current user: public

Query: d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]}, from SCOP175

Results of FFAS03 search in SCOP175
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
2 -59.500d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  28  1EHAPATTGPLPSAPRD--VVASLVSTRFIKLTWRTPSDPHGDNLTYSVFYTKEGIARERVENTSHPGEMQVTIQNLMPATVYIFRVMAQNKHGSGESSAPLRVETQPE 107
3 -57.900d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  24  7.GKNYDLSDLPGPPSKP--QVTDVTKNSVTLSWQPGTPGTLPASAYIIEAFSQSVSNSWQTVANHVKTTLYTVRGLRPNTIYLFMVRAINPQGLSDPSPMSDPVRTQD 111
4 -55.200d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  24  9........ELPGPPTN--LGISNIGPRSVTLQFRPGYDGKTSISRWLVEAQVGVVGEGEEWLLNEPDARSMEVPDLNPFTCYSFRMRQVNIVGTSPPSQPSRKIQTLQ 111
5 -54.800d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]}  ali model 3D-neighbors follow..  21  2......VQDVPNAPKLTGI---TCQADKAEIHWEQQGDNRSPILHYTIQFNTSTPASWDAAYEKVPNTDSSFVVQMSPWANYTFRVIAFNKIGASPPSAHSDSCTTQ. 100
6 -54.600d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  24  1SQPDHGRLSPPEAPDRP--TISTASETSVYVTWIPRGNGGFPIQSFRVEYKKKVGDWILATSAIPPSRLSVEITGLEKGISYKFRVRALNMLGESEPSAPSRPYVVS. 107
7 -53.900d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  22  2.EIFTTLSCEPDIPNPP--RIANRTKNSLTLQWKAPSDNGSKIQNFVLEWDEGKGN-GEFCQCYMGSQKQFKITKLSPAMGCKFRLSARNDYGTSGFSEEVLYYTSG. 104
8 -53.400d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  1..........PSAPKL--EGQMGEDGNSIKVNLIKQDDGGSPIRHYLVRYRALSSE-WKPEIRLPSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTAA.. 93
9 -51.900d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  30  1..........PSMPASP--VLTKAGITWLSLQWSKPSTPSDEGISYILEMEEETSGYGFKPKY-DGEDLAYTVKNLRRSTKYKFKVIAYNSEGKSNPSEVVEFTTCPD 96
10 -51.700d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  23  7GPTPAPVYDVPNPPFD--LELTDQLDKSVQLSWTPGDDNNSPITKFIIEYEDAMHKPGLWHHQTESGTQTTAQLNLSPYVNYSFRVMAVNSIGKSLPSEASEQYLTKA 113
11 -51.600d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  1........EVPSEPGR--LAFNVVSSTVTQLSWAEPAETNGEITAYEVCYGLVNDDNMKKVLVDNPKNRMLLIENLRESQPYRYTVKARNGAGWGPEREAIINLATQ. 102
12 -50.800d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  24  1...RVETQPEVQLPGPAPLRAYAASPTSITVTWETPVSGNGEIQNYKLYYMEKGTDKE---QDVDVSSHSYTINGLKKYTEYSFRVVAYNKHGPGVSTPDVAVRTLSD 103
13 -50.200d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  22  8SHPPILERTLDDVPGPPMILFPEVRTTSVRLIWQPPAAPNGIILAYQITHRLNTTTNTATVEVLAPSARQYTATGLKPESVYLFRITAQTRKGWGEAAEALVVTTEKR 117
14 -49.400d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  22  6.....THEDVPGPVGH--LSFSEILDTSLKVSWQEPGEKNGILTGYRISWEEYNRTNTRVTHYLPNVTLEYRVTGLTALTTYTIEVAAMTSKGQGQVSASTISSGVP. 105
15 -49.400d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  25  1.............PGRPTMMISTTAMNTALLQWHPPKELPGELLGYRLQYCRADEARPNTI-DFGKDDQHFTVTGLHKGTTYIFRLAAKNRAGLGEEFEKEIRTP... 91
16 -49.100d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  24  1..........PDQCKPP--QVTCRSATCAQVNWEVPLSNGTDVTEYRLEWGGVEGSMQI---CYCGPGLSYEIKGLSPATTYYCRVQALSVVGAGPFSEVVACVTPPS 93
17 -48.800d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  23  2.....SSGSSGLSP--PRGLVAVRTPRGVLLHWDPPELVPKRLDGYVLEGRQGSQGWEVLDPAVAGTETELLVPGLIKDVLYEFRLVAFAGSFVSDPSNTANVSTSGL 102
18 -48.600d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  22  1........DTPSSPSIDQV---EPYSSTAQVQFDEPATGGVPILKYKAEWRAVGEEVWHSKWKEASMEGIVTIVGLKPETTYAVRLAALNGKGLGEISAASEFKTQP. 100
19 -48.400d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  23  1.........PTSAPQH--LTVEDVTDTTTTLKWRPPRIGAGGIDGYLVEYCLEGSEEWVPANKEPVERCGFTVKDLPTGARILFRVVGVNIAGRSEPATLLQPVTIRE 98
20 -48.000d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  31  1..........PPGPCLPPRLQGRPKAKEIQLRWGPPVDGGSPISCYSVEMSPIEKDEPREVYQ--GSEVECTVSSLLPGKTYSFRLRAANKMGFGPFSEKCDITTAP. 96
21 -47.700d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  1..........PSTVPI--MHQVSATMRSITLSWPQPEQPNGIILDYEIRYYEKEHNEFNS-SMARSQTNTARIDGLRPGMVYVVQVRARTVAGYGKFSGKMCFQTLTD 95
22 -47.100d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  6.....TFELVPTPPKDVTVVSKEGKPKTIIVNWQPPSEANGKITGYIIYYSTDVNAEIHVIEPVVGNRLTHQIQELTLDTPYYFKIQARNSKGMGPMSEAVQFRTPK. 110
23 -46.800d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  1...........SGPVEVFITETPSQPNSHPIQWNAP--QPSHISKYILRWRPKNSVGRWKEATIPGHLNSYTIKGLKPGVVYEGQLISIQQYGHQEVTRFDFTTTS.. 93
24 -46.100d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  22  1........SPIDPPGKP--VPLNITRHTVTLKWAKPYTGGFKITSYIVEKRDLPNGRWLKANFSNILENEFTVSGLTEDAAYEFRVIAKNAAGASPPSEPSDAITCRD 100
25 -45.600d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}  ali model 3D-neighbors follow..  16  4.......LDPMPVPEL--LEIEEYSETAVVLHWSLADADEHLITGYYAYYRPSSSAEYFKATIEGAHARSFKIAPLETATMYEFKLQSFSAASASEFSA......... 95
26 -45.600d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  18  5....TTCPDKPGIPVKPSV-KGKIHSHSFKITWDPPKNGGATINKYVVEMAEGSNGNK--EMIYSGATREHLCDRLNPGCFYRLRVYCISDGGQSAVSESLLVQT... 104
27 -45.500d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]}  ali model 3D-neighbors follow..  15  1..........PDVPFKNNVVGQGTEPNNLVISWTPMIEHNAPNFHYYVSWKRDIPAAWENNNIFDWRQNNIVIADQPTFVKYLIKVVAINDRGESNVAAEEVVGYSGE 103
28 -45.400d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}  ali model 3D-neighbors follow..  17  2............PPTPP--NVTRLSDESVMLRWMVPRNDGLPIVIFKVQYRMVGKRNWQTTNDELGKSFTASVTDLKPQHTYRFRILAVYSNNDNKESNTSAKFYLQ. 106
29 -45.100d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  8DEETKAFEALLSNIVKP--VASDIQARTVVLTWSPPESSVPELYGYEVLISSTGKDGKYKS-VYVGEETNITLNDLKPAMDYHAKVQAEYNSIKGTPSEAEIFTTLSC 121
30 -45.100d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  21  1...DIQVITQTGVPGQPLFKAEPESETSILLSWTPPR--SDTIANYELVYKDGEHGEEQRITI--EPGTSYRLQGLKPNSLYYFRLAARSPQGLGASTAEISARTMQ. 101
31 -44.800d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  2.SSGSSGHSGEDLPMVANVRVNVVNSTLAEVHWDPVKSIRGHLQGYRIYYWKTQSSSEKKILTFQGSKTHGMLPGLEPFSHYTLNVRVVNGKGEGPASPDRVFNTPEG 119
32 -44.700d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  22  1......ISTEEAAPDGPDVTLQPVTSQSIQVTWKAPKKENGVIRGYQIGYRENSPGYSIVEMKATGDSEVYTLDNLKKFAQYGVVVQAFNRAGTGPSSSEINATTLE. 109
33 -44.600d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  2..........LGAPQN--PNAKAAGSRKIHFNWLPP---SGKPMGYRVKYWIQGDSESE-AHLLDSKVPSVELTNLYPYCDYEMKVCAYGAQGEGPYSSLVSCRTHQ. 92
34 -44.000d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  17  1..........PAGPYI--TFTDAVNETTIMLKWMYISNNNTPIHGFYIYYRPTDSDNDSKKDMVEGDRYWHSISHLQPETSYDIKMQCFNEGGESEFSNVMICETKAR 101
35 -43.900d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  15  3.....SGSSGPGAPSTVRI---SKNVDGIHLSWEPPTSPSGNILEYSAYLAIRTAQMQKTSCTVTAGQLANAHIDYTSRPAIVFRISAKNEKGYGPATQIRWLQGNSK 117
36 -43.700d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  16  1.........PMMPPVG--VQASILSHDTIRITWADNSQKITDSRYYTVRWKTNIPANTKYK-NANATTLSYLVTGLKPNTLYEFSVMVTKGRRSSTWSMTAHGTTFE. 99
37 -43.200d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  22  19........RVPEVPSSLHV---RPLVTSIVVSWTPPENQNIVVRGYAIGYGIGSPHA--QTIKVDYKQRYYTIENLDPSSHYVITLKAFNNVGEGIPLYESAVTRPHT 113
38 -43.100d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  2.......AKADDIVGP--VTHEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEELHLTRKHFALERGCRLRGLSPGN-YSVRIRATSLAGNGSWTEPTYFYVTDY 101
39 -43.100d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  1...DVAVRTLSDVPSAANLSLEVRNSKSIMIHWQPPATQNGQITGYKIRYRKASRKSDVTETLVSGTQLSQLIEGLDRGTEYNFRVAALTINGTGPATDWLSAETFES 109
40 -42.900d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  20  13.......VVPLSKPHPP--VVGKVTHHSIELYWDLEQKEKRQWLRFSIEEEDPKMHSYGVIYT--GYATRHVVEGLEPRTLYKFRLKVTSPSGEYEYSPVVSVATTRE 114
41 -42.000d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  14  5SSGTVNVTTKKTPPSQPPGNVWNATDTKVLLNWEQVMENESEVTGYKVFYRTSSQNNVQVLNT----NKTSAELVLPIKEDYIIEVKATTDGGDGTSSEQIRIPRITS 111
42 -41.900d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  21  1........AESLSGLS--LKLVKKEPRQLELTWAGSRRNPGGNLSYELHVLNQDEE-----WHQMVLEPRVLLTKLQPDTTYIVRVRTLTPLGPGPFSPDHEFRTSP. 93
43 -40.900d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  12  2SSGSSGRQVQKELGDVLLHNPVVLTPTTVQVTWTVD-RQPQFIQGYRVMYRQTSGLQWQNLDAKVPTERSAVLVNLKKGVTYEIKVRPYFNEFQGMDSESKTVRTTEE 114
44 -38.900d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  18  3.......GSEVPQLTD--LSFVDITDSSIGLRWTPL--NSSTIIGYRITVVAAGEGIPIFEDFVDSSVGYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQT.... 95
45 -38.700d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  13  1....VEFSTLPAGPPAPPQDVTGVTPATIRVSWRPPVSNGANVTGYGVYAKGQRV---AEVIFPTADSTAVELVRLRSLEAKGVTVRTLSAQGESVDSAVAAVPPELL 110
46 -38.700d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  24  4.........KPNPPHNLSVINSEELSSILKLTWTNPSIKSVIILKYNIQYRTKDASTWSQIPDTASTRSSFTVQDLKPFTEYVFRIRCMKEDGKGYWSDWSEEASGI. 103
47 -35.500d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  10  3...........NELLK--FSYIRTSFDKILLRWEPYWPDFRDLLGFMLFYKEAPYQNVTSNDPKSQNHPGWLMRGLKPWTQYAIFVKTLVTFSDERRTYKSDIIYVQ. 122
48 -33.700d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  14  2...........DSPTG--IDFSDITANSFTVHWIAPR---ATITGYRIRHHPEHFSGRPREDRVPHSRNSITLTNLTPGTEYVVSIVALNGREESPLLIGQQST.... 89
49 -33.100d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  18  1........TNPSVPLD--PISVSNSSSQIILKWKPPSDPNGNITHYLVFWERQAEDSELRPFEKVVNKESLVISGLRHFTGYRIELQACNQDTPEERCSVAAYVSART 194
50 -32.700d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  3...........DRPKG--LAFTDVDVDSIKIAWESPQ---GQVSRYRVTYSSPEDGIHELFPAPDGEEDTAELQGLRPGSEYTVSVVALHDDMESQPLIGTQSTAIP. 93
51 -32.600d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  3..................LEVVAATPTSLLISWDAPA---VTVRYYRITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRT 89
52 -32.500d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  2..........LDAPSQ--IEVKDVTDTTALITWFKPL---AEIDGIELTYGIKDVPGDRTTIDLTEDENQYSIGNLKPDTEYEVSLISRRGDMSSNPAKET....... 87
53 -32.300d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  16  2...........PPPTD--LRFTNIGPDTMRVTWAPPP--SIDLTNFLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYVVSVSSVYEQHESTPLRGR....... 87
54 -31.500d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  21  1.............PAPTDLKFTQVTPTSLSAQWTPP---NVQLTGYRVRVTPKEKTGPMKEINLAPDSSSVVVSGLMVATKYEVSVYALKDTLTSRPAQ......... 83
55 -30.200d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  16  1.........PLSPPTNLHLE-ANPDTGVLTVSWERST--TPDITGYRITTTPTNGQQGNSLEVVHADQSSCTFDNLSPGLEYNVSVYTVKDDKESVPISDT....... 90
56 -29.500d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  16  2...........DAPKN--LRVGSRTATSLDLEWDNSE---AEAQEYKVVYSTLAGEQYHEVLKGIGPTTKTTLTDLVPGTEYGVGISAVMNSKQSIPATMNARTE... 92
57 -28.800d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  2..........VSPPRR--ARVTDATETTITISWRTK---TETITGFQVDAVPANGQTPIQR-TIKPDVRSYTITGLQPGTDYKIYLYTLNDNARSSPVVIDAST.... 89
58 -28.300d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  20  2...........DSPRD--LMVTASSETSISLIWTKAS---GPIDHYRITFTPSSGI--SSEVTVPRDRTSYTLTDLEPGAEYIISITAERGRQQSLESTVD....... 84
59 -28.200d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  14  1.........SGSRPRLSQLSVTDVTTSSLRLNWEAPP---GAFDSFLLRFGVPSPST-QRELMVPGTRHSAVLRDLRSGTLYSLTLYGLRGPHKADSIQGTART.... 100
60 -28.000d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  1.........QPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFLRFELRYRAERSKTFTTW-MVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGT. 99
61 -27.900d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]}  ali model 3D-neighbors follow..  18  1...........DNPKD--LEVSDPTETTLSLRWRRPV---AKFDRYRLTYVSPSGK--KNEMEIPVDSTSFILRGLDAGTEYTISLVAEKGRHKSKPTTIKGSTV... 87
62 -27.600d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]}  ali model 3D-neighbors follow..  17  2...........GSPKG--ISFSDITENSATVSWTPPR---SRVDSYRVSYVPITGGTPNVV-TVDGSKTRTKLVKLVPGVDYNVNIISVKGFEESEPISGILKT.... 88
63 -27.400d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  23  2..........LEAPRD--LEAKEVTPRTALLTWTEP---PVRPAGYLLSFHTPGGQ--TQEILLPGGITSHQLLGLFPSTSYNARLQAMWGQSLLPPVSTSFTTG... 89
64 -27.400d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  18  1..........PDGPTQ--LRALNLTEGFAVLHWKPPQ---NPVDTYDIQVTAPGAP--PLQAETPGSAVDYPLHDLVLHTNYTATVRGLRGPNLTSPASITFTTGLE. 90
65 -26.500d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  13  3.........PPEKPKN--LSCIVNEGKKMRCEWDGGRETHLE-TNFTLKSEWATHKFADCKAKRDTPTSCTVDYSTVYFVNIEVWVEAENALGKVTSD.......... 88
66 -26.500d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]}  ali model 3D-neighbors follow..  21  2........MAPTAPTN--LASTAQTTSSITLSWTASTDNVG-VTGYDVYNGTA--------LATTVTGTTATISGLAADTSYTFTVKAKDAAGNVSAASNAVSVKT.. 88
67 -26.200d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  21  1.........KPRAPGN--LTVHTNVSDTLLLTWSNPYPPDNYLLTYAVNIWSENDPADFRIYNVTYLEPSLRISTLKSGISYRARVRAWAQAYNTTWSEWSPSTKWH. 101
68 -26.100d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  21  1..........PDPPIALNWTLLNVSLTGIQVRWEAPRNADIQVLEYELQYKEVNETKWKMMDPI--LTTSVPVYSLKVDKEYEVRVRS-KQRNSGNYGEFSEVLYVT. 102
69 -26.000d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  12  1.........KLEPPMLQALDIVSHQPGCLWLSWKPWKPSEYMEQECELRYQPQLKGNWTLVFHLPSSKDQFELCGLHQAPVYTLQMRCIRSSLPGFWSPWSPGLQLR. 103
70 -25.400d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  7.........KPDPPENVVARPVPSNPRRLEVTWQTPSTWPDPELKFFLRYRPLILDQWQHVE--LSNGTAHTITDAYAGKEYIIQVAAKDN---SDWSVAAHATPWTE 108
71 -25.400d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  14  2.........EPEPPRNLTLEVKQLKDKKLWVKWSPPTITDVK-MEYEIRLKPEEAEEWEIHFTG--HQTQFKVFDLYPGQKYLVQTRCKPDHGYSRWSQESSVEM... 102
72 -23.600d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  10  1.........KPDPPKNLQLKPLK-NSRQVEVSWEYPDTWSTP-LTFCVQVQGKSKREKKDR-----VFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASV..... 92
73 -23.500d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  27  4.........LLDAPVGLVARLAD-ESGHVVLRWLPPPETPMT-IRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRAREPSFGGFWSAWSEPVSLL. 103
74 -22.700d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  16  2.........IPWAPEN--LTLHKLSESQLELNWNNRFLNHC--LEHLVQYRTDWDHSWTEQSVD--YRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSE...... 88
75 -22.500d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  15  4.........PPASPSNLSC-LMHLTTNSLVCQWEPGPETHLP-TSFILKSFRSRADCQYQGDTIPQNNCSIPRKNLLLYQYMAIWVQAENMLGSSESP.......... 97

FFAS is supported by the NIH grant R01-GM087218-01
7 9 5 9 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Jaroszewski L, Slabinski L, Wooley J, Deacon AM, Lesley SA, Wilson IA, Godzik A. Genome pool strategy for structural coverage of protein families. Structure. 2008 Nov 12;16(11):1659-67.