current user: public

Query: d1tu9a_ a.1.1.2 (A:) Hypothetical protein PA3967 {Pseudomonas aeruginosa [TaxId: 287]}, from SCOP175

Results of FFAS03 search in SCOP175
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130
2 -48.800d1cqxa1 a.1.1.2 (A:1-150) Flavohemoglobin, N-terminal domain {Alcaligenes eutrophus [TaxId: 106590]}  ali model 3D-neighbors follow..  16  5KTKDIVKATAPVLAEGYDIIKCFYQRMFEAHPELKNVFNMAHQEQQQQALARAVYAYAENIEDPNSLMAVLKNIANKHASLGVKPEQYPIVGEHLLAAIKEVLGNATDDIISAWAQAYGNLADVLMGMESE 139
6 -36.300d1cg5a_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Cartilaginous fish akaei (Dasyatis akajei) [TaxId: 31902]}  ali model 3D-neighbors follow..  13  5QNKKAIEELGNLIKANEAWGADALARLFELHPQTKTYFSNEQVKKHGKRVMNALADATHHLDNLHL-HLEDLARKHGE-NLLVDPHNFHLFADCIVVTLAVNLQAFTPVTHCAVDKFLELVAYELSSCYR. 141
7 -35.100d1gcvb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Houndshark (Mustelus griseus) [TaxId: 89020]}  ali model 3D-neighbors follow..  11  6EERDEISKTFQGT-DMKTVVTQALDRMFKVYPWTNRYFQDFRSSIHAGIVVGALQDAVKHMDDVKT-LFKDLSKKHAD-DLHVDPGSFHLLTDCIIVELAYLRKCFTPHIQGIWDKFFEVVIDAISKQY.. 135
8 -35.000d1cg5b_ a.1.1.2 (B:) Hemoglobin, beta-chain {Cartilaginous fish akaei (Dasyatis akajei) [TaxId: 31902]}  ali model 3D-neighbors follow..  6DQEHYIKGVWKDV-DHKQITAKALERVFVVYPWTTRLFSDIGVQQHADKVQRALGEAIDDLKKVEINFQN---LSGKHQEIGVDTQNFKLLGQTFMVELALHYKKFRPKEHAAAYKFFRLVAEALSSNY.. 140
9 -33.700d1hlba_ a.1.1.2 (A:) Hemoglobin, different isoforms {Caudina arenicola, also known as Molpadia arenicola [TaxId: 7698]}  ali model 3D-neighbors follow..  20  15AQKKIVRKTWHQLMRNTSFVTDVFIRIFAYDPSAQNKFPSRQMQAHAIRVSSIMSEYVEELDSDIPELLATLARTHD--LNKVGADHYNLFAKVLMEALQAELGSFNEKTRDAWAKAFSVVQAVLLVKHG. 157
10 -33.700d3d1ka1 a.1.1.2 (A:1-142) Hemoglobin, alpha-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]}  ali model 3D-neighbors follow..  13  5KDKAAVRALWSKIGKSDAIGNDALSRMIVVYPQTKIYFSSPNIKAHGKKVMGGIALAVSKIDDLKT-GLMELSEQHAY-KLRVDPSNFKILNHCILVVISTMFPKFTPEAHVSLDKFLSGVALALAERYR. 142
12 -32.700d1itha_ a.1.1.2 (A:) Hemoglobin {Innkeeper worm (Urechis caupo) [TaxId: 6431]}  ali model 3D-neighbors follow..  19  5AQIKAIQDHWFLNIKGCAAADSIFFKYLTAYPGDLAFFHNPAYKAQTLTVINYLDKVVDALGGNAGALMKAKVPSHD--AMGITPKHFGQLLKLVGGVFQEEFS-ADPTTVAAWGDAAGVLVAAMK..... 141
13 -32.600d3sdha_ a.1.1.2 (A:) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}  ali model 3D-neighbors follow..  12DVKKDLRDSWKVIGSDKGNGVALMTTLFADNQETIGYFKNDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLAS--KNFGDKYANAWAKLVAVVQAAL...... 145
14 -32.500d1asha_ a.1.1.2 (A:) Ascaris hemoglobin, domain 1 {Pig roundworm (Ascaris suum) [TaxId: 6253]}  ali model 3D-neighbors follow..  16  3KTRELCMKSLEHAKVDRQDGIDLYKHMFENYPPLRKYFKDPFFAKQGQKILLACHVLCATYDDRETAYTRELLDRHARDHVHMPPEVWTDFWKLFEEYLGKKTT-LDEPTKQAWHEIGREFAKEINK.... 147
15 -32.100d1x9fb_ a.1.1.2 (B:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit II (globin B) {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}  ali model 3D-neighbors follow..  17  7LEGLKVKSEWGRAHDREAFSQAIWRATFAQVPESRSLFKHPAFIAHADRVLGGLDIAISTLDQPATLKEELDHLQVQHEGRKIPDNYFDAFKTAILHVVAAQLGRCYDR--EAWDACIDHIEDGIKGHH.. 145
19 -29.400d3d1kb1 a.1.1.2 (B:1-146) Hemoglobin, beta-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]}  ali model 3D-neighbors follow..  14  6KERSIISDIFSHM-DYDDIGPKALSRCLVVYPWTQRYFSNANVAAHGIKVLHGLDRGMKNMDNIAD-AYTDLSTLHSEK-LHVDPDNFKLLSDCITIVLAAKMGAFTAETQGAFQKFLAAVVSALGKQY.. 145
20 -29.100d1ecda_ a.1.1.2 (A:) Erythrocruorin {Midge (Chironomus thummi thummi), fraction III [TaxId: 7154]}  ali model 3D-neighbors follow..  13  4DQISTVQASFDKVKGDPV---GILYAVFKADPSIMAKFTTAPFETHANRIVGFFSKIIGELPNIEA-DVNTFVASHK--PRGVTHDQLNNFRAGFVSYMKAHTD--FAGAEAAWGATLDTFFGMIFSK... 135
21 -28.800d1x9fa_ a.1.1.2 (A:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit IV (globin A) {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}  ali model 3D-neighbors follow..  14  6EDRREIRHIWDDVWSSVAIVRAVFDDLFKHYPTSKALFESGEFKSHLVRVANGLKLLINLLDDTLVSHLGHLADQHIQR-KGVTKEYFRGIGEAFARVLPQV---LSCFNVDAWNRCFHRLVARIAKD... 145
22 -28.000d1x9fc_ a.1.1.2 (C:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit III (globin C) {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}  ali model 3D-neighbors follow..  11  8EDHRIVQKQWDILWRDIGFGRLLLTKLAKDIPEVNDLFKGPKFSAHALRILNGLDLAINLLDDPPAAALDHLAHQHEVR-EGVQKAHFKKFGEILATGLPQVLD---DYDALAWKSCLKGILTKISSR... 148
23 -27.500d1kr7a_ a.1.1.4 (A:) Nerve tissue mini-hemoglobin (neural globin) {Milky ribbon-worm (Cerebratulus lacteus) [TaxId: 6221]}  ali model 3D-neighbors follow..  14  1............MVNWAAVVDDFYQELFKAHPEYQNKFGFKGVAKGNAAYKTQAGKTVDYINAAIGGSADAAGLASRHKGRNVGSAEFHNAKACLAKACSAHGAPLGHAIDDILSHL.............. 110
24 -27.400d1it2a_ a.1.1.2 (A:) Hagfish hemoglobin {Inshore hagfish (Eptatretus burgeri) [TaxId: 7764]}  ali model 3D-neighbors follow..  14GDKKAINKIWPKIYKEEQYSLNILLRFLKCFPQAQASFPDPEVKHQAVVIFNKVNEIINSMDNQEEKSLKDLSQKHKT-VFKVDSIWFKELSSIFVSTI---------DGGAEFEKLFSIICILLRSAY.. 146
25 -27.000d2qfka1 a.1.1.2 (A:1-137) Dehaloperoxidase {Amphitrite ornata [TaxId: 129555]}  ali model 3D-neighbors follow..  11  2.....FKQDIATIRGDRTYAQDIFLAFLNKYPDERRYFSMAKFGDHTEKVFNLMMEVADRATDCVPLASDANTLVQMKQHSSLTTGNFEKLFVALVEYMRA---SGQSFDSQSWDRFGKNLVSALSSA... 134
26 -25.800d1h97a_ a.1.1.2 (A:) Trematode hemoglobin/myoglobin {Paramphistomum epiclitum [TaxId: 54403]}  ali model 3D-neighbors follow..  12  5HEQDILLKELGPHVDTPETGLGAYHALFTAHPQYISHFQSEGIKHYARTLTEAIVHMLKEISNDAEVKKIAAQYGKDHTSRKVTKDEFMSGEPIFTKYFQNLVKD-KAAVEKFLKHVFPMMAAEI...... 147
27 -16.100d1or4a_ a.1.1.2 (A:) Heme-based aerotactic transducer HemAT, sensor domain {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  37AELYVLEQLQPLIQENVNIVDAFYKNLDH-ESSLMDIINDHSSVDRLKQTLKRHIQEMFAGVIDDEFIEKRNRIASIHLRIGLLPKWYMGAFQELLLSMIDINQQELLKAIKATTKILNLEQQLVLE.... 169
28 -14.400d1dlwa_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Ciliate (Paramecium caudatum) [TaxId: 5885]}  ali model 3D-neighbors follow..  15  13................QAVTAQFYANIQA-DATVATFFNGIDMPNQTNKTAAFLCAALGGPNAWTGRNLKE-----VHANMGVSNAQFTTVIGHLRSALTGVAAALVEQTVAVAETVRGDVVTV....... 116
29 -14.400d1idra_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Mycobacterium tuberculosis, HbN [TaxId: 1773]}  ali model 3D-neighbors follow..  18  25................EVVVEDFYVRVLA-DDQLSAFFSGTNMSRLKGKQVEFFAAALGGPEPYTGAPMKQ-----VHQGRGITMHHFSLVAGHLADALTAA--GVPSETITEILGVIAPLAVDVTS.... 127
30 -13.000d1s69a_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Cyanobacteria (Synechocystis sp.), pcc 6803 [TaxId: 1143]}  ali model 3D-neighbors follow..  20  14................DLAVDKFYERVLQ-DDRIKHFFADVDMAKQRAHQKAFLTYAFGGTDKYDGRYMRE-AHKELVENHGLNGEHFDAVAEDLLATLKEM............................. 97
31 -12.800d1ngka_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Mycobacterium tuberculosis, HbO [TaxId: 1773]}  ali model 3D-neighbors follow..  19  1......KSFYDAVGGAKTFVSRFYAQV-AEDEVLRRVYPEDDLAGAEERLRMFLEQYWGGPRTYSEQR----RLRMRHAPFRISLIERDAWLRCMHTAVASIDETLDDEHRRELLDYLEMAAHSLVNS... 124
32 -10.100d1ux8a_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  16  14.................QLVDTFYERV-ASHPLLKPIFPS-DLTETARKQKQFLTQYLGGPPLYTEEH----MLRARHLPFPITNERADAWLSCMKDAMDHV--GLEGEIREFLFGRLELTARHMVNQ... 119

FFAS is supported by the NIH grant R01-GM087218-01
6 1 9 1 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page

Selected papers from Godzik Lab

Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Reed JC, Doctor KS, Godzik A. The domains of apoptosis: a genomics perspective. Sci STKE. 2004 Jun 22;2004(239):re9. Review.