current user: public

Announcement: our server is upgraded to a faster system. If you experience any issues during this period please let us know.

Query: d1r5sa_ f.50.1.1 (A:) Gap junction alpha-1 protein, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}, from SCOP175

Results of FFAS03 search in SCOP175
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130
1 -114.000d1r5sa_ f.50.1.1 (A:) Gap junction alpha-1 protein, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors  100  1GPLGSPSKDCGSPKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNAKKVAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI 132
2 -7.300d1nyca_ b.61.2.2 (A:) Staphostatin B (SspC) {Staphylococcus aureus [TaxId: 1280]}  ali model 3D-neighbors follow..  19  1..........GSMYQLQFINLVYDTTKLTHLEQTNINLFIG-----------------NWSNHQLQKSICIRHGDDTSHNQYHIL-FIDTAHQRIKFSSFDNEEIIYILDYDDTQHILMQTSSK........ 96
3 -5.500d1f7da_ b.85.4.1 (A:) Deoxyuridine 5`-triphosphate nucleotidohydrolase (dUTPase) {Feline immunodeficiency virus [TaxId: 11673]}  ali model 3D-neighbors follow..  13  8.ILDKRSEDAGYDLLAAKEIHLLPPTGVKLMLPKGYWGLIIGKSSIGSKGLDVLGG-------VIDEGYRGEIGVIMINVSRKSITLMERQKIAQLIILPCKHEVLEQGKV..................... 116
4 -5.450d2lisa_ a.19.1.1 (A:) Lysin {Red abalone (Haliotis rufescens) [TaxId: 6454]}  ali model 3D-neighbors follow..  16  50..................................................VNRRYMQTHWANYMLKIDALGRTPVV---------DYTRGAEIGRRIDMAYFYDFLKDKNMIPKYLPYMEEINRMRPADVPV 128
5 -5.420d1v5na_ g.49.1.3 (A:) Pdi-like hypothetical protein At1g60420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}  ali model 3D-neighbors follow..  12.........LKEIEAKYDEIAKDWPKKVKHVLHEEHELELTRVQVYTCDKCEEEGTIWSYHCDECDFDLHAKCALNEDTKESGP................................................ 86
6 -5.010d1zuoa1 d.20.1.1 (A:201-362) Ubiquitin-conjugating enzyme E2 Q2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  18  79.............................PFDPPFVRVVLVLGGGALCMEL---LTKQGWSSAYSIESVIMQINATLVKGKAR................................................. 136
7 -4.950d1m7xa2 b.71.1.1 (A:623-728) 1,4-alpha-glucan branching enzyme {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  16  1................................PYGFEWLVVDDKERSVLIFVRRDKEGNFTPVPRHDYRFGINQPEILNTDSMHYH-DEIASHGRQHSLSLTLPPLATIWLVREAE................ 106
8 -4.930d2bopa_ d.58.8.1 (A:) Papillomavirus-1 E2 protein {Bovine papillomavirus type 1 [TaxId: 10559]}  ali model 3D-neighbors follow..  14  5.....................................LISGTANQVKCYRFRKKNHRHRYENCTTTWFTVADNGAERQGQAQILITFGSPSQRQDFLKH................................. 67
9 -4.930d3b6oa1 c.55.3.5 (A:9-234) Three prime repair exonuclease 1, TREX1 {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  18  59.................LSLCIAPGKAC----SPGASEITG--SKAELEVQGRQRFDDNLAILLRAFLQRQPQPCCLVAHNGDRYDFPLLQTELARLSTPSPLDGTFCVDSIAALKALEQASSP........ 160
10 -4.930d1n7va_ b.126.1.1 (A:) Adsorption protein p2 {Bacteriophage prd1 [TaxId: 10658]}  ali model 3D-neighbors follow..  16  183.......SNSGIASFIFDRPVTEPNPNWPPLPPP-YPTPALGIGAAAAYGFGYQVTVYRWEEIPVE---------------ADPETCPAQPTTDKVIIRTTDLNP-GIILVRQTSNPMNAVAGRLVPYVEDI 306

FFAS is supported by the NIH grant R01-GM087218-01
6 0 9 4 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Liu T, Rojas A, Ye Y, Godzik A. Homology modeling provides insights into the binding mode of the PAAD/DAPIN/pyrin domain, a fourth member of the CARD/DD/DED domain family. Protein Sci. 2003 Sep;12(9):1872-81.