current user: public

Query: d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]}, from SCOP175

Results of FFAS03 search in SCOP175
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90
1 -54.200d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors  100  1RLDAPSQIEVKDVTDTTALITWFKPLAEIDGIELTYGIKDVPGDRTTIDLTEDENQYSIGNLKPDTEYEVSLISRRGDMSSNPAKETFTT 90
2 -51.400d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  26  1.LDSPTGIDFSDITANSFTVHWIAPRATITGYRIRHHPEHFSGRPREDRVPHSRNSITLTNLTPGTEYVVSIVALNGREESPLLIGQQST 89
3 -50.000d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  24  1NIDRPKGLAFTDVDVDSIKIAWESPQGQVSRYRVTYSSPEDGIHELFPAPDGEEDTAELQGLRPGSEYTVSVVALHDDMESQPLIGTQST 90
4 -49.600d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  27  1..PAPTDLKFTQVTPTSLSAQWTPPNVQLTGYRVRVTPKEKTGPMKEINLAPDSSSVVVSGLMVATKYEVSVYALKDTLTSRPAQGVVTT 88
5 -47.500d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]}  ali model 3D-neighbors follow..  22  1.VGSPKGISFSDITENSATVSWTPPRSRVDSYRVSYVPITG-GTPNVVTVDGSKTRTKLVKLVPGVDYNVNIISVKGFEESEPISGILKT 88
6 -47.300d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  22  1.VPPPTDLRFTNIGPDTMRVTWAPPSIDLTNFLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYVVSVSSVYEQHESTPLRGRQKT 90
7 -47.100d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]}  ali model 3D-neighbors follow..  31  1..DNPKDLEVSDPTETTLSLRWRRPVAKFDRYRLTYVSPS--GKKNEMEIPVDSTSFILRGLDAGTEYTISLVAEKGRHKSKPTTIKGST 86
8 -46.700d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  23  1NVSPPRRARVTDATETTITISWRTKTETITGFQVDAVPANG-QTPIQRTIKPDVRSYTITGLQPGTDYKIYLYTLNDNARSSPVVIDAST 89
9 -46.500d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  22  1.IDAPKNLRVGSRTATSLDLEWDNSEAEAQEYKVVYSTLAGEQYHEVLKGIGPTTKTTLTDLVPGTEYGVGISAVMNSKQSIPATMNART 91
10 -46.300d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  21  3SRPRLSQLSVTDVTTSSLRLNWEAPPGAFDSFLLRFGVPSPSLLQRELMVPGTRHSAVLRDLRSGTLYSLTLYGLRGPHKADSIQGTART 100
11 -46.200d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  32  2.LEAPRDLEAKEVTPRTALLTWTEPPVRPAGYLLSFHTPG--GQTQEILLPGGITSHQLLGLFPSTSYNARLQAMWGQSLLPPVSTSFTT 88
12 -46.100d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  18  5EVPQLTDLSFVDITDSSIGLRWTPLNSSIIGYRITVVAAGEGIPIFEDFVDSSVGYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQT 95
13 -45.000d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  21  1.....RDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYAVTGRGDSPASSKPISI 85
14 -44.200d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  24  1.LDSPRDLMVTASSETSISLIWTKASGPIDHYRITFTPSS--GISSEVTVPRDRTSYTLTDLEPGAEYIISITAERGRQQSLESTVDA.. 85
15 -43.900d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  22  1.PDGPTQLRALNLTEGFAVLHWKPPQNPVDTYDIQVTAPG--APPLQAETPGSAVDYPLHDLVLHTNYTATVRGLRGPNLTSPASITFTT 87
16 -39.900d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  22  2.LSPPTNLHLEANPDGVLTVSWERSTTPITGYRITTTPTNGQGNSLEEVVHADQSSCTFDNLSPGLEYNVSVYTVKDDKESVPISDTIIP 93
17 -39.600d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  26  1..SGPVEITETPSQPNSHPIQWNAPPSHISKYILRWRPKNSVGRWKEATIPGHLNSYTIKGLKPGVVYEGQLISIQQYGHQEVTRFDFTT 91
18 -37.600d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  1DLGAPQNPNAKAAGSRKIHFNWLPPSGKPMGYRVKYWIQG-DSESEAHLLDSKVPSVELTNLYPYCDYEMKVCAYGAQGEGPYSSVSCRT 90
19 -35.800d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  14  11.PGPVGHLSFSEILDTSLKVSWQEPNGILTGYRISWEEYNRTNTRVTHYLPNVTLEYRVTGLTALTTYTIEVAAMTSKGQGQVSASTISS 102
20 -35.600d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  21  3..AGPYITFTDAVNETTIMLKWMYINTPIHGFYIYYRPTDSDNDSKKDMVEGDRYWHSISHLQPETSYDIKMQCFNEGGESEFSNMICET 98
21 -35.500d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  19  11.PSAPRDVVASLVSTRFIKLTWRTPAGDNLTYSVFYTKEGIARERVENTSHPGEMQVTIQNLMPATVYIFRVMAQNKHGSGESSAPLRVE 103
22 -35.400d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  18  16.PGPPSKPQVTDVTKNSVTLSWQPGTLPASAYIIEAFSQSVSNSWQTVANHVKTTLYTVRGLRPNTIYLFMVRAINPQGLSDPSPMS... 104
23 -35.100d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  19  18.LSNIVKPVASDIQARTVVLTWSPPSPELYGYEVLISSTGKDGKYKSV-YVGEETNITLNDLKPAMDYHAKVQAEYNSIKGTPSEAEIFT 117
24 -34.800d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  2.MMPPVGVQASILSHDTIRITWADNSTDSRYYTVRWKTNIPANT-KYKNANATTLSYLVTGLKPNTLYEFSVMVTKGRRSSTWSMAHGTT 97
25 -34.700d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  21  10..GPPMDVTLQPVTSQSIQVTWKAPNGVIRGYQIGYRENSPGSNGQEMKATGDSEVYTLDNLKKFAQYGVVVQAFNRAGTGPSSSINATT 107
26 -34.400d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  3.PSEPGRLAFNVVSSTVTQLSWAEPNGEITAYEVCYGLVNDDNRKKVLVDNPKNRMLLIENLRESQPYRYTVKARNGAGWGPEREAIINL 99
27 -34.300d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  1.PSAPKLEGQMGEDGNSIKVNLIKQDSPIRHYLVRYRALSSE--KPEIRLPSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVFRT 91
28 -34.300d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}  ali model 3D-neighbors follow..  19  7.MPVPELLEIEEYSETAVVLHWSLASHLITGYYAYYRPSSSAGEYFKATIGAHARSFKIAPLETATMYEFKLQSFSAASASEFSA..... 95
29 -34.200d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  21.PGPPMGILFPEVRTTSVRLIWQPPNGIILAYQITHRLNTTTANTATVVLAPSARQYTATGLKPESVYLFRITAQTRKGWGEAAEALVVT 113
30 -33.900d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  18  13..AAPQNLSLEVRNSKSIMIHWQPPNGQITGYKIRYRKASRKSDVTETLVSGTQLSQLIEGLDRGTEYNFRVAALTINGTGPATDLSAET 106
31 -33.700d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  19  1.PSTVPIMHQVSATMRSITLSWPQPNGIILDYEIRYYEKE-HNEFNSSMARSQTNTARIDGLRPGMVYVVQVRARTVAGYGKFSKMCFQT 92
32 -33.500d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  16..VAPGNVRVNVVNSTLAEVHWDPVRGHLQGYRIYYWKTQSSSEKKILTFQGSKTHGMLPGLEPFSHYTLNVRVVNGKGEGPASPRVFNT 116
33 -33.400d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  12  11.PGPPTNLGISNIGPRSVTLQFRPGKTSISRWLVEAQVGVVGEGEEQLSNEPDARSMEVPDLNPFTCYSFRMRQVNIVGTSPPSSRKIQT 109
34 -33.000d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  11.PGPAPNLRAYAASPTSITVTWETPNGEIQNYKLYYMEKGTD---KEQDVDVSSHSYTINGLKKYTEYSFRVVAYNKHGPGVSTPVAVRT 100
35 -32.800d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  16  11.PEAPDRPTISTASETSVYVTWIPRGFPIQSFRVEYKKLKKVGDWILAAIPPSRLSVEITGLEKGISYKFRVRALNMLGESEPSAPS... 101
36 -32.800d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  10EPDIPNPPRIANRTKNSLTLQWKAPSSKIQNFVLEWDEGKGNGEFCQC-YMGSQKQFKITKLSPAMGCKFRLSARNDYGTSGFSEEVLYY 101
37 -32.600d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  11.PGQPLNFKAEPESETSILLSWTPPSDTIANYELVYKDGEHGEEQRITI--EPGTSYRLQGLKPNSLYYFRLAARSPQGLGASTAISART 99
38 -32.500d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  11.PHAPEHATLSTVERRAINLTWTKPFSPLIRYILEMSENNAPWTVLLASVDPKATSVTVKGLVPARSYQFRLCAVNDVGKGQFSKDT... 101
39 -32.500d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  1.PDQCKPPQVTCRSATCAQVNWEVPLTDVTEYRLEWGGVEGS---MQICYCGPGLSYEIKGLSPATTYYCRVQALSVVGAGPFSEVVACV 89
40 -32.400d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  19  1.PSMPASPVLTKAGITWLSLQWSKPSDEGISYILEMEEETSGYGFKPKY-DGEDLAYTVKNLRRSTKYKFKVIAYNSEGKSNPSEVVEFT 92
41 -32.000d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]}  ali model 3D-neighbors follow..  12  7...NPDNVVGQGTEPNNLVISWTPMNAPNFHYYVSWKRDIPAAAWENNNIDWRQNNIVIADQPTFVKYLIKVVAINDRGESNVAAEEVVG 99
42 -32.000d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  24  21.PEVPSSLHV-RPLVTSIVVSWTPPNIVVRGYAIGYGIGSPH--AQTIKVDYKQRYYTIENLDPSSHYVITLKAFNNVGEGIPLYESAVT 109
43 -31.800d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  13  3..NELLKFSYIRTSFDKILLRWEPYWRDLLGFMLFYKEAPYQNLRSNDPKSQNHPGWLMRGLKPWTQYAIFVKTLVTFSDERRTYIYVQT 123
44 -31.700d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  7.GLSPPRGLVAVRTPRGVLLHWDPPEKRLDGYVLEGRQGSQGWEVLDPAVAGTETELLVPGLIKDVLYEFRLVAFAGSFVSDPSNTANVS 98
45 -31.400d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  17.PNPPFDLELTDQLDKSVQLSWTPGNSPITKFIIEYEDAMHKPGLHHQTEVSGTQTTAQLNLSPYVNYSFRVMAVNSIGKSLPSEAS... 106
46 -31.000d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  22  1.PGRP-TMMISTTAMNTALLQWHPPKGELLGYRLQYCRAD-EARPNTIDFGKDDQHFTVTGLHKGTTYIFRLAAKNRAGLGEEFEKEIRT 90
47 -30.900d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  16  18...LVRLHNPVVLTPTTVQVTWTVDPQFIQGYRVMYRQTSGLQAQNLDAKVPTERSAVLVNLKKGVTYEIKVRPYFNEFQGMDSESKTVR 110
48 -30.700d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  13..SPPKDVTVKEGKPKTIIVNWQPPNGKITGYIIYYSTDVNAHDWVIEPVVGNRLTHQIQELTLDTPYYFKIQARNSKGMGPMSEVQFRT 108
49 -30.400d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  15  3.SLSGLSLKLVKKEPRQLELTWAGSRGGNLSYELHVLNQD-----EEWHQMVLEPRVLLTKLQPDTTYIVRVRTLTPLGPGPSPDHEFRT 91
50 -29.500d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  15  16.LSKPHPPVVGKVTHHSIELYWDLEQQGPQEQWLRFS-EDPKMHSYGVIYTGYATRHVVEGLEPRTLYKFRLKVTSPSGEYEYSPVVSVA 110
51 -29.100d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  14  5.DDIVGPVTHEIFENNVVHLMWQEPNGLIVLYEVSYRRYGDEELHLTRKHFALERGCRLRGLSPGN-YSVRIRATSLAGNGSWTETYFYV 98
52 -29.000d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}  ali model 3D-neighbors follow..  15  2...PPTPPNVTRLSDESVMLRWMVPRLPIVIFKVQYRMVGKRKNWQTTNELGKSFTASVTDLKPQHTYRFRILAVYSNNDNKESNTS... 100
53 -28.600d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  13  10KPGIPVKSVKGKIHSHSFKITWDPPKATINKYVVEMAEGSNGNKWEMIY-SGATREHLCDRLNPGCFYRLRVYCISDGGQSAVSESLLVQ 103
54 -28.400d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  11  8.PGAPSTVRI-SKNVDGIHLSWEPPTGNILEYSAYLAIRTAQGLKTSCTVTAGQLANAHIDYTSRPAIVFRISAKNEKGYGPATQIRWLQ 113
55 -28.200d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  22  2.TSAPQHLTVEDVTDTTTTLKWRPPDGGIDGYLVEYCLEGSEEWVPANKEPVERCGFTVKDLPTGARILFRVVGVNIAGRSEPATLL... 91
56 -28.100d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]}  ali model 3D-neighbors follow..  13  6.PNAPKLTGI-TCQADKAEIHWEQQGSPILHYTIQFNTSFTPASDAAYEKVPNTDSSFVVQMSPWANYTFRVIAFNKIGASPPSAHS... 94
57 -27.700d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  19  3.PSSPSIDQV-EPYSSTAQVQFDEPEVPILKYKAEWRAVGEEVWHSDAKEASMEGIVTIVGLKPETTYAVRLAALNGKGLGEISAASEFK 97
58 -27.500d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  16  11.PAPPQDVTVQGVTPATIRVSWRPPVANVTGYGVYA---KGQRVAEVIFPTADSTAVELVRLRSLEAKGVTVRTLSAQGESVDSAVAAVP 106
59 -26.500d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  19  3.IDPPGKPVPLNITRHTVTLKWAKPEFKITSYIVEKRDLPNGRWLKANFSNILENEFTVSGLTEDAAYEFRVIAKNAAGAISPPS..... 90
60 -26.000d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  4KPNPPHNLSVSEELSSILKLTWTNPSVIILKYNIQYRTKDASTQIPPEDTASTRSSFTVQDLKPFTEYVFRIRCMKEDGKG......... 91
61 -26.000d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  19  1KPRAPGNLTVHTNVSDTLLLTWSNPYPPDNTYAVNIWSENDPADFRIYNVTYLEPSLRISTLKSGISYRARVRAWAQAYNT......... 89
62 -25.600d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  13  18.PSQPPGNVVWNATDTKVLLNWEQVESEVTGYKVFYRTSSQN----NVQVLNTNKTSAELVLPIKEDYIIEVKATTDGGDGTSSEQIRIP 107
63 -25.500d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  12  2.PGPCLPPRLQRPKAKEIQLRWGPPLSPISCYSVEMSPIEKDEPREVYQ--GSEVECTVSSLLPGKTYSFRLRAANKMGFGPFSEKCDIT 93
64 -25.300d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  22  2RLMAPISLQVVHVETHRCNISWEISQAS--EFEARTLSPGHTEEAPLLTLKQKQEWICLETLTPDTQYEFQVRV................ 81
65 -24.400d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  12  2NPSVPLDPISVSNSSSQIILKWKPPNGNITHYLVFWERQAEDSEHRPFEKVVNKESLVISGLRHFTGYRIELQACNQDTPEERCSVSART 194
66 -24.400d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  4LLDAPVGLVARLADESGVVLRWLPPPETPMRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRA................ 82
67 -24.000d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  10  2IPWAPENLTLHKLSESQLELNWNNRLNHCLEHLVQYRTDWDHSWTEQSV--DYRHKFSLPSVDGQKRYTFRVRS................ 74
68 -23.800d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  19  1QPDPPANITVTAVARNPLSVTWQDPHSWNSSFELRYRAERSKT--TTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQG......... 87
69 -22.700d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  14  1KLEPPMLQALDSHQPGCLWLSWKPWKPS--ECELRYQPQLKGANWTLVFLPSSKDQFELCGLHQAPVYTLQMRCIRSSLPG......... 91
70 -22.500d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  14  5QPPEPRDLQI-STDQDHFLLTWSVALGSPQSFEVVYKRLQDSEDAAILLSNTSQATLGPEHLMPSSTYVARVRT................ 87
71 -22.000d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  14  7KPDPPENVVARPVPSNPLEVTWQTPST---KFFLRYRPLILDQ---QHVELSNGTAHTITDAYAGKEYIIQVAA................ 86
72 -21.900d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  12  5QMAPP-SLQVTK-DGDSYSLRWETMKMRYETFEIQYRKDTATWKDSKTETLQNAHSMALPALEPSTRYWARVRV................ 80
73 -21.200d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]}  ali model 3D-neighbors follow..  16  4.PTAPTNLASTAQTTSSITLSWTASTDNVTGYDV---------NGTALATTVTGTTATISGLAADTSYTFTVKAKDAAGNVSAASVSVKT 88
74 -20.700d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  1.PDPPIALNWTLLNHADIQVRWEAPRNA--EYELQYKEVNETK---KMMDPILTTSVPVYSLKVDKEYEVRVRS................ 84
75 -20.700d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  12  2EPEPPRNLTLEKDKKTYLWVKWSPPTIT--EYEIRLKPEEAEEWEIHFTG--HQTQFKVFDLYPGQKYLVQTRCKPDHG........... 89

FFAS is supported by the NIH grant R01-GM087218-01
7 6 4 0 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Grynberg M, Jaroszewski L, Godzik A. Domain analysis of the tubulin cofactor system: a model for tubulin folding and dimerization. BMC Bioinformatics. 2003 Oct 10;4(1):46.