current user: public




Query: d1tu9a_ a.1.1.2 (A:) Hypothetical protein PA3967 {Pseudomonas aeruginosa [TaxId: 287]}, from SCOP175

Results of FFAS03 search in SCOP175
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130
# Score Template Links and tools%idFirst NAADRVMQSYGRCCASTGFFDDFYRHFLASSPQIRAKFATTDMTAQKHLLRAGIMNLVMYARGMSDSKLRALGASHSRAALDIRPELYDLWLDALLMAVAEHDRDCDAETRDAWRDVMGRGIAVIKSYYGSLast
1 -70.900d1tu9a_ a.1.1.2 (A:) Hypothetical protein PA3967 {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors  100  1NAADRVMQSYGRCCASTGFFDDFYRHFLASSPQIRAKFATTDMTAQKHLLRAGIMNLVMYARGMSDSKLRALGASHSRAALDIRPELYDLWLDALLMAVAEHDRDCDAETRDAWRDVMGRGIAVIKSYYGS 131
2 -48.500d1cqxa1 a.1.1.2 (A:1-150) Flavohemoglobin, N-terminal domain {Alcaligenes eutrophus [TaxId: 106590]}  ali model 3D-neighbors follow..  16  5KTKDIVKATAPVLEHGYDIIKCFYQRMFEAHPELKNVFNMAHQEQQQQALARAVYAYAENIEDPNSLMAVLKNIANKHASLGVKPEQYPIVGEHLLAAIKEVLGNATDDIISAWAQAYGNLADVLMGMESE 139
3 -45.900d1jl7a_ a.1.1.2 (A:) Glycera globin {Marine bloodworm (Glycera dibranchiata) [TaxId: 6350]}  ali model 3D-neighbors follow..  16  5AQRQVVASTWKDIAGGAGVGKECLSKFISAHPEMAAVFGFSGVAELGAKVLAQIGVAVSHLGDEGKMVAEMKAVGVRHKGYGIKAEYFEPLGASLLSAMEHRIGGMNAAAKDAWAAAYGDISGALISGLQS 147
4 -44.000d2gdma_ a.1.1.2 (A:) Leghemoglobin {Yellow lupin (Lupinus luteus) [TaxId: 3873]}  ali model 3D-neighbors follow..  16  6SQAALVKSSWEEFNANPKHTHRFFILVLEIAPAAKDLFSNPELQAHAGKVFKLVYEAAIQLEVTGVATLKNLGSVH--VSKGVADAHFPVVKEAILKTIKEVVGAWSEELNSAWTIAYDELAIVIKKEMDD 151
5 -41.100d1q1fa_ a.1.1.2 (A:) Neuroglobin {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  13  2PESELIRQSWRVVSRSLEHGTVLFARLFALEPSLLPLFQSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLTSLGRKHRAVGVRLSSFSTVGESLLYMLEKSLGPFTPATRTAWSRLYGAVVQAMSRGWDG 148
6 -34.900d1gcvb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Houndshark (Mustelus griseus) [TaxId: 89020]}  ali model 3D-neighbors follow..  11  6EERDEISKTFQGT-DMKTVVTQALDRMFKVYPWTNRYFQDFRSSIHAGIVVGALQDAVKHMDDVKT-LFKDLSKKHAD-DLHVDPGSFHLLTDCIIVELAYLRKCFTPHIQGIWDKFFEVVIDAISKQY.. 135
7 -34.300d1asha_ a.1.1.2 (A:) Ascaris hemoglobin, domain 1 {Pig roundworm (Ascaris suum) [TaxId: 6253]}  ali model 3D-neighbors follow..  16  3KTRELCMKSLEHAKVDRQDGIDLYKHMFENYPPLRKYFKDPFFAKQGQKILLACHVLCATYDDRETAYTRELLDRHARDHVHMPPEVWTDFWKLFEEYLGKKTT-LDEPTKQAWHEIGREFAKEINK.... 147
8 -34.100d1cg5a_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Cartilaginous fish akaei (Dasyatis akajei) [TaxId: 31902]}  ali model 3D-neighbors follow..  13  5QNKKAIEELGNLIKANEAWGADALARLFELHPQTKTYFSNEQVKKHGKRVMNALADATHHLDNLHL-HLEDLARKHGE-NLLVDPHNFHLFADCIVVTLAVNLQAFTPVTHCAVDKFLELVAYELSSCYR. 141
9 -33.900d3d1ka1 a.1.1.2 (A:1-142) Hemoglobin, alpha-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]}  ali model 3D-neighbors follow..  13  5KDKAAVRALWSKIGKSDAIGNDALSRMIVVYPQTKIYFSSPNIKAHGKKVMGGIALAVSKIDDLKT-GLMELSEQHAY-KLRVDPSNFKILNHCILVVISTMFPKFTPEAHVSLDKFLSGVALALAERY.. 141
10 -33.900d1hlba_ a.1.1.2 (A:) Hemoglobin, different isoforms {Caudina arenicola, also known as Molpadia arenicola [TaxId: 7698]}  ali model 3D-neighbors follow..  20  15AQKKIVRKTWHQLMRNTSFVTDVFIRIFAYDPSAQNKFPSRQMQAHAIRVSSIMSEYVEELDSDIPELLATLARTHDL--NKVGADHYNLFAKVLMEALQAELGSFNEKTRDAWAKAFSVVQAVLLVKHG. 157
11 -33.600d1cg5b_ a.1.1.2 (B:) Hemoglobin, beta-chain {Cartilaginous fish akaei (Dasyatis akajei) [TaxId: 31902]}  ali model 3D-neighbors follow..  6DQEHYIKGVWKDV-DHKQITAKALERVFVVYPWTTRLFSDIGVQQHADKVQRALGEAIDDLKKVEI-NFQNLSGKHQE--IGVDTQNFKLLGQTFMVELALHYKKFRPKEHAAAYKFFRLVAEALSSNY.. 140
12 -32.200d1x9fb_ a.1.1.2 (B:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit II (globin B) {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}  ali model 3D-neighbors follow..  17  7LEGLKVKSEWGRAHDREAFSQAIWRATFAQVPESRSLFKHPAFIAHADRVLGGLDIAISTLDQPATLKEELDHLQVQHEGRKIPDNYFDAFKTAILHVVAAQLGRCYDR--EAWDACIDHIEDGIKGHH.. 145
13 -31.200d1b0ba_ a.1.1.2 (A:) Hemoglobin I {Clam (Lucina pectinata) [TaxId: 29163]}  ali model 3D-neighbors follow..  17  5AQKDNVKSSWAKASAAGTAGPEFFMALFDAHDDVFAKFNTPEMAAQAQSFKGLVSNWVDNLDNAGALEGQCKTFAANHKARGISAGQLEAAFKVLAGFMKSYGGD-----EGAWTAVAGALMGMIRPD... 141
14 -29.900d1mbaa_ a.1.1.2 (A:) Myoglobin {Slug sea hare (Aplysia limacina) [TaxId: 6502]}  ali model 3D-neighbors follow..  14  5AEADLAGKSWAPVFANNANGLDFLVALFEKFPDSANFFASPKLRDVSSRIFTRLNEFVNNAANAGKMSAMLSQFAKEHVGFGVGSAQFENVRSMFPGFVASVAA-PPAGADAAWTKLFGLIIDALKAAGA. 146
15 -29.800d1itha_ a.1.1.2 (A:) Hemoglobin {Innkeeper worm (Urechis caupo) [TaxId: 6431]}  ali model 3D-neighbors follow..  19  5AQIKAIQDHWFLNIKGCAAADSIFFKYLTAYPGDLAFFSNPAYKAQTLTVINYLDKVVDALGGNAGALMKAKVPSHDA--MGITPKHFGQLLKLVGGVFQEEFS-ADPTTVAAWGDAAGVLVAAMK..... 141
16 -29.300d3sdha_ a.1.1.2 (A:) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}  ali model 3D-neighbors follow..  10  12DVKKDLRDSWKVIGSDKGNGVALMTTLFADNQETIGYFANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLAS--KNFGDKYANAWAKLVAVVQAAL...... 145
17 -28.900d1ecda_ a.1.1.2 (A:) Erythrocruorin {Midge (Chironomus thummi thummi), fraction III [TaxId: 7154]}  ali model 3D-neighbors follow..  13  4DQISTVQASFDKVKGDP---VGILYAVFKADPSIMAKFGTAPFETHANRIVGFFSKIIGELPNIEA-DVNTFVASHK--PRGVTHDQLNNFRAGFVSYMKAHTD--FAGAEAAWGATLDTFFGMIFSK... 135
18 -28.800d1a6ma_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}  ali model 3D-neighbors follow..  15  5GEWQLVLHVWAKVEADAGHGQDILIRLFKSHPETLEKFDSEDLKKHGVTVLTALGAILKKKGHHEA-ELKPLAQSHATK-HKIPIKYLEFISEAIIHVLHSRHPDFGADAQGAMNKALELFRKDIAAKYKE 148
19 -28.500d1x9fa_ a.1.1.2 (A:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit IV (globin A) {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}  ali model 3D-neighbors follow..  13  6EDRREIRHIWDDVWSSVAIVRAVFDDLFKHYPTSKALFESGEFKSHLVRVANGLKLLINLLDDTLVSHLGHLADQHIQR-KGVTKEYFRGIGEAFARVLPQV---LSCFNVDAWNRCFHRLVARIAKDL.. 146
20 -27.600d2qfka1 a.1.1.2 (A:1-137) Dehaloperoxidase {Amphitrite ornata [TaxId: 129555]}  ali model 3D-neighbors follow..  11  2.....FKQDIATIRGDRTYAQDIFLAFLNKYPDERRYFSMAKFGDHTEKVFNLMMEVADRATDCVPLASDANTLVQMKQHSSLTTGNFEKLFVALVEYMRA---SGQSFDSQSWDRFGKNLVSALSSA... 134
21 -27.500d1x9fc_ a.1.1.2 (C:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit III (globin C) {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}  ali model 3D-neighbors follow..  12  8EDHRIVQKQWDILWRDIGFGRLLLTKLAKDIPEVNDLFKGPKFSAHALRILNGLDLAINLLDDPPAAALDHLAHQHEVR-EGVQKAHFKKFGEILATGLPQVLDD---YDALAWKSCLKGILTKISSR... 148
22 -27.200d1urva_ a.1.1.2 (A:) Cytoglobin {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  5AERKAVQAMWARLYANEDVGVAILVRFFVNFPSAKQYFRSPQLRKHASRVMGALNTVVENLHDPDSSVLALVGKAHAL-KHKVEPVYFKILSGVILEVVAEEFADFPPETQRAWAKLRGLIYSHVTAAYKE 151
23 -27.100d1h97a_ a.1.1.2 (A:) Trematode hemoglobin/myoglobin {Paramphistomum epiclitum [TaxId: 54403]}  ali model 3D-neighbors follow..  10  5HEQDILLKELGPHAHIVETGLGAYHALFTAHPQYISHFQSEGIKHYARTLTEAIVHMLKEISNDAEVKKIAAQYGKDHTSRKVTKDEFMSGEPIFTKYFQNLVK--DAEGKAAVEKFLKHVFPMMAAE... 146
24 -27.000d1kr7a_ a.1.1.4 (A:) Nerve tissue mini-hemoglobin (neural globin) {Milky ribbon-worm (Cerebratulus lacteus) [TaxId: 6221]}  ali model 3D-neighbors follow..  15  1............MVNWAAVVDDFYQELFKAHPEYQNKFGFKGVAKGNAAYKTQAGKTVDYINAAIGGSADAAGLASRHKGRNVGSAEFHNAKACLAKACSAHGADLGHAIDDILSHL.............. 110
25 -25.600d3d1kb1 a.1.1.2 (B:1-146) Hemoglobin, beta-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]}  ali model 3D-neighbors follow..  14  6KERSIISDIFSHM-DYDDIGPKALSRCLVVYPWTQRYFSNANVAAHGIKVLHGLDRGMKNMDNIAD-AYTDLSTLHSE-KLHVDPDNFKLLSDCITIVLAAKMGAFTAETQGAFQKFLAAVVSALGKQY.. 145
26 -23.600d1it2a_ a.1.1.2 (A:) Hagfish hemoglobin {Inshore hagfish (Eptatretus burgeri) [TaxId: 7764]}  ali model 3D-neighbors follow..  14GDKKAINKIWPKIYKEEQYSLNILLRFLKCFPQAQASFQDPEVKHQAVVIFNKVNEIINSMDNQEIKSLKDLSQKHKTV-FKVDSIWFKELSSIFVSTI---------DGGAEFEKLFSIICILLRSAY.. 146
27 -14.800d1or4a_ a.1.1.2 (A:) Heme-based aerotactic transducer HemAT, sensor domain {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  37AELYVLEQLQPLIQENVNIVDAFYKNLDH-ESSLMDIINDHSSVDRLKQTLKRHIQEMFAGVIDDEFIEKRNRIASIHLRIGLLPKWYMGAFQELLLSMIDIYEASITN-QQELLKAIKATTKIL...... 160
28 -14.000d1dlwa_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Ciliate (Paramecium caudatum) [TaxId: 5885]}  ali model 3D-neighbors follow..  15  13................QAVTAQFYANIQA-DATVATFFNGIDMPNQTNKTAAFLCAALGGPNAWTGRNLKE-----VHANMGVSNAQFTTVIGHLRSALTGVAAALVEQTVAVAETVRGDVVTV....... 116
29 -13.900d1idra_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Mycobacterium tuberculosis, HbN [TaxId: 1773]}  ali model 3D-neighbors follow..  17  9REPISIYDKIGGHEAIEVVVEDFYVRVLA-DDQLSAFFSGTNMSRLKGKQVEFFAAALGGPEPYTGAPMKQ-----VHQGRGITMHHFSLVAGHLADALTAA--GVPSETITEILGVIAPLAVDVTS.... 127
30 -12.500d1s69a_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Cyanobacteria (Synechocystis sp.), pcc 6803 [TaxId: 1143]}  ali model 3D-neighbors follow..  20  14................DLAVDKFYERVLQ-DDRIKHFFADVDMAKQRAHQKAFLTYAFGGTDKYDGRYMRE-AHKELVENHGLNGEHFDAVAEDLLATLKEM............................. 97
31 -12.200d1ngka_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Mycobacterium tuberculosis, HbO [TaxId: 1773]}  ali model 3D-neighbors follow..  19  1......KSFYDAVGGAKTFVSRFYAQV-AEDEVLRRVYPEDDLAGAEERLRMFLEQYWGGPRTYSEQR----RLRMRHAPFRISLIERDAWLRCMHTAVASIDETLDDEHRRELLDYLEMAAHSLVNS... 124
32 -9.450d1ux8a_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  16  14.................QLVDTFYERV-ASHPLLKPIFPS-DLTETARKQKQFLTQYLGGPPLYTEEH----MLRARHLPFPITNERADAWLSCMKDAMDHV--GLEGEIREFLFGRLELTARHMVNQ... 119

FFAS is supported by the NIH grant R01-GM087218-01
6 7 7 2 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Slabinski L, Jaroszewski L, Rodrigues AP, Rychlewski L, Wilson IA, Lesley SA, Godzik A. The challenge of protein structure determination--lessons from structuralgenomics. Protein Sci. 2007 Nov;16(11):2472-82.