current user: public

Query: d1tu9a_ a.1.1.2 (A:) Hypothetical protein PA3967 {Pseudomonas aeruginosa [TaxId: 287]}, from SCOP175

Results of FFAS03 search in SCOP175
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130
2 -50.800d1cqxa1 a.1.1.2 (A:1-150) Flavohemoglobin, N-terminal domain {Alcaligenes eutrophus [TaxId: 106590]}  ali model 3D-neighbors follow..  16  5KTKDIVKATAPVLAEGYDIIKCFYQRMFEAHPELKNVFNMAHQEQQQQALARAVYAYAENIEDPNSLMAVLKNIANKHASLGVKPEQYPIVGEHLLAAIKEVLGNATDDIISAWAQAYGNLADVLMGMESE 139
6 -39.400d1cg5b_ a.1.1.2 (B:) Hemoglobin, beta-chain {Cartilaginous fish akaei (Dasyatis akajei) [TaxId: 31902]}  ali model 3D-neighbors follow..  6DQEHYIKGVWKDV-DHKQITAKALERVFVVYPWTTRLFSDIGVQQHADKVQRALGEAIDDLKKVEI---NFQNLSGKHQEIGVDTQNFKLLGQTFMVELALHYKKFRPKEHAAAYKFFRLVAEALSSNY.. 140
8 -38.800d1gcvb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Houndshark (Mustelus griseus) [TaxId: 89020]}  ali model 3D-neighbors follow..  11  6EERDEISKTFQGT-DMKTVVTQALDRMFKVYPWTNRYFQDFRSSIHAGIVVGALQDAVKHMDDVKT-LFKDLSKKHAD-DLHVDPGSFHLLTDCIIVELAYLRKCFTPHIQGIWDKFFEVVIDAISKQY.. 135
9 -38.500d1cg5a_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Cartilaginous fish akaei (Dasyatis akajei) [TaxId: 31902]}  ali model 3D-neighbors follow..  13  5QNKKAIEELGNLIKANEAWGADALARLFELHPQTKTYFSNEQVKKHGKRVMNALADATHHLDNLHL-HLEDLARKHGE-NLLVDPHNFHLFADCIVVTLAVNLQAFTPVTHCAVDKFLELVAYELSSCYR. 141
10 -38.100d1hlba_ a.1.1.2 (A:) Hemoglobin, different isoforms {Caudina arenicola, also known as Molpadia arenicola [TaxId: 7698]}  ali model 3D-neighbors follow..  17  15AQKKIVRKTWHQLMRNTSFVTDVFIRIFAYDPSAQNKFPSRQMQAHAIRVSSIMSEYVEELDS-DILPELLATLARTHDLNKVGADHYNLFAKVLMEALQAELGSFNEKTRDAWAKAFSVVQAVLLVKHG. 157
11 -37.000d3sdha_ a.1.1.2 (A:) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}  ali model 3D-neighbors follow..  12DVKKDLRDSWKVIGSDKGNGVALMTTLFADNQETIGYFKNDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLAS--KNFGDKYANAWAKLVAVVQAAL...... 145
12 -36.500d3d1ka1 a.1.1.2 (A:1-142) Hemoglobin, alpha-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]}  ali model 3D-neighbors follow..  13  5KDKAAVRALWSKIGKSDAIGNDALSRMIVVYPQTKIYFSSPNIKAHGKKVMGGIALAVSKIDDLKT-GLMELSEQHAY-KLRVDPSNFKILNHCILVVISTMFPKFTPEAHVSLDKFLSGVALALAERYR. 142
15 -36.300d1asha_ a.1.1.2 (A:) Ascaris hemoglobin, domain 1 {Pig roundworm (Ascaris suum) [TaxId: 6253]}  ali model 3D-neighbors follow..  16  3KTRELCMKSLEHAKVDRQDGIDLYKHMFENYPPLRKYFKDPFFAKQGQKILLACHVLCATYDDRETFYTRELLDRHARDHVHMPPEVWTDFWKLFEEYLGKKTT-LDEPTKQAWHEIGREFAKEINK.... 147
16 -35.900d1x9fb_ a.1.1.2 (B:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit II (globin B) {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}  ali model 3D-neighbors follow..  18  7LEGLKVKSEWGRAHDREAFSQAIWRATFAQVPESRSLFKHPAFIAHADRVLGGLDIAISTLDQPATLKEELDHLQVQHEGRKIPDNYFDAFKTAILHVVAAQLGRYDRE---AWDACIDHIEDGIKGHH.. 145
17 -35.700d3d1kb1 a.1.1.2 (B:1-146) Hemoglobin, beta-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]}  ali model 3D-neighbors follow..  14  6KERSIISDIFSHM-DYDDIGPKALSRCLVVYPWTQRYFSNANVAAHGIKVLHGLDRGMKNMDNIAD-AYTDLSTLHSE-KLHVDPDNFKLLSDCITIVLAAKMGHFTAETQGAFQKFLAAVVSALGKQY.. 145
18 -35.600d1itha_ a.1.1.2 (A:) Hemoglobin {Innkeeper worm (Urechis caupo) [TaxId: 6431]}  ali model 3D-neighbors follow..  19  5AQIKAIQDHWFLNIKGCAAADSIFFKYLTAYPGDLAFFHNPAYKAQTLTVINYLDKVVDALGGNAGALMKAKVPSHD--AMGITPKHFGQLLKLVGGVFQEEFSA-DPTTVAAWGDAAGVLVAAMK..... 141
20 -34.500d2qfka1 a.1.1.2 (A:1-137) Dehaloperoxidase {Amphitrite ornata [TaxId: 129555]}  ali model 3D-neighbors follow..  11  2.....FKQDIATIRGDRTYAQDIFLAFLNKYPDERRYFKMAKFGDHTEKVFNLMMEVADRATDCVPLASDANTLVQMKQHSSLTTGNFEKLFVALVEYMRAS---GQSFDSQSWDRFGKNLVSALSSAGMK 137
21 -33.400d1ecda_ a.1.1.2 (A:) Erythrocruorin {Midge (Chironomus thummi thummi), fraction III [TaxId: 7154]}  ali model 3D-neighbors follow..  11  4DQISTVQASFDKVKGDP---VGILYAVFKADPSIMAKFTTAPFETHANRIVGFFSKIIGELPNIEAD---VNTFVASHKPRGVTHDQLNNFRAGFVSYMKAHTD--FAGAEAAWGATLDTFFGMIFSK... 135
22 -32.400d1h97a_ a.1.1.2 (A:) Trematode hemoglobin/myoglobin {Paramphistomum epiclitum [TaxId: 54403]}  ali model 3D-neighbors follow..  10  5HEQDILLKELGPHAHIVETGLGAYHALFTAHPQYISHFSSEGIKHYARTLTEAIVHMLKEISNDAEVKKIAAQYGKDHTSRKVTKDEFMSGEPIFTKYFQNLVKD--AEGKAAVEKFLKHVFPMMAAE... 146
23 -31.800d1x9fc_ a.1.1.2 (C:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit III (globin C) {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}  ali model 3D-neighbors follow..  10  8EDHRIVQKQWDILWRDIGFGRLLLTKLAKDIPEVNDLFKGPKFSAHALRILNGLDLAINLLDDPPALDAALDHLAHQHEVEGVQKAHFKKFGEILATGLPQVLDD---YDALAWKSCLKGILTKISSR... 148
24 -31.200d1it2a_ a.1.1.2 (A:) Hagfish hemoglobin {Inshore hagfish (Eptatretus burgeri) [TaxId: 7764]}  ali model 3D-neighbors follow..  14GDKKAINKIWPKIYKEEQYSLNILLRFLKCFPQAQASFPDPEVKHQAVVIFNKVNEIINSMDNQEEIIKSLKDLSQKHKVFKVDSIWFKELSSIFVSTI---------DGGAEFEKLFSIICILLRSAY.. 146
25 -30.600d1x9fa_ a.1.1.2 (A:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit IV (globin A) {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}  ali model 3D-neighbors follow..  10  6EDRREIRHIWDDVDRRVAIVRAVFDDLFKHYPTSKALFESGEFKSHLVRVANGLKLLINLLDDTLVLQSHLGHLADQHIQKGVTKEYFRGIGEAFARVLPQVLS---CFNVDAWNRCFHRLVARIAKD... 145
26 -30.100d1kr7a_ a.1.1.4 (A:) Nerve tissue mini-hemoglobin (neural globin) {Milky ribbon-worm (Cerebratulus lacteus) [TaxId: 6221]}  ali model 3D-neighbors follow..  15  1............MVNWAAVVDDFYQELFKAHPEYQNKFGFKGVAKGNAAYKTQAGKTVDYINAAIGGSADAAGLASRHKGRNVGSAEFHNAKACLAKACSAHGADLGHAIDDILSHL.............. 110
27 -19.400d1ngka_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Mycobacterium tuberculosis, HbO [TaxId: 1773]}  ali model 3D-neighbors follow..  18  1......KSFYDAVGGAKTFVSRFYAQV-AEDEVLRRVYPEDDLAGAEERLRMFLEQYWGGPRTYSEQRGHP-RLRMRHAPFRISLIERDAWLRCMHTAVASISETLDDEHRRELLDYLEMAAHSLVNS... 124
28 -18.100d1or4a_ a.1.1.2 (A:) Heme-based aerotactic transducer HemAT, sensor domain {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  37AELYVLEQLQPLIQENVNIVDAFYKNLDH-ESSLMDIINDHSSVDRLKQTLKRHIQEMFAGVIDDEFIEKRNRIASIHLRIGLLPKWYMGAFQELLLSMIDIYEA-LLKAIKATTKILNLEQQLVLE.... 169
29 -16.500d1idra_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Mycobacterium tuberculosis, HbN [TaxId: 1773]}  ali model 3D-neighbors follow..  15  12......ISIYDKIGGHEVVVEDFYVRV-LADDQLSAFFSGTNMSRLKGKQVEFFAAALGGPEPYTGAPMKQ-----VHQGRGITMHHFSLVAGHLADALTAA--GVPSETITEILGVIAPLAVDVTS.... 127
30 -16.100d1dlwa_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Ciliate (Paramecium caudatum) [TaxId: 5885]}  ali model 3D-neighbors follow..  11  1.......SLFEQLGGQAAVTAQFYANI-QADATVATFFNGIDMPNQTNKTAAFLCAALGGPNAWTGRNLKE-----VHANMGVSNAQFTTVIGHLRSALTGA--GVAAALVEQTVAVAETVRGDVVT.... 115
31 -15.500d1s69a_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Cyanobacteria (Synechocystis sp.), pcc 6803 [TaxId: 1143]}  ali model 3D-neighbors follow..  18  1......STLYEKLGGTTAVVDKFYERV-LQDDRIKHFFADVDMAKQRAHQKAFLTYAFGGTDKYDGRYMRE-AHKELVENHGLNGEHFDAVAEDLLATLKEM............................. 97
32 -14.700d1ux8a_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  15  1......NAPYEAIGEESQLVDTFYERV-ASHPLLKPIFPS-DLTETARKQKQFLTQYLGGPPLYTEEH----MLRARHLPFPITNERADAWLSCMKDAMDHV--GLEGEIREFLFGRLELTARHMVNQ... 119

FFAS is supported by the NIH grant R01-GM087218-01
6 0 4 1 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Zhang B, Jaroszewski L, Rychlewski L, Godzik A. Similarities and differences between nonhomologous proteins with similar folds: evaluation of threading strategies. Fold Des. 1997;2(5):307-17.