current user: public




Query: d1r5sa_ f.50.1.1 (A:) Gap junction alpha-1 protein, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}, from SCOP175

Results of FFAS03 search in SCOP175
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130
# Score Template Links and tools%idFirst GPLGSPSKDCGSPKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNAKKVAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEILast
1 -114.000d1r5sa_ f.50.1.1 (A:) Gap junction alpha-1 protein, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors  100  1GPLGSPSKDCGSPKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNAKKVAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI 132
2 -7.300d1nyca_ b.61.2.2 (A:) Staphostatin B (SspC) {Staphylococcus aureus [TaxId: 1280]}  ali model 3D-neighbors follow..  19  1..........GSMYQLQFINLVYDTTKLTHLEQTNINLFIG-----------------NWSNHQLQKSICIRHGDDTSHNQYHIL-FIDTAHQRIKFSSFDNEEIIYILDYDDTQHILMQTSSK........ 96
3 -5.500d1f7da_ b.85.4.1 (A:) Deoxyuridine 5`-triphosphate nucleotidohydrolase (dUTPase) {Feline immunodeficiency virus [TaxId: 11673]}  ali model 3D-neighbors follow..  13  8.ILDKRSEDAGYDLLAAKEIHLLPPTGVKLMLPKGYWGLIIGKSSIGSKGLDVLGG-------VIDEGYRGEIGVIMINVSRKSITLMERQKIAQLIILPCKHEVLEQGKV..................... 116
4 -5.450d2lisa_ a.19.1.1 (A:) Lysin {Red abalone (Haliotis rufescens) [TaxId: 6454]}  ali model 3D-neighbors follow..  16  50..................................................VNRRYMQTHWANYMLKIDALGRTPVV---------DYTRGAEIGRRIDMAYFYDFLKDKNMIPKYLPYMEEINRMRPADVPV 128
5 -5.420d1v5na_ g.49.1.3 (A:) Pdi-like hypothetical protein At1g60420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}  ali model 3D-neighbors follow..  12.........LKEIEAKYDEIAKDWPKKVKHVLHEEHELELTRVQVYTCDKCEEEGTIWSYHCDECDFDLHAKCALNEDTKESGP................................................ 86
6 -5.010d1zuoa1 d.20.1.1 (A:201-362) Ubiquitin-conjugating enzyme E2 Q2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  18  79.............................PFDPPFVRVVLVLGGGALCMEL---LTKQGWSSAYSIESVIMQINATLVKGKAR................................................. 136
7 -4.950d1m7xa2 b.71.1.1 (A:623-728) 1,4-alpha-glucan branching enzyme {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  16  1................................PYGFEWLVVDDKERSVLIFVRRDKEGNFTPVPRHDYRFGINQPEILNTDSMHYH-DEIASHGRQHSLSLTLPPLATIWLVREAE................ 106
8 -4.930d2bopa_ d.58.8.1 (A:) Papillomavirus-1 E2 protein {Bovine papillomavirus type 1 [TaxId: 10559]}  ali model 3D-neighbors follow..  14  5.....................................LISGTANQVKCYRFRKKNHRHRYENCTTTWFTVADNGAERQGQAQILITFGSPSQRQDFLKH................................. 67
9 -4.930d3b6oa1 c.55.3.5 (A:9-234) Three prime repair exonuclease 1, TREX1 {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  18  59.................LSLCIAPGKAC----SPGASEITG--SKAELEVQGRQRFDDNLAILLRAFLQRQPQPCCLVAHNGDRYDFPLLQTELARLSTPSPLDGTFCVDSIAALKALEQASSP........ 160
10 -4.930d1n7va_ b.126.1.1 (A:) Adsorption protein p2 {Bacteriophage prd1 [TaxId: 10658]}  ali model 3D-neighbors follow..  16  183.......SNSGIASFIFDRPVTEPNPNWPPLPPP-YPTPALGIGAAAAYGFGYQVTVYRWEEIPVE---------------ADPETCPAQPTTDKVIIRTTDLNP-GIILVRQTSNPMNAVAGRLVPYVEDI 306

FFAS is supported by the NIH grant R01-GM087218-01
4 7 1 8 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.