current user: public

Query: d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]}, from SCOP175

Results of FFAS03 search in SCOP175
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90
1 -53.900d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors  100  1RLDAPSQIEVKDVTDTTALITWFKPLAEIDGIELTYGIKDVPGDRTTIDLTEDENQYSIGNLKPDTEYEVSLISRRGDMSSNPAKETFTT 90
2 -50.700d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  24  1NIDRPKGLAFTDVDVDSIKIAWESPQGQVSRYRVTYSSPEDGIHELFPAPDGEEDTAELQGLRPGSEYTVSVVALHDDMESQPLIGTQST 90
3 -50.100d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  26  2..DSPTGIDFSDITANSFTVHWIAPRATITGYRIRHHPEHFSGRPREDRVPHSRNSITLTNLTPGTEYVVSIVALNGREESPLLIGQQST 89
4 -48.900d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  27  1..PAPTDLKFTQVTPTSLSAQWTPPNVQLTGYRVRVTPKEKTGPMKEINLAPDSSSVVVSGLMVATKYEVSVYALKDTLTSRPAQGVVTT 88
5 -48.100d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  23  1NVSPPRRARVTDATETTITISWRTKTETITGFQVDAVPANGQTP-IQRTIKPDVRSYTITGLQPGTDYKIYLYTLNDNARSSPVVIDAST 89
6 -47.400d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  18  5EVPQLTDLSFVDITDSSIGLRWTPLNSTIIGYRITVVAAGEGIPIFEDFVDSSVGYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQT 95
7 -47.200d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  22  2..PPPTDLRFTNIGPDTMRVTWAPPPIDLTNFLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYVVSVSSVYEQHESTPLRGRQKT 90
8 -47.100d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  31  2.LEAPRDLEAKEVTPRTALLTWTEPPVRPAGYLLSFHTPGGQT--QEILLPGGITSHQLLGLFPSTSYNARLQAMWGQSLLPPVSTSFTT 88
9 -47.000d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]}  ali model 3D-neighbors follow..  21  2..GSPKGISFSDITENSATVSWTPPRSRVDSYRVSYVPITGGTP-NVVTVDGSKTRTKLVKLVPGVDYNVNIISVKGFEESEPISGILKT 88
10 -46.800d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  22  2..DAPKNLRVGSRTATSLDLEWDNSEAEAQEYKVVYSTLAGEQYHEVPKGIGPTTKTTLTDLVPGTEYGVGISAVMNSKQSIPATMNART 91
11 -46.300d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]}  ali model 3D-neighbors follow..  30  1..DNPKDLEVSDPTETTLSLRWRRPVAKFDRYRLTYVSPSGKKN--EMEIPVDSTSFILRGLDAGTEYTISLVAEKGRHKSKPTTIKGST 86
12 -45.900d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  21  4.RPRLSQLSVTDVTTSSLRLNWEAPPGAFDSFLLRFGVPSPSTLQRELMVPGTRHSAVLRDLRSGTLYSLTLYGLRGPHKADSIQGTART 100
13 -44.500d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  11.PSAPRDVVASLVSTRFIKLTWRTPHGDNLTYSVFYTKEGIARERVENTSHPGEMQVTIQNLMPATVYIFRVMAQNKHGSGESSALRVET 104
14 -44.400d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  18  16.PGPPSKPQVTDVTKNSVTLSWQPGTLPASAYIIEAFSQSVSNSWQTVANHVKTTLYTVRGLRPNTIYLFMVRAINPQGLSDPSPMS... 104
15 -44.100d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  21  1.....RDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYAVTGRGDSPASSKPISI 85
16 -44.100d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  24  1.PDGPTQLRALNLTEGFAVLHWKPPQNPVDTYDIQVTAPGAPPL--QAETPGSAVDYPLHDLVLHTNYTATVRGLRGPNLTSPASITFTT 87
17 -43.000d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  14  11.PGPVGHLSFSEILDTSLKVSWQEPNGILTGYRISWEEYNRTNTRVTHYLPNVTLEYRVTGLTALTTYTIEVAAMTSKGQGQVSASTISS 102
18 -42.900d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  1DLGAPQNPNAKAAGSRKIHFNWLPPSGKPMGYRVKYWIQGDSES-EAHLLDSKVPSVELTNLYPYCDYEMKVCAYGAQGEGPYSSVSCRT 90
19 -42.900d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  22  2..DSPRDLMVTASSETSISLIWTKASGPIDHYRITFTPSSGISS--EVTVPRDRTSYTLTDLEPGAEYIISITAERGRQQSLESTVD... 84
20 -42.600d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  3.PSEPGRLAFNVVSSTVTQLSWAEPNGEITAYEVCYGLVNDDNRKKVLVDNPKNRMLLIENLRESQPYRYTVKARNGAGWGPEREAIINL 99
21 -42.600d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  1.PSAPKLEGQMGEDGNSIKVNLIKQDSPIRHYLVRYRALSSE-WKPEIRLPSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVFRT 91
22 -42.500d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  22  2.TSAPQHLTVEDVTDTTTTLKWRPPDGGIDGYLVEYCLEGSEEWVPANKEPVERCGFTVKDLPTGARILFRVVGVNIAGRSEPATLL... 91
23 -42.400d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  25  1..SGPVEVFITPSQPNSHPIQWNAPPSHISKYILRWRPKNSVGRWKEATIPGHLNSYTIKGLKPGVVYEGQLISIQQYGHQEVTRFDFTT 91
24 -41.900d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  21.PGPPMGILFPEVRTTSVRLIWQPPNGIILAYQITHRLNTTTATATVEVLAPSARQYTATGLKPESVYLFRITAQTRKGWGEAAEALVVT 113
25 -41.700d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  2.LSPPTNLHLEANDTGVLTVSWERSTPDITGYRITTTPTNGQQGNSEEVVHADQSSCTFDNLSPGLEYNVSVYTVKDDKESVPISDTIIP 93
26 -41.400d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  19  1.PSMPASPVLTKAGITWLSLQWSKPSDEGISYILEMEEETSGYGFK-PKYDGEDLAYTVKNLRRSTKYKFKVIAYNSEGKSNPSEVVEFT 92
27 -41.300d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  11  11.PGPPTNLGISNIGPRSVTLQFRPGKTSISRWLVEAQVGVVGEGEEQLSNEPDARSMEVPDLNPFTCYSFRMRQVNIVGTSPPSQPS... 104
28 -41.300d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  10EPDIPNPPRIANRTKNSLTLQWKAPSSKIQNFVLEWDEGKGNGEFCQC-YMGSQKQFKITKLSPAMGCKFRLSARNDYGTSGFSEEVLYY 101
29 -41.200d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  21  2.VAGPYITFTDAVNETTIMLKWMYINTPIHGFYIYYRPTDSDNDSKKDMVEGDRYWHSISHLQPETSYDIKMQCFNEGGESEFSNMICET 98
30 -41.100d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  21  8.LSPPRGL-VAVRTPRGVLLHWDPPPKRLDGYVLEGRQGSQGWEVLDPAVAGTETELLVPGLIKDVLYEFRLVAFAGSFVSDPSNTANVS 98
31 -41.000d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  1.PSTVPIMHQVSATMRSITLSWPQPNGIILDYEIRYYEKEHNEF-NSSMARSQTNTARIDGLRPGMVYVVQVRARTVAGYGKFSGMCFQT 92
32 -40.900d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  16  11.PHAPEHATLSTVERRAINLTWTKPNSPLIRYILEMSENNAPWTVLLASVDPKATSVTVKGLVPARSYQFRLCAVNDVGKGQFSKDTERV 104
33 -40.800d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}  ali model 3D-neighbors follow..  19  7.MPVPELLEIEEYSETAVVLHWSLASHLITGYYAYYRPSSSAGEYFKATIGAHARSFKIAPLETATMYEFKLQSFSAASASEFSA..... 95
34 -40.800d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  12.SAAPQNLSLEVRNSKSIMIHWQPPNGQITGYKIRYRKASRKSDVTETLVSGTQLSQLIEGLDRGTEYNFRVAALTINGTGPATDLSAET 106
35 -40.800d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  2.MMPPVGVQASILSHDTIRITWADNSTDSRYYTVRWKTNIPANT-KYKNANATTLSYLVTGLKPNTLYEFSVMVTKGRRSSTWSMAHGTT 97
36 -40.600d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  17.PNPPFDLELTDQLDKSVQLSWTPGNSPITKFIIEYEDAMHKPGLHHQTEVSGTQTTAQLNLSPYVNYSFRVMAVNSIGKSLPSEAS... 106
37 -40.600d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  16  11.PEAPDRPTISTASETSVYVTWIPRGFPIQSFRVEYKKLKKVGDWILATIPPSRLSVEITGLEKGISYKFRVRALNMLGESEPSAPS... 101
38 -40.100d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  16  1KPRAPGNLTVHTNVSDTLLLTWSNPYPPHLTYAVNIWSENDPADFRNVTYLEPSLRIAASTLKSGISYRARVRAWAQAYNTTWSEWSPST 98
39 -40.100d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  11.PGQPLNFKAEPESETSILLSWTPPSDTIANYELVYKDGEHGEEQRITI--EPGTSYRLQGLKPNSLYYFRLAARSPQGLGASTAISART 99
40 -40.000d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  11.PGPAPNLRAYAASPTSITVTWETPNGEIQNYKLYYMEKGTDKEQ---DVDVSSHSYTINGLKKYTEYSFRVVAYNKHGPGVSTPVAVRT 100
41 -39.900d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  22  1.PGRP-TMMISTTAMNTALLQWHPPKGELLGYRLQYCRADEARP-NTIDFGKDDQHFTVTGLHKGTTYIFRLAAKNRAGLGEEFEKEIRT 90
42 -39.900d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  1.PDQCKPPQVTCRSATCAQVNWEVPLTDVTEYRLEWGGVEGSMQ---ICYCGPGLSYEIKGLSPATTYYCRVQALSVVGAGPFSEVVACV 89
43 -39.800d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  22  21.PEVPSSLHVR-PLVTSIVVSWTPPNIVVRGYAIGYGIGSPHAQTIK--VDYKQRYYTIENLDPSSHYVITLKAFNNVGEGIPLYESAVT 109
44 -39.600d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  19  3.IDPPGKPVPLNITRHTVTLKWAKPEFKITSYIVEKRDLPNGRWLKANFSNILENEFTVSGLTEDAAYEFRVIAKNAAGASPPSEPS... 93
45 -39.500d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  21  10..GPPMDVTLQPVTSQSIQVTWKAPNGVIRGYQIGYRENSPGSNGQEMKATGDSEVYTLDNLKKFAQYGVVVQAFNRAGTGPSSSINATT 107
46 -39.500d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  22  18.LSNIVKPVASDIQARTVVLTWSPPSPELYGYEVLISSTGKDGKYKSV-YVGEETNITLNDLKPAMDYHAKVQAEYNSIKGTPSEEIFTT 118
47 -39.100d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  16..VAPGNVRVNVVNSTLAEVHWDPVRGHLQGYRIYYWKTQSSSKKKILTFQGSKTHGMLPGLEPFSHYTLNVRVVNGKGEGPASPRVFNT 116
48 -38.700d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]}  ali model 3D-neighbors follow..  12  5.FKNPDNVVGQGTEPNNLVISWTPMNAPNFHYYVSWKRDIPAAAWENNNIDWRQNNIVIADQPTFVKYLIKVVAINDRGESNVAAEEVVG 99
49 -38.500d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}  ali model 3D-neighbors follow..  15  2...PPTPPNVTRLSDESVMLRWMVPRLPIVIFKVQYRMVGKRKNWQTTNELGKSFTASVTDLKPQHTYRFRILAVYSNNDNKESNTS... 100
50 -38.400d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  16.DVLVRLHNPVVLTPTTVQVTWTVDPQFIQGYRVMYRQTSGLQWQNLDAKVPTERSAVLVNLKKGVTYEIKVRPYFNEFQGMDSEKTVRT 111
51 -38.000d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  18  2TPSSPSIDQV-EPYSSTAQVQFDEPEVPILKYKAEWRAVGEEVWHSDAKEASMEGIVTIVGLKPETTYAVRLAALNGKGLGEISAASEFK 97
52 -37.900d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  18  1QPDPPANITVTAVNPRWLSVTWQDPHSWRLRFELRYRAERSKTF-TTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSE..... 91
53 -37.500d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  10KPGIPVKPSVKKIHSHSFKITWDPPKATINKYVVEMAEGSNGNKWEMIY-SGATREHLCDRLNPGCFYRLRVYCISDGGQSAVSESLLVQ 103
54 -37.500d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]}  ali model 3D-neighbors follow..  13  6.PNAPKLTGI-TCQADKAEIHWEQQRSPILHYTIQFNTSFTPAWDAAYEKVPNTDSSFVVQMSPWANYTFRVIAFNKIGASPPSAHS... 94
55 -37.300d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  14  5.DDIVGPVTHEIFENNVVHLMWQEPNGLIVLYEVSYRRYGDEELHLTRKHFALERGCRLRGLSPGN-YSVRIRATSLAGNGSWTEPTYFY 97
56 -37.300d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  2RLMAPISLQVVHVETHRCNISWEISQERHLEFEARTLSPGHTWEEPLLTLKQKQEWICLETLTPDTQYEFQVRVKPLQGEFTSQPLAFRT 102
57 -37.200d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  14  16.LSKPHPPVVGKVTHHSIELYWDLEQKEWLRFSIEEEDPKMHSYGVI--YTGYATRHVVEGLEPRTLYKFRLKVTSPSGEYEYSPVVSVA 110
58 -37.100d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  13  3..NELLKFSYIRTSFDKILLRWEPYWRDLLGFMLFYKEAPYQNLRSNDPKSQNHPGWLMRGLKPWTQYAIFVKTLVTFSDERRTYIYVQT 123
59 -36.900d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  19  4KPNPPHNLSVSEELSSILKLTWTNPSVIILKYNIQYRTKDASTWSQPEDTASTRSSFTVQDLKPFTEYVFRIRCMKEDGKGYWSDWS... 97
60 -36.700d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  4LLDAPVGLVARLAESGHVVLRWLPPPETHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGSEPVSLLT 104
61 -36.600d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  12.TSPPKDVTVVEGKPKTIIVNWQPPNGKITGYIIYYSTDVNAEIHVIEPVVGNRLTHQIQELTLDTPYYFKIQARNSKGMGPMSEVQFRT 108
62 -36.400d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  15  3.SLSGLSLKLVKKEPRQLELTWAGSRGGNLSYELHVLNQDEEWHQMV-----LEPRVLLTKLQPDTTYIVRVRTLTPLGPGPFSPHEFRT 91
63 -36.300d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  10  8.PGAPSTVRI-SKNVDGIHLSWEPPSGNILEYSAYLAIRTAQMQDTSCTVTAGQLANAHIDYTSRPAIVFRISAKNEKGYGPATQIRWLQ 113
64 -35.500d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  12  1KLEPPMLQALVSHQPGCLWLSWKPWKPSEQECELRYQPQKGANWTLVFHLPSSKDQFELCGLHQAPVYTLQMRCIRSSLPGFWSPLQLRP 104
65 -35.100d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  12  2.PGPCLPPRLQRPKAKEIQLRWGPPLSPISCYSVEMSPIEKDEPREVYQ--GSEVECTVSSLLPGKTYSFRLRAANKMGFGPFSEKCDIT 93
66 -34.500d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  10  2IPWAPENLTLHKLSESQLELNWNNRLNHCLEHLVQYRTDWDHSWTEQSVD--YRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQH..... 85
67 -34.300d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  11  2EPEPPRNLTLEKDKKTYLWVKWSPPTITTMEYEIRLKPEEAEEWEIHFTG--HQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWSQESSV 100
68 -33.800d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  4.PEKPKNLSCIVNEGKKMRCEWDGGTHLETNFTLKSEWATHKFADCKAKRDTPTSCTVDYSTVYFVNIEVWVEAENALGKVTSDHINFDP 94
69 -33.600d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  13  18.PSQPPGNVVWNATDTKVLLNWEQVESEVTGYKVFYRTSSQNNV----QVLNTNKTSAELVLPIKEDYIIEVKATTDGGDGTSSEQIRIP 107
70 -33.300d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  10  1KPDPPKNLQLKPLKSRQVEVSWEYPDTWSLTFCVQVQGKSKREKKDR-----VFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVP 93
71 -33.300d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  11.PAPPQDVTVQGVTPATIRVSWRPPVLTVTGYGVYA---KGQRVAEVIFPTADSTAVELVRLRSLEAKGVTVRTLSAQGESVDSAVAAVP 106
72 -33.200d1f6fb1 b.1.2.1 (B:5-100) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  11  1..GKPEIHKCRSPDKETFTCWWNPGGGLPTNYSLTYSKEGEKTTYEYKTSGPNSCFFSKQYTSIWKIYIITVNATNQMGSSSSDPLYVDV 93
73 -32.800d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  11  2NPSVPLDPISVSNSSSQIILKWKPPNGNITHYLVFWERQAEDEEHRPFEKVVNKESLVISGLRHFTGYRIELQACNQDTPEERCSVAAYV 190
74 -32.500d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  18  1.PDPPIALNWTTGIHADIQVRWEAPRNAVLEYELQYKEVNETKWKMMDPI--LTTSVPVYSLKVDKEYEVRVRSKQRNSGN......... 91
75 -32.100d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  14  5QPPEPRDLQI-STDQDHFLLTWSVALGSDLEFEVVYKRLQDSWEDAALLSNTSQATLGPEHLMPSSTYVARVRTRLAPGSRLS....... 96

FFAS is supported by the NIH grant R01-GM087218-01
5 7 2 4 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Godzik A. cd-hit: a fast program for clustering and comparing large sets of protein or nucleotide sequences. Bioinformatics. 2006 May 26;