current user: public

Query: d1r5sa_ f.50.1.1 (A:) Gap junction alpha-1 protein, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}, from SCOP175

Results of FFAS03 search in SCOP175
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130
1 -112.000d1r5sa_ f.50.1.1 (A:) Gap junction alpha-1 protein, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors  100  1GPLGSPSKDCGSPKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNAKKVAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI 132
2 -6.510d2f2ha2 b.30.5.11 (A:1-247) Putative glucosidase YicI, N-terminal domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  13  166..................................GERFTALVRNGQTVETWNRDGGTSTEQAYKNIPFYMTNRGVLVNHPQCVSFEVGSEKVSKVQFSVSEYLEYFVIDGPTP................... 247
3 -5.990d1nnxa_ b.40.10.1 (A:) Hypothetical protein YgiW {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  9.......................................ATQSQAGGFQGPNGSVTTVESAKSLRDDTWVTLRGNIVERISDDLYVF-KDASGTINVDIDHKRWNGVTVTPKDTVEIQGEVDKDWNSVEIDV 100
4 -5.900d1f7da_ b.85.4.1 (A:) Deoxyuridine 5`-triphosphate nucleotidohydrolase (dUTPase) {Feline immunodeficiency virus [TaxId: 11673]}  ali model 3D-neighbors follow..  13  8.ILDKRSEDAGYDLLAAKEIHLLPPTGVKLMLPKGYWGLIIGKSSIGSKGLD--------LGGVIDEGYRGEIGVIMINVSRKSITLMERQKIAQLIILPCKHEVLEQGKV..................... 116
5 -5.510d1upsa1 b.29.1.2 (A:19-284) GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosidase, GngC, catalytic domain {Clostridium perfringens [TaxId: 1502]}  ali model 3D-neighbors follow..  16  3..........................PANPIEKAGYKLDFSDEFNGP------TLDREKWTDYYCKDPESAKANYRFENGSLVEYITEDQKPWCPEHDGTVRSSAIMSFDKSWIHNFSGTTDNHERNE.... 102
6 -5.250d1a8pa1 b.43.4.2 (A:2-100) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Azotobacter vinelandii [TaxId: 354]}  ali model 3D-neighbors follow..  25  11............................................................................VHHWNDTLFSFKTTRNPSLRFENGQFVMIGLEVDGRPLMRAYSIASP-NYEEHLEF 65
7 -5.190d3b6oa1 c.55.3.5 (A:9-234) Three prime repair exonuclease 1, TREX1 {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  18  59.................LSLCIAPGKAC----SPGASEITG--SKAELEVQGRQRFDDNLAILLRAFLQRQPQPCCLVAHNGDRYDFPLLQTELARLSTPSPLDGTFCVDSIAALKALEQASSPS....... 161
8 -5.110d2bopa_ d.58.8.1 (A:) Papillomavirus-1 E2 protein {Bovine papillomavirus type 1 [TaxId: 10559]}  ali model 3D-neighbors follow..  14  5.....................................LISGTANQVKCYRFRKKNHRHRYENCTTTWFTVADNGAERQGQAQILITFGSPSQRQDFLKH................................. 67
9 -4.950d1vkia_ d.116.1.1 (A:) Hypothetical protein Atu3699 {Agrobacterium tumefaciens, strain C58 [TaxId: 358]}  ali model 3D-neighbors follow..  10  58...................................FVLTVEENAVVDLKSVHKTIGAASRVSFGRPEKMLEYLG--VVPGSVTVFGAINDTARQVTFVLDSDLLENELVNGHPLSNDQT............. 139
10 -4.930d2p8ta2 d.74.4.2 (A:83-199) Hypothetical protein PH0730 {Pyrococcus horikoshii [TaxId: 53953]}  ali model 3D-neighbors follow..  20  21....................................................KNPPEFKSIELRDEAIKFDAKGAMILTVKDNEIVFPEDFRPLKE.................................... 64

FFAS is supported by the NIH grant R01-GM087218-01
7 9 7 4 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Schwarzenbacher R, Godzik A, Jaroszewski L. The JCSG MR pipeline: optimized alignments, multiple models and parallel searches. Acta Crystallogr D Biol Crystallogr. 2008 Jan;64(Pt 1):133-40. Epub 2007 Dec 5.