVEGSMQICY---CGPGLSYEIKGLSPATTYYCRVQALSVVGAGPFSEVVACVTPPS 93
18 -51.800d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  24  1.............PGRPTMMISTTAMNTALLQWHPPKELPGELLGYRLQYCRADEARPNTID-FGKDDQHFTVTGLHKGTTYIFRLAAKNRAGLGEEFEKEIRTPED. 93
19 -51.300d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  22  1........DTPSSPSIDQV---EPYSSTAQVQFDEPATGGVPILKYKAEWRAVGEEVWHSKWKEASMEGIVTIVGLKPETTYAVRLAALNGKGLGEISAASEFKTQP. 100
20 -51.000d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  23  1........SPIDPPGKPVPL--NITRHTVTLKWAKPYTGGFKITSYIVEKRDLPNGRWLKANFSNILENEFTVSGLTEDAAYEFRVIAKNAAGASPPSEPSDAITCRD 100
21 -50.900d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  22  9.HPPILERTLDDVPGPPMILFPEVRTTSVRLIWQPPAAPNGIILAYQITHRLNTTTNTATVEVLAPSARQYTATGLKPESVYLFRITAQTRKGWGEAAEALVVTTEKR 117
22 -50.500d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  5....TTCPDKPGIPVKPSV-KGKIHSHSFKITWDPPDNGGATINKYVVEMAEGSNGNKWE-MIYSGATREHLCDRLNPGCFYRLRVYCISDGGQSAVSESLLVQTPA. 106
23 -50.000d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  1...........SGPVEVFITETPSQPNSHPIQWNAP--QPSHISKYILRWRPKNSVGRWKEATIPGHLNSYTIKGLKPGVVYEGQLISIQQYGHQEVTRFDFTTTS.. 93
24 -49.800d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  6.....TFELVPTPPKDVTVVSKEGKPKTIIVNWQPPSEANGKITGYIIYYSTDVNAEIHVIEPVVGNRLTHQIQELTLDTPYYFKIQARNSKGMGPMSEAVQFRTPK. 110
25 -49.700d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  31  1..........PPGPCLPPRLQGRPKAKEIQLRWGPPVDGGSPISCYSVEMSPIEKDEPREVY--QGSEVECTVSSLLPGKTYSFRLRAANKMGFGPFSEKCDITTAP. 96
26 -48.800d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  24  4.........KPNPPHNLSVINSEELSSILKLTWTNPSIKSVIILKYNIQYRTKDASTWSQIPDTASTRSSFTVQDLKPFTEYVFRIRCMKEDGKGYWSDWSEEASGIT 104
27 -48.100d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}  ali model 3D-neighbors follow..  20  2............PPTPPNVT--RLSDESVMLRWMVPRNDGLPIVIFKVQYRMVGKRKKPKWNSELGKSFTASVTDLKPQHTYRFRILAVYSNNDNKESNTSAKFYLQ. 106
28 -48.000d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  21  1...DIQVITQTGVPGQPLFKAEPESETSILLSWTPPRSD--TIANYELVYKDGEHGEEQRITI--EPGTSYRLQGLKPNSLYYFRLAARSPQGLGASTAEISARTMQ. 101
29 -47.700d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]}  ali model 3D-neighbors follow..  15  1..........PDVPFKNNVVGQGTEPNNLVISWTPMIEHNAPNFHYYVSWKRDIPAAWENNNIFDWRQNNIVIADQPTFVKYLIKVVAINDRGESNVAAEEVVGYSGE 103
30 -47.600d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  21  12.ESDLDETRVPEVPSSLHV---RPLVTSIVVSWTPPENQNIVVRGYAIGYGIGSPHAQTIK--VDYKQRYYTIENLDPSSHYVITLKAFNNVGEGIPLYESAVTRPH. 112
31 -47.600d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}  ali model 3D-neighbors follow..  15  2.....AALDPMPVPEL--LEIEEYSETAVVLHWSLADADEHLITGYYAYYRPSSSGEYFKATIEGAHARSFKIAPLETATMYEFKLQSFSAASASEFSA......... 95
32 -47.500d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  2.SSGSSGHSGEDLPMVANVRVNVVNSTLAEVHWDPVKSIRGHLQGYRIYYWKTQSSSKKKILTFQGSKTHGMLPGLEPFSHYTLNVRVVNGKGEGPASPDRVFNTPEG 119
33 -46.900d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  2.......AKADDIVGP--VTHEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEELHLCDTHFALERGCRLRGLSPGN-YSVRIRATSLAGNGSWTEPTYFYVTDY 101
34 -46.400d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  1...DVAVRTLSDVPSAANLSLEVRNSKSIMIHWQPPATQNGQITGYKIRYRKASRKSDVTETLVSGTQLSQLIEGLDRGTEYNFRVAALTINGTGPATDWLSAETFES 109
35 -46.400d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  15  3.....SGSSGPGAPSTVRI---SKNVDGIHLSWEPPTSPSGNILEYSAYLAIRTAQMQDNPSTVTAGQLANAHIDYTSRPAIVFRISAKNEKGYGPATQIRWLQGNSK 117
36 -46.100d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  21  11.....HKVVPLSKPHPPVV--GKVTHHSIELYWDLEQKEKRQWLRFSIEEEDPKMHSYGVI--YTGYATRHVVEGLEPRTLYKFRLKVTSPSGEYEYSPVVSVATTRE 114
37 -46.000d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  1.........QPDPPANITVTAVARNPRWLSVTWQDPHNSSFYRLRFELRYRAERSKTFTTWM-VKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTP 100
38 -45.900d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  16  1.........PVAGPYI--TFTDAVNETTIMLKWMYISNNNTPIHGFYIYYRPTDSDNDSKKDMVEGDRYWHSISHLQPETSYDIKMQCFNEGGESEFSNVMICETKAR 101
39 -45.800d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  22  1......ISTEEAAPDGPDVTLQPVTSQSIQVTWKAPELQNGVIRGYQIGYRENSPGSNGQYSKATGDSEVYTLDNLKKFAQYGVVVQAFNRAGTGPSSSEINATTLE. 109
40 -45.600d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  16  1.........PMMPPVG--VQASILSHDTIRITWADNSQKITDSRYYTVRWKTNIPANT-KYKNANATTLSYLVTGLKPNTLYEFSVMVTKGRRSSTWSMTAHGTTFE. 99
41 -44.300d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  22  1........AESLSGLS--LKLVKKEPRQLELTWAGSRRNPGGNLSYELHVLNQDEEWHQMV-----LEPRVLLTKLQPDTTYIVRVRTLTPLGPGPFSPDHEFRTSP. 93
42 -43.600d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  19  6.SGDEETKAFEALLSNIKPVASDIQARTVVLTWSPPSSLINELYGYEVLISSTGKDGKYKS-VYVGEETNITLNDLKPAMDYHAKVQAEYNSIKGTPSEAEIFTTLSC 121
43 -43.400d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  21  3...........GAPQN--PNAKAAGSRKIHFNWLPP---SGKPMGYRVKYWIQGDSES-EAHLLDSKVPSVELTNLYPYCDYEMKVCAYGAQGEGPYSSLVSCRTHQ. 92
44 -43.300d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  12  1.........KLEPPMLQALDVVSHQPGCLWLSWKPWKPSEYMEQECELRYQPQKGANWTLVFHLPSSKDQFELCGLHQAPVYTLQMRCIRSSLPGFWSPWSPGLQLR. 103
45 -43.000d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  12  2SSGSSGRQVQKELGDVLLHNPVVLTPTTVQVTWTVDRQ-PQFIQGYRVMYRQTSGSSWQNLDAKVPTERSAVLVNLKKGVTYEIKVRPYFNEFQGMDSESKTVRTTEE 114
46 -43.000d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  1.........KPRAPGN--LTVHTNVSDTLLLTWSNPYPPDNYLLTYAVNIWSENDPADFRIYNVLEPSLRIAASTLKSGISYRARVRAWAQAYNTTWSEWSPSTKWH. 101
47 -42.600d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  1.....MRGSEVPQLTD--LSFVDITDSSIGLRWTPL--NSSTIIGYRITVVAAGEGIPIFEDFVDSSVGYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQT.... 95
48 -42.500d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  2.................DLEVVAATPTSLLISWDAP---AVTVRYYRITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRT 89
49 -42.200d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  6.SGTVNVTTKKTPPSQPGNVVWNATDTKVLLNWEQVMENESEVTGYKVFYRTSSQNNVQVLN----TNKTSAELVLPIKEDYIIEVKATTDGGDGTSSEQIRIPRITS 111
50 -42.200d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  14  2...........DSPTG--IDFSDITANSFTVHWIAP---RATITGYRIRHHPEHFSGRPREDRVPHSRNSITLTNLTPGTEYVVSIVALNGREESPLLIGQQST.... 89
51 -41.500d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  2..........IDRPKG--LAFTDVDVDSIKIAWESP---QGQVSRYRVTYSSPEDGIHELFPAPDGEEDTAELQGLRPGSEYTVSVVALHDDMESQPLIGTQSTAIP. 93
52 -40.900d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  16  2..........LDAPSQ--IEVKDVTDTTALITWFKP---LAEIDGIELTYGIKDVPGDRTTIDLTEDENQYSIGNLKPDTEYEVSLISRRGDMSSNPAKETFTT.... 90
53 -40.700d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  1.............PAPTDLKFTQVTPTSLSAQWTPP---NVQLTGYRVRVTPKEKTGPMKEINLAPDSSSVVVSGLMVATKYEVSVYALKDTLTSRPAQGVVTTL... 89
54 -40.500d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  11  2.EFSTLPAGPPAPPQDVTVQ-AGVTPATIRVSWRPPVLNGANVTGYGVYAKGQRVA---EVIFPTADSTAVELVRLRSLEAKGVTVRTLSAQGESVDSAVAAVPPELL 110
55 -40.500d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  2...........PPPTD--LRFTNIGPDTMRVTWAPP--PSIDLTNFLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYVVSVSSVYEQHESTPLRGRQKT.... 90
56 -39.300d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  14  2.........EPEPPRNLTLEVLKDKKTYLWVKWSPPTKTGWFTMEYEIRLKPEEAEEWEIHFTG--HQTQFKVFDLYPGQKYLVQTRCKPDHGYSRWSQESSVEM... 102
57 -39.000d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  1.........PLSPPTNLHLE-ANPDTGVLTVSWERS--TTPDITGYRITTTPTNGQQGNSLEVVHADQSSCTFDNLSPGLEYNVSVYTVKDDKESVPISDTIIPA... 94
58 -39.000d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  18  7.........KPDPPENVVARPVPSNPRRLEVTWQTPPDPESFPLKFFLRYRPLILDQWQHVELS--NGTAHTITDAYAGKEYIIQVAAKDN-EIGTWSDWSVAAHATP 105
59 -39.000d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  18  1........TNPSVPLD--PISVSNSSSQIILKWKPPSDPNGNITHYLVFWERQAEDSELRPFEKVVNKESLVISGLRHFTGYRIELQACNQDTPEERCSVAAYVSART 194
60 -38.700d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  27  4.........LLDAPVGLVARLAD-ESGHVVLRWLPPETPMTSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPGGFWSAWSEPVSLL. 103
61 -38.600d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  10  1.........KPDPPKNLQLKPLK-NSRQVEVSWEYPDTWSTPSLTFCVQVQGKSKREKKDR-----VFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASV..... 92
62 -38.100d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  21  1..........PDPPIALNWTSLTGIHADIQVRWEAPRQKGWMVLEYELQYKEVNETKWKMMDPI--LTTSVPVYSLKVDKEYEVRVRSKQRNSGGEFSEVLYVTLPQ. 105
63 -38.000d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  20  2...........DSPRD--LMVTASSETSISLIWTKA---SGPIDHYRITFTPSSGISSEV--TVPRDRTSYTLTDLEPGAEYIISITAERGRQQSLESTVDA...... 85
64 -37.900d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  16  2..........VSPPRR--ARVTDATETTITISWRTK---TETITGFQVDAVPANGQTPIQR-TIKPDVRSYTITGLQPGTDYKIYLYTLNDNARSSPVVIDASTA... 90
65 -37.800d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  10  2..........ENELLK--FSYIRTSFDKILLRWEPYPPDFRDLLGFMLFYKEAPYQNVTSNDPKSQNHPGWLMRGLKPWTQYAIFVKTLVTFSDERRTAKSDIIYVQ. 122
66 -37.700d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  16  2.........RLMAPIS--LQVVHVETHRCNISWEISSHYFERHLEFEARTLSPGHTWEAPLLTLKQKQEWICLETLTPDTQYEFQVRVKPLQGESPWSQPLAFRTKP. 104
67 -37.400d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  16  2...........DAPKN--LRVGSRTATSLDLEWDNS---EAEAQEYKVVYSTLAGEQYHEVPKGIGPTTKTTLTDLVPGTEYGVGISAVMNSKQSIPATMNART.... 91
68 -37.400d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]}  ali model 3D-neighbors follow..  17  2...........GSPKG--ISFSDITENSATVSWTPP---RSRVDSYRVSYVPITGGTPNVV-TVDGSKTRTKLVKLVPGVDYNVNIISVKGFEESEPISGILKT.... 88
69 -36.900d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  23  2..........LEAPRD--LEAKEVTPRTALLTWTEP---PVRPAGYLLSFHTPGGQTQEI--LLPGGITSHQLLGLFPSTSYNARLQAMWGQSLLPPVSTSFTTG... 89
70 -36.700d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]}  ali model 3D-neighbors follow..  18  1...........DNPKD--LEVSDPTETTLSLRWRRP---VAKFDRYRLTYVSPSGKKNEM--EIPVDSTSFILRGLDAGTEYTISLVAEKGRHKSKPTTIKGSTV... 87
71 -35.900d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  13  3.........PPEKPKN--LSCIVNEGKKMRCEWDGGRETHLE-TNFTLKSEWATHKFADCKAKRDTPTSCTVDYSTVYFVNIEVWVEAENALGKVTSDHIN....... 91
72 -35.700d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  13  1.......SGSRPRLSQ--LSVTDVTTSSLRLNWEAPP---GAFDSFLLRFGVPSPSTLQRELMVPGTRHSAVLRDLRSGTLYSLTLYGLRGPHKADSIQGTARTL... 101
73 -35.500d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  16  5.........QMAPPSLQVTK----DGDSYSLRWETMMRYEHIDHTFEIQYRKDTATWKDSKTETLQNAHSMALPALEPSTRYWARVRVRTSRTNGIWSEWSEARS... 99
74 -35.400d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  16  1......AGYPPASPSNLSC-LMHLTTNSLVCQWEPGPETHLP-TSFILKSFRSRADCQYQGAKKRQNNCSIPRKNLLLYQYMAIWVQAENMLGSSESPKLC....... 100
75 -35.200d1f6fb1 b.1.2.1 (B:5-100) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  16  1...........GKPEI--HKCRSPDKETFTCWWNPGTDGGLP-TNYSLTYSKEGEKTTYECPDYGPNSCFFSKQYTSIWKIYIITVNATNQMGSSSSDPLY....... 90

FFAS is supported by the NIH grant R01-GM087218-01
6 0 5 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ye Y, Li Z, and Godzik A. Modeling and Analyzing Three-Dimensional Structures of Human Disease Proteins Pacific Symposium on Biocomputing 11:439-450(2006) [PDF]