current user: public

Query: d1w9sa_ b.18.1.10 (A:) Hypothetical protein BH0236 {Bacillus halodurans [TaxId: 86665]}, from SCOP175

Results of FFAS03 search in SCOP175
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130
2 -65.900d1od3a_ b.18.1.10 (A:) Putative xylanase {Clostridium stercorarium [TaxId: 1510]}  ali model 3D-neighbors follow..  36  3GTRSAFSNIQAEDYDSSYGPNLQIFSLPGGGSAIGYIENGYSTTYKNIDFGDGATSVTARVATQ-NATTIQVRLGSPSGTLLGTIYVGSTGSFDTYRDVSATISNTAGVKDIVLVFSGP-----VNVDWFVFSK 130
3 -57.300d1uxza_ b.18.1.10 (A:) Cellulase B (lichenase 5a) {Cellvibrio mixtus [TaxId: 39650]}  ali model 3D-neighbors follow..  33  4......ATIQAEDHSQQSGTQQETTTDTGGGKNVGYIDAGDWLSYAGTPVSSGSYLIEYRVASQNGGGSLTFEEAG-GAPVHGTIAIPATGGWQTWTTIQHTVNLSAGSHQFGIKANAGG----WNLNWIRINK 129
4 -13.900d1ciya1 b.18.1.3 (A:462-609) delta-Endotoxin, C-terminal domain {Bacillus thuringiensis, CRYIA (A) [TaxId: 1428]}  ali model 3D-neighbors follow..  12  7...SQITQIPLTSTNLGSGTSVVKGPGFTGGDILRRTSPGQTLRVNITAPLSQRYRVRIRYAST-TNLQFHTSID---GRPINQGNFSATMSSGSTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEF.. 142
5 -10.200d1w0na_ b.18.1.28 (A:) Endo-1,4-beta-xylanase D {Paenibacillus polymyxa [TaxId: 1406]}  ali model 3D-neighbors follow..  21  2......TKVEAENMKIGGTYAGKISAPFDG---VALYANADYVSYS-QYFANSTHNISVRGASSNAGAKVDLVIG---GVTVGSFNF--TGKTPTVQTLS-NITHATGDQEIKLALTSDDGTWDAYVDFIEFS. 119
6 -8.310d1ji6a1 b.18.1.3 (A:503-652) delta-Endotoxin, C-terminal domain {Bacillus thuringiensis, CRY3bb1 [TaxId: 1428]}  ali model 3D-neighbors follow..  10  3......NTIDAEKITQLPVVKAYALSSGASIIEGPGFTGGNLLFLKESSNSIAKFKVTLNSAALLQRYRVRIRYASNSNNDFLVIYINKTMNKDDLATTNSNMGFSGDKNELIIGAESFVSNEKIYIDKIEF.. 145
7 -6.910d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  10  3...DPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQG------KSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPC................................. 94
8 -6.800d1nkga2 b.18.1.25 (A:338-508) Rhamnogalacturonase B, RhgB, C-terminal domain {Aspergillus aculeatus [TaxId: 5053]}  ali model 3D-neighbors follow..  15  66..........................................IKFTATSAQTGAATLRIGTTLSFAGGRPQATINSYTGSAPAAPTNLDSRG-GLGEVYDVSIPSVAGTNTITINVISGSSGDTYLSPNFIFDC 166
9 -6.510d1ooya1 c.124.1.3 (A:261-481) Succinate:CoA transferase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}  ali model 3D-neighbors follow..  18  16.........DGMYANLGIGIPLLASNFISPNMTVGILGLGPYPLQNEVDINAGKETVTVLPGASYFSSDESIRGGHVNLTMLGAMQVSKYGDLANWMIPGKLVKGMGGAMDL...................... 130
10 -6.220d1wmxa_ b.18.1.24 (A:) Endoglucanase CelJ {Clostridium thermocellum [TaxId: 1515]}  ali model 3D-neighbors follow..  10  34.........TTVTYNGLPTLRLNVQTTVQSGWWISLLTLRGWNTHDLSQYENGYLEFDIKGKEGGEDFVIGFRDKVYERV---SNYVTVTTDWQHVKIPLRDLMKINNGFDPLVFSKRYADPFTVWFSDIKITS 172

FFAS is supported by the NIH grant R01-GM087218-01
6 3 9 9 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Jaroszewski L, Ye Y, Godzik A. The interplay of fold recognition and experimental structure determination in structural genomics. Curr Opin Struct Biol. 2004 Jun;14(3):307-12.