current user: public




d1r0da_
Query: d1r0da_ a.216.1.1 (A:) Huntingtin interacting protein 12 {Human (Homo sapiens) [TaxId: 9606]}, from SCOP175

Results of FFAS03 search in SCOP175
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190
# Score Template Links and tools%idFirst DVRQEELGAVVDKEMAATSAAIEDAVRRIEDMMNQARHASSGVKLEVNERILNSCTDLMKAIRLLVTTSTSLQKEIVESGRGAATQQEFYAKNSRWTEGLISASKAVGWGATQLVEAADKVVLHTGKYEELIVCSHEIAASTAQLVAASKVKANKHSPHLSRLQECSRTVNERAANVVASTKSGQEQIEDRDTMLast
1 -79.300d1r0da_ a.216.1.1 (A:) Huntingtin interacting protein 12 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors  100  1DVRQEELGAVVDKEMAATSAAIEDAVRRIEDMMNQARHASSGVKLEVNERILNSCTDLMKAIRLLVTTSTSLQKEIVESGRGAATQQEFYAKNSRWTEGLISASKAVGWGATQLVEAADKVVLHTGKYEELIVCSHEIAASTAQLVAASKVKANKHSPHLSRLQECSRTVNERAANVVASTKSGQEQIEDRDTM 194
2 -29.600d1sj8a2 a.216.1.1 (A:658-782) Talin 1 {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  25  2..........................................................................................DTDPHFQDVLMQLANAVASAAAALVLKAKSVAQRTEDQTQVIAAATQCALSTSQLVACTKVVAPTISSCQEQLVEAGRLVAKAVEGCVSASQAATEDGQLLRGV 110
3 -26.700d1u89a1 a.216.1.1 (A:752-889) Talin 1 {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  12  9...........................................DGQLLRGVGAAATAVTQALNELLQHVKAHATG--------------------------GPAGRYDQATDTILTVTENIFSSMGDAGEMVRQARILAQATSDLVNAIKADAESDLENSRKLLSAAKILADATAKMVEAAKGAAAHPDSEE.. 134
4 -26.600d1qkra_ a.24.9.1 (A:) Vinculin {Chicken (Gallus gallus) [TaxId: 9031]}  ali model 3D-neighbors follow..  13  1...........KDEEFPEQKAGEAINQPMMMAARQLHDEARKWSSKGND-IIAAAKRMALLMAEMSRLVR---------------------GGSGNKRALIQCAKDIAKASDEVTRLAKEVAKQCTDRTNLLQVCERIPTISTQLKILSTVKATMLGRATEMLVHNAQNLMQSVKETVREAEAASIKIRTDAGF 174
5 -25.300d2b0ha1 a.24.9.2 (A:1838-1973) Talin 1 {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  15  15.............................................DYQTTMVRTAKAIAVTVQEMVTKSNTSPEE------------------------LGPLANQLTSDYGRLASQAKPAAVAAENGAHIKHRVQELGHGCSALVTKAGALQPSDVYTKKELIECARRVSEKVSHVLAALQAGNR........ 136
6 -20.000d1dova_ a.24.9.1 (A:) alpha-catenin {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  5..........LKEELVVAVEDVRKQGDLMKSAAGEF--ADDPCSSVKRGNMVRAARALLSAVTRLLILADMADVYKLLVQLKVVEDGILKLRNAGNEQDLGIQYKALKPEVDKLNIMAAKRQQELKDRDQMAAARGILQKNVPILYTASQLQHPDVAAYKANRDLIYKQLQQAVTGISNAAQ............ 179
7 -18.900d1t01a1 a.24.9.1 (A:1-125) Vinculin {Chicken (Gallus gallus) [TaxId: 9031]}  ali model 3D-neighbors follow..  15  11....................................................SILEPVAQQISHLVIMHEEGEV------------------DGKAIPDLTAPVSAVQAAVSNLVRVGKETVQTTEDKRDMPPAFIKVENACTKLVRAAQMLQADSVPARDYLIDGSRGILSGTSDLL................ 123
8 -16.800d1st6a7 a.24.9.1 (A:719-855) Vinculin {Chicken (Gallus gallus) [TaxId: 9031]}  ali model 3D-neighbors follow..  12  29.................................................................................................QMLVAGATSIARRANRILLVAKREVENSEDREAVKAASDELSKTISPMVMDAKAGNISDPGLQKSFLDSGYRILGAVAKVREAFQ............ 118
9 -12.400d1sj7a1 a.215.1.1 (A:488-654) A middle domain of Talin 1 {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  16  76.......GDPAETDYTAVGCAVTTISSNLTEMSRGVKLLAALLEDE-GRPLLQAAKGLAGAVSELLRSAQPASAE---------------------RQNLLQAAGNVGQASGELLQ.............................................................................. 166
10 -10.200d1k04a_ a.24.14.1 (A:) FAT domain of focal adhesion kinase {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  13  12.............................................RSNDKVYENVTGLVKAVIEMSSKIQPAP-----------------------PEEYVPMVKEVGLALRTLLATVDETIPPASTHREIEMAQKLLNSDLGELINKMKLMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQA.......... 134

FFAS is supported by the NIH grant R01-GM087218-01
6 0 3 6 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Grynberg M, Jaroszewski L, Godzik A. Domain analysis of the tubulin cofactor system: a model for tubulin folding and dimerization. BMC Bioinformatics. 2003 Oct 10;4(1):46.