current user: public

Query: d1w9sa_ b.18.1.10 (A:) Hypothetical protein BH0236 {Bacillus halodurans [TaxId: 86665]}, from SCOP206

Results of FFAS03 search in SCOP206
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130
2 -66.800d1od3a_ b.18.1.10 (A:) Putative xylanase {Clostridium stercorarium [TaxId: 1510]}  ali model 3D-neighbors follow..  37  4.TRSAFSNIQAEDYDSSYGPNLQIFSLPGGGSAIGYIENGYSTTYKNIDFGDGATSVTARVATQ-NATTIQVRLGSPSGTLLGTIYVGSTGSFDTYRDVSATISNTAGVKDIVLVFSGP-----VNVDWFVFSK 130
3 -58.600d1uxza_ b.18.1.10 (A:) Cellulase B (lichenase 5a) {Cellvibrio mixtus [TaxId: 39650]}  ali model 3D-neighbors follow..  33  4......ATIQAEDHSQQSGTQQETTTDTGGGKNVGYIDAGDWLSYAGTPVSSGSYLIEYRVASQNGGGSLTFEEAG-GAPVHGTIAIPATGGWQTWTTIQHTVNLSAGSHQFGIKANAGG----WNLNWIRINK 129
4 -21.700d1w0na_ b.18.1.28 (A:) Endo-1,4-beta-xylanase D {Paenibacillus polymyxa [TaxId: 1406]}  ali model 3D-neighbors follow..  18  2......TKVEAENMKIGGTYAGKISAPFDG---VALYANADYVSYS-QYFANSTHNISVRGASSNAGAKVDLVIG---GVTVGSFNFTGKTPTVQTLS---NITHATGDQEIKLALTSDDGTWDAYVDFIEFS. 119
5 -17.800d1ciya1 b.18.1.3 (A:462-609) delta-Endotoxin, C-terminal domain {Bacillus thuringiensis, CRYIA (A) [TaxId: 1428]}  ali model 3D-neighbors follow..  10  7...SQITQIPLTKSTNLGSTSVVKGPGFTGGDILRRTSPGQTLRVNITAPLSQRYRVRIRYAST-TNLQFHTSID---GRPINQGNFSATMSSGSTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEF.. 142
6 -13.400d3eb7a3 b.18.1.0 (A:502-652) automated matches {Bacillus thuringiensis [TaxId: 1428]}  ali model 3D-neighbors follow..  8...DKITQIPVVKASDGPKPSANEVGHYLGGDPISFNSSGGVIRLNINSPLSQKYRVRIRYCS-SVDFDLDVVRG---GTTVNNGRFNKSAPNVGFASFSTPFTFNQAQDTLKISVRNIVGGSVVYIDRIEL.. 147
7 -12.400d1ji6a1 b.18.1.3 (A:503-652) delta-Endotoxin, C-terminal domain {Bacillus thuringiensis, CRY3bb1 [TaxId: 1428]}  ali model 3D-neighbors follow..  10  8...EKITQLPVVAYALSSGASIIEGPGFTGGNLLFLKESSNSIAKFKVTLNSAALLQRYRVRIRYASTTNLRLFVQNSNNDFLVIYINKTMNKDDLATTNSNMGFSGDKNELIIGAESFVSNEKIYIDKIEF.. 145
8 -7.990d2yr3a1 b.1.1.0 (A:8-99) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  5....PSFSSVLKDCAVIEGQDFVLQCSVRG-PRITWLLNGQPIQYARSTCEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWV............................................... 89
9 -7.970d2xhna3 b.18.1.0 (A:338-508) automated matches {Fungus (Aspergillus aculeatus) [TaxId: 5053]}  ali model 3D-neighbors follow..  16  43................................TVGSSALTDFIKFTATSAQTGAATLRIGTTLSFAGGRPQATINSYTGSAPAAPTNLDSGLGEVYDVSIPSGTIVAGTNTITINVISGSSGDTYLSPNFIFDC 166
10 -7.530d1i5pa1 b.18.1.3 (A:473-633) delta-Endotoxin, C-terminal domain {Bacillus thuringiensis subsp. kurstaki, CRY2AA [TaxId: 29339]}  ali model 3D-neighbors follow..  10  27........IHATQVNNQTRTFISEKFGNQGD-SLRFEQSNTTARYT-LRGNGNSYNLYLRVSS-IGNSTIRVTINGRVYTVSNVNTTTNNDGVNSDINIGNIVASDNTNVTLDINVTLNSGTPFD-LMNIMF.. 152

FFAS is supported by the NIH grant R01-GM087218-01
8 8 5 2 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Jaroszewski L, Rychlewski L, Godzik A. Improving the quality of twilight-zone alignments. Protein Sci. 2000 Aug;9(8):1487-96.