current user: public

Announcement: our server is upgraded to a faster system. If you experience any issues during this period please let us know.

Query: d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]}, from SCOP175

Results of FFAS03 search in SCOP175
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
2 -59.500d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  28  1EHAPATTGPLPSAPRD--VVASLVSTRFIKLTWRTPSDPHGDNLTYSVFYTKEGIARERVENTSHPGEMQVTIQNLMPATVYIFRVMAQNKHGSGESSAPLRVETQPE 107
3 -57.300d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  24  7.GKNYDLSDLPGPPSKP--QVTDVTKNSVTLSWQPGTPGTLPASAYIIEAFSQSVSNSWQTVANHVKTTLYTVRGLRPNTIYLFMVRAINPQGLSDPSPMSDPVRTQD 111
4 -55.200d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]}  ali model 3D-neighbors follow..  21  2......VQDVPNAPKLTGI---TCQADKAEIHWEQQGDNRSPILHYTIQFNTSTPASWDAAYEKVPNTDSSFVVQMSPWANYTFRVIAFNKIGASPPSAHSDSCTTQ. 100
5 -54.900d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  22  2.EIFTTLSCEPDIPNPP--RIANRTKNSLTLQWKAPSDNGSKIQNFVLEWDEGKGN-GEFCQCYMGSQKQFKITKLSPAMGCKFRLSARNDYGTSGFSEEVLYYTSG. 104
6 -54.500d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  24  6.....VPPELPGPPTN--LGISNIGPRSVTLQFRPGYDGKTSISRWLVEAQVGEGEEWLLIHQLSPDARSMEVPDLNPFTCYSFRMRQVNIVGTSPPSQPSRKIQTLQ 111
7 -54.200d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  24  1SQPDHGRLSPPEAPDRP--TISTASETSVYVTWIPRGNGGFPIQSFRVEYKKLKKDWILATSAIPPSRLSVEITGLEKGISYKFRVRALNMLGESEPSAPSRPYVVS. 107
8 -53.200d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  1..........PSAPKL--EGQMGEDGNSIKVNLIKQDDGGSPIRHYLVRYRALSSE-WKPEIRLPSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTAA.. 93
9 -52.100d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  30  1..........PSMPASP--VLTKAGITWLSLQWSKPSTPSDEGISYILEMEEETSGYGFKPKY-DGEDLAYTVKNLRRSTKYKFKVIAYNSEGKSNPSEVVEFTTCPD 96
10 -51.800d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  1........EVPSEPGR--LAFNVVSSTVTQLSWAEPAETNGEITAYEVCYGLVNDDNMKKVLVDNPKNRMLLIENLRESQPYRYTVKARNGAGWGPEREAIINLATQ. 102
11 -51.500d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  23  7GPTPAPVYDVPNPPFD--LELTDQLDKSVQLSWTPGDDNNSPITKFIIEYEDAMHKPGLWHHQTESGTQTTAQLNLSPYVNYSFRVMAVNSIGKSLPSEASEQYLTKA 113
12 -51.300d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  24  1...RVETQPEVQLPGPAPLRAYAASPTSITVTWETPVSGNGEIQNYKLYYMEKGTDKE---QDVDVSSHSYTINGLKKYTEYSFRVVAYNKHGPGVSTPDVAVRTLSD 103
13 -51.100d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  23  1.........PTSAPQH--LTVEDVTDTTTTLKWRPPRIGAGGIDGYLVEYCLEGSEEWVPANKEPVERCGFTVKDLPTGARILFRVVGVNIAGRSEPATLLQPVTIRE 98
14 -50.100d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  24  1..........PDQCKPP--QVTCRSATCAQVNWEVPLSNGTDVTEYRLEWGGVEGSMQICYC---GPGLSYEIKGLSPATTYYCRVQALSVVGAGPFSEVVACVTPPS 93
15 -49.800d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  22  6.....THEDVPGPVGH--LSFSEILDTSLKVSWQEPGEKNGILTGYRISWEEYNRTNTRVTHYLPNVTLEYRVTGLTALTTYTIEVAAMTSKGQGQVSASTISSGVP. 105
16 -49.600d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  23  2.....SSGSSGLSP--PRGLVAVRTPRGVLLHWDPPELVPKRLDGYVLEGRQGSQGWEVLDPAVAGTETELLVPGLIKDVLYEFRLVAFAGSFVSDPSNTANVSTSGL 102
17 -49.300d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  22  1........DTPSSPSIDQV---EPYSSTAQVQFDEPATGGVPILKYKAEWRAVGEEVWHSKWKEASMEGIVTIVGLKPETTYAVRLAALNGKGLGEISAASEFKTQP. 100
18 -49.300d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  25  1.............PGRPTMMISTTAMNTALLQWHPPKELPGELLGYRLQYCRADEARPNTID-FGKDDQHFTVTGLHKGTTYIFRLAAKNRAGLGEEFEKEIRTP... 91
19 -49.000d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  22  8SHPPILERTLDDVPGPPMILFPEVRTTSVRLIWQPPAAPNGIILAYQITHRLNTTTNTATVEVLAPSARQYTATGLKPESVYLFRITAQTRKGWGEAAEALVVTTEKR 117
20 -48.100d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  31  1..........PPGPCLPPRLQGRPKAKEIQLRWGPPVDGGSPISCYSVEMSPIEKDEPREVYQ--GSEVECTVSSLLPGKTYSFRLRAANKMGFGPFSEKCDITTAP. 96
21 -47.700d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  1..........PSTVPI--MHQVSATMRSITLSWPQPEQPNGIILDYEIRYYEKEHNEFN-SSMARSQTNTARIDGLRPGMVYVVQVRARTVAGYGKFSGKMCFQTLTD 95
22 -47.600d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  22  1........SPIDPPGKP--VPLNITRHTVTLKWAKPYTGGFKITSYIVEKRDLPNGRWLKANFSNILENEFTVSGLTEDAAYEFRVIAKNAAGASPPSEPSDAITCRD 100
23 -46.800d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  6.....TFELVPTPPKDVTVVSKEGKPKTIIVNWQPPSEANGKITGYIIYYSTDVNAEIHVIEPVVGNRLTHQIQELTLDTPYYFKIQARNSKGMGPMSEAVQFRTPK. 110
24 -46.100d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  18  5....TTCPDKPGIPVKPSV-KGKIHSHSFKITWDPPKNGGATINKYVVEMAEGSNGNK--EMIYSGATREHLCDRLNPGCFYRLRVYCISDGGQSAVSESLLVQT... 104
25 -46.100d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  8DEETKAFEALLSNIVKP--VASDIQARTVVLTWSPPESSVPELYGYEVLISSTGKDGKYKS-VYVGEETNITLNDLKPAMDYHAKVQAEYNSIKGTPSEAEIFTTLSC 121
26 -46.000d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}  ali model 3D-neighbors follow..  17  2............PPTPP--NVTRLSDESVMLRWMVPRNDGLPIVIFKVQYRMVGRKNWQTTNDELGKSFTASVTDLKPQHTYRFRILAVYSNNDNKESNTSAKFYLQ. 106
27 -45.500d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]}  ali model 3D-neighbors follow..  15  1..........PDVPFKNNVVGQGTEPNNLVISWTPMIEHNAPNFHYYVSWKRDIPAAWENNNIFDWRQNNIVIADQPTFVKYLIKVVAINDRGESNVAAEEVVGYSGE 103
28 -45.200d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  1...........SGPVEVFITETPSQPNSHPIQWNAP--QPSHISKYILRWRPKNSVGRWKEATIPGHLNSYTIKGLKPGVVYEGQLISIQQYGHQEVTRFDFTTTS.. 93
29 -44.800d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}  ali model 3D-neighbors follow..  16  4.......LDPMPVPEL--LEIEEYSETAVVLHWSLADADEHLITGYYAYYRPSSSGEYFKATIEGAHARSFKIAPLETATMYEFKLQSFSAASASEFSA......... 95
30 -44.800d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  24  4.........KPNPPHNLSVINSEELSSILKLTWTNPSIKSVIILKYNIQYRTKDASTWSQIPDTASTRSSFTVQDLKPFTEYVFRIRCMKEDGKGYWSDWSEEASGI. 103
31 -44.600d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  21  1...DIQVITQTGVPGQPLFKAEPESETSILLSWTPPRSD--TIANYELVYKDGEHGEEQRITI--EPGTSYRLQGLKPNSLYYFRLAARSPQGLGASTAEISARTMQ. 101
32 -44.500d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  2.SSGSSGHSGEDLPMVANVRVNVVNSTLAEVHWDPVKSIRGHLQGYRIYYWKTQSSSKKKILTFQGSKTHGMLPGLEPFSHYTLNVRVVNGKGEGPASPDRVFNTPEG 119
33 -44.300d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  16  1.........PVAGPYI--TFTDAVNETTIMLKWMYISNNNTPIHGFYIYYRPTDSDNDSKKDMVEGDRYWHSISHLQPETSYDIKMQCFNEGGESEFSNVMICETKAR 101
34 -44.100d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  2..........LGAPQN--PNAKAAGSRKIHFNWLPP---SGKPMGYRVKYWIQGDSESE-AHLLDSKVPSVELTNLYPYCDYEMKVCAYGAQGEGPYSSLVSCRTHQ. 92
35 -44.100d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  15  3.....SGSSGPGAPSTVRI---SKNVDGIHLSWEPPTSPSGNILEYSAYLAIRTAQMQDTSCTVTAGQLANAHIDYTSRPAIVFRISAKNEKGYGPATQIRWLQGNSK 117
36 -44.000d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  21  14........VPLSKPHPP--VVGKVTHHSIELYWDLEQKEKRQWLRFSIEEEDPKMHSYGVIYT--GYATRHVVEGLEPRTLYKFRLKVTSPSGEYEYSPVVSVATTRE 114
37 -43.600d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  2.......AKADDIVGP--VTHEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEELHLTRKHFALERGCRLRGLSPGN-YSVRIRATSLAGNGSWTEPTYFYVTDY 101
38 -43.600d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  22  1......ISTEEAAPDGPDVTLQPVTSQSIQVTWKAPELQNGVIRGYQIGYRENSPGYSIVEMKATGDSEVYTLDNLKKFAQYGVVVQAFNRAGTGPSSSEINATTLE. 109
39 -43.300d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  16  1.........PMMPPVG--VQASILSHDTIRITWADNHQKITDSRYYTVRWKTNIPANTKYK-NANATTLSYLVTGLKPNTLYEFSVMVTKGRRSSTWSMTAHGTTFE. 99
40 -42.600d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  21  12.ESDLDETRVPEVPSSLHV---RPLVTSIVVSWTPPENQNIVVRGYAIGYGIGSPHAQTI--KVDYKQRYYTIENLDPSSHYVITLKAFNNVGEGIPLYESAVTRPH. 112
41 -42.500d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  1...DVAVRTLSDVPSAANLSLEVRNSKSIMIHWQPPATQNGQITGYKIRYRKASRKSDVTETLVSGTQLSQLIEGLDRGTEYNFRVAALTINGTGPATDWLSAETFES 109
42 -42.400d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  22  1........AESLSGLS--LKLVKKEPRQLELTWAGSRRNPGGNLSYELHVLNQDEEWH-----QMVLEPRVLLTKLQPDTTYIVRVRTLTPLGPGPFSPDHEFRTSP. 93
43 -41.100d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  14  5SSGTVNVTTKKTPPSQPPGNVVNATDTKVLLNWEQVMENESEVTGYKVFYRTSSQNNVQVLN----TNKTSAELVLPIKEDYIIEVKATTDGGDGTSSEQIRIPRITS 111
44 -40.200d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  11  6SGRQVQKELGDVLVRL--HNPVVLTPTTVQVTWTVD-RQPQFIQGYRVMYRQTSGLQWQNLDAKVPTERSAVLVNLKKGVTYEIKVRPYFNEFQGMDSESKTVRTTEE 114
45 -38.700d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  11  2.EFSTLPAGPPAPPQDVTVQ-AGVTPATIRVSWRPPVLNGANVTGYGVYAKGQRVA---EVIFPTADSTAVELVRLRSLEAKGVTVRTLSAQGESVDSAVAAVPPELL 110
46 -38.600d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  18  3.......GSEVPQLTD--LSFVDITDSSIGLRWTPL--NSSTIIGYRITVVAAGEGIPIFEDFVDSSVGYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQT.... 95
47 -36.000d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  14  2...........DSPTG--IDFSDITANSFTVHWIAP---RATITGYRIRHHPEHFSGRPREDRVPHSRNSITLTNLTPGTEYVVSIVALNGREESPLLIGQQST.... 89
48 -35.200d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  12  3.............NELLKFSYIRTSFDKILLRWEPYWPDFRDLLGFMLFYKEAPYQN-RSNDPKSQNHPGWLMRGLKPWTQYAIFVKTLVTFSDERRTY......... 112
49 -34.900d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  2..........LDAPSQ--IEVKDVTDTTALITWFKPL---AEIDGIELTYGIKDVPGDRTTIDLTEDENQYSIGNLKPDTEYEVSLISRRGDMSSNPAKET....... 87
50 -34.900d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  3..................LEVVAATPTSLLISWDAP---AVTVRYYRITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYAVTGRGDSPASSKPISINYR. 88
51 -34.700d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  18  1........TNPSVPLD--PISVSNSSSQIILKWKPPSDPNGNITHYLVFWERQAEDEEHRPFEKVVNKESLVISGLRHFTGYRIELQACNQDTPEERCSVAAYVSART 194
52 -34.300d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  21  1.............PAPTDLKFTQVTPTSLSAQWTPP---NVQLTGYRVRVTPKEKTGPMKEINLAPDSSSVVVSGLMVATKYEVSVYALKDTLTSRPAQGV....... 85
53 -34.300d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  3...........DRPKG--LAFTDVDVDSIKIAWESPQ---GQVSRYRVTYSSPEDGIHELFPAPDGEEDTAELQGLRPGSEYTVSVVALHDDMESQPLIGTQSTAIPA 94
54 -33.800d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  16  2...........PPPTD--LRFTNIGPDTMRVTWAPPP--SIDLTNFLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYVVSVSSVYEQHESTPLRGR....... 87
55 -33.100d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  1.........QPDPPANITVTAVARNPRWLSVTWQDPHNSSFYRLRFELRYRAERSKTFTTW-MVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGT. 99
56 -31.100d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  16  2...........DAPKN--LRVGSRTATSLDLEWDNSE---AEAQEYKVVYSTLAGEQYHEVLKGIGPTTKTTLTDLVPGTEYGVGISAVMNSKQSIPATMNARTE... 92
57 -30.800d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]}  ali model 3D-neighbors follow..  19  1...........DNPKD--LEVSDPTETTLSLRWRRPV---AKFDRYRLTYVSPSGKKNEM--EIPVDSTSFILRGLDAGTEYTISLVAEKGRHKSKPTTIK....... 83
58 -30.700d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  16  1.........PLSPPTNLHLE-ANPDTGVLTVSWERST--TPDITGYRITTTPTNGQQGNSLEVVHADQSSCTFDNLSPGLEYNVSVYTVKDDKESVPISDT....... 90
59 -30.600d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  20  2...........DSPRD--LMVTASSETSISLIWTKAS---GPIDHYRITFTPSSGISSEV--TVPRDRTSYTLTDLEPGAEYIISITAERGRQQSLESTVDA...... 85
60 -30.100d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  3...........SPPRR--ARVTDATETTITISWRTK---TETITGFQVDAVPANGQTPIQR-TIKPDVRSYTITGLQPGTDYKIYLYTLNDNARSSPVVID....... 86
61 -30.100d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  23  2..........LEAPRD--LEAKEVTPRTALLTWTEP---PVRPAGYLLSFHTPGGQTQEI--LLPGGITSHQLLGLFPSTSYNARLQAMWGQSLLPPVSTSFTTG... 89
62 -30.100d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  13  1.......SGSRPRLSQ--LSVTDVTTSSLRLNWEAPP---GAFDSFLLRFGVPSPSTLEPHPMVPGTRHSAVLRDLRSGTLYSLTLYGLRGPHKADSIQGTART.... 100
63 -29.800d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  13  3.........PPEKPKN--LSCIVNEGKKMRCEWDGGRETHLE-TNFTLKSEWATHKFADCKAKRDTPTSCTVDYSTVYFVNIEVWVEAENALGKVTSDH......... 89
64 -29.400d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]}  ali model 3D-neighbors follow..  17  2...........GSPKG--ISFSDITENSATVSWTPP---RSRVDSYRVSYVPITGGTPNVV-TVDGSKTRTKLVKLVPGVDYNVNIISVKGFEESEPISGI....... 85
65 -28.600d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  12  1.........KLEPPMLQALDIGSHQPGCLWLSWKPWKPSEYMEQECELRYQPQLKGNWTLVFHLPSSKDQFELCGLHQAPVYTLQMRCIRSSLPGFWSPWSPGLQLR. 103
66 -28.400d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  19  1..........PDGPTQ--LRALNLTEGFAVLHWKPPQ---NPVDTYDIQVTAPGAP--PLQAETPGSAVDYPLHDLVLHTNYTATVRGLRGPNLTSPASIT....... 84
67 -27.200d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  21  1..........PDPPIALNWTLLNVSHADIQVRWEAPRNADIQVLEYELQYKEVNETKWKMMD--PILTTSVPVYSLKVDKEYEVRVRSKQR-NSGNYGEFSEVLYVT. 102
68 -26.900d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  21  1.........KPRAPGN--LTVHTNVSDTLLLTWSNPYPPDNYLLTYAVNIWSENDPADFRIYNVTYLEPSLRISTLKSGISYRARVRAWAQAYNTTWSEWSPSTKWH. 101
69 -26.700d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]}  ali model 3D-neighbors follow..  21  2........MAPTAPTN--LASTAQTTSSITLSWTASTDNVG-VTGYDVYNGTA--------LATTVTGTTATISGLAADTSYTFTVKAKDAAGNVSAASNAVSVKT.. 88
70 -26.200d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  15  4.........PPASPSNLSC-LMHLTTNSLVCQWEPGPETHLP-TSFILKSFRSRADCQYQGDTIPQNNCSIPRKNLLLYQYMAIWVQAENMLGSSESP.......... 97
71 -25.800d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  2.......TELP-SPPSVWFEAEFF---HHILHWTPIPQQSESTC-YEVALLRYGIESWNSISQTLSYDLTAVTLDLYHSNGYRARVRAVDGSRHSQWTVTNTRFSVD. 99
72 -25.500d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  7.........KPDPPENVVARPVPSNPRRLEVTWQTPSTWPDPELKFFLRYRPLILDQWQHVE--LSNGTAHTITDAYAGKEYIIQVAAKDN---SDWSVAAHATPWTE 108
73 -25.100d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  14  2.........EPEPPRNLTLEVKQLKDKKLWVKWSPPTITDVK-MEYEIRLKPEEAEEWEIHFTG--HQTQFKVFDLYPGQKYLVQTRCKPDHGYSRWSQESSVEM... 102
74 -24.600d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  27  4.........LLDAPVGLVARLAD-ESGHVVLRWLPPPETPTSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRAREPSFGGFWSAWSEPVSLL. 103
75 -24.200d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  10  1.........KPDPPKNLQLKPLK-NSRQVEVSWEYPDTWSTP-LTFCVQVQGKSKREKKDRVF-----TDKTSATVICRKNASISVRAQDRYYSSSWSEWASV..... 92

FFAS is supported by the NIH grant R01-GM087218-01
6 1 0 5 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Nika K, Tautz L, Saito K, Cerignoli F, Friedberg I, Godzik A, Mustelin T. Identification and characterization of DUSP27, a novel dual-specific protein phosphatase. FEBS Lett. 2007 May 29;581(13):2527-33. Epub 2007 Apr 30.