current user: public




Query: d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]}, from SCOP175

Results of FFAS03 search in SCOP175
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .
# Score Template Links and tools%idFirst MQLFDLPLDQLQTYKPEKTAPKDFSEFWKLSLEELAKVQAEPDLQPVDYPADGVKVYRLTYKSFGNARITGWYAVPDKEGPHPAIVKYHGYNASYDGEIHEMVNWALHGYATFGMLVRGQQRSEDTSISPHGHALGWMTKGILDKDTYYYRGVYLDAVRALEVISSFDEVDETRIGVTGGSQGGGLTIAAAALSDIPKAAVADYPYLSNFERAIDVALEQPYLEINSFFRRNGSPETEVQAMKTLSYFDIMNLADRVKVPVLMSIGLIDKVTPPSTVFAAYNHLETKKELKVYRYFGHEYIPAFQTEKLAFFKQILKGLast
1 -121.000d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors  100  1MQLFDLPLDQLQTYKPEKTAPKDFSEFWKLSLEELAKVQAEPDLQPVDYPADGVKVYRLTYKSFGNARITGWYAVPDKEGPHPAIVKYHGYNASYDGEIHEMVNWALHGYATFGMLVRGQQRSEDTSISPHGHALGWMTKGILDKDTYYYRGVYLDAVRALEVISSFDEVDETRIGVTGGSQGGGLTIAAAALSDIPKAAVADYPYLSNFERAIDVALEQPYLEINSFFRRNGSPETEVQAMKTLSYFDIMNLADRVKVPVLMSIGLIDKVTPPSTVFAAYNHLETKKELKVYRYFGHEYIPAFQTEKLAFFKQILKG 318
2 -35.500d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]}  ali model 3D-neighbors follow..  15  6.................................................RRSIAGSRLVWVESFDGSRVPTYVLESGRATPGPTVVLVHGGPFAEDSWDTFAASLAAAGFHVVMPNYRGSTGYGEEWRLKIIGDPC--------------GGELEDVSAAARWARESGLAS--ELYIMGYSYGGYMTLCALTMKPGLFKAGVAGASVVDWEEMYELSDAAFRNFIEQLTGGSR---------EIMRSRSPINHVDRIKEPLALIHPQNDSRTPLKPLLRLMGELLATFEAHIIPDAGHEDAVKILLPAVFFLATQRE. 259
3 -31.700d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]}  ali model 3D-neighbors follow..  13  81............................DERRQKGQARKVELYQKAAPLLSPPAERHELVV---DGIPMPVYVRIPEGPGPHPAVIMLGGLESTKEESFQMENLVLDRGMATATFDGPGQGEMFEYKRIAGDYEK---------------------TSAVVDLLTKLEAIRNDAIGVLGRSLGGNYALKSAACEPRLAACISWGGFSD-----LDYWDLETPLTKESWKYVSKVDTLEEARLHVHAALETRDVLSQIACPTYILHGVHDEVPLSFVDTVLELVPAEHLNLVVEKDGDHNLGIRPRLEMADWLYDVLVA 345
4 -28.700d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]}  ali model 3D-neighbors follow..  16  4..............................................................RTERLTLAGLVLARIPEAPKALLLALHGLQGSKEHILALLPGYAERGFLLLAFDAPRHGEREGPPPSSKSPRY-----------EEVYRVALGFKEEARRVAEEAERRFGLPLFLAGGSLGAFVAHLLLAEGFRPRGVLAFIGS-------------------GFPMKLPQGQVVEDPGVLALYQAPPATRGEAYGVPLLHLHGSRDHIVPLARMEKTLEALEGRLARFVEEGAGHTLTPLMARVGLAFLEHWLEA 237
5 -27.200d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]}  ali model 3D-neighbors follow..  1....................................................QCKTIAHVLRVNNGQELHVWETPPKENFKNNTILIASGFARRMDHFAGLAEYLSTNGFHVFRYDSLHHVGLSSG-----------------SIDEFTMTTGKNSLCTVYHWLQTK---GTQNIGLIAASLSARVAYEVIS-DLELSFLITAVGVVNLRDTLEKALGFDYLSLPIDELPNDLDFEGHKLGSEVFTLDSTLDKVANTSVPLIAFTANNDDWVKQEEVYDMLAHIRTHCKLYSLLGSSHDLGENLVVLR-NFYQSVTK. 256
6 -25.600d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}  ali model 3D-neighbors follow..  15  1.....................................................MPSKKLDFIILNETKFWYQMILPPHSKKYPLLLDVYAGPCSVFRLNWATYLASTENIIVASFDGRGSGYQGDKIMHAINRRLGTF---------------VEDQIEAARQFSKMGFVDNKRIAIWGWSYGGYVTSMVLGSGSGVFKCGIAVAPVSRWEYYDSV-----------YTERYMGLPTPEDNLDHYRNSTVMSRAENFKVEYLLIHGTADDNVHFQQSAQISKALGVDFQAMWYTDEDHGIASSTAHQHIHFIKQCFS. 256
7 -24.700d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  14  10...............................................................IDDYNLPMQILKPATTTHYPLLLVVDGTPGSQFEVSWETVMVSSHGAVVVKCDGRGSGFQGTKLLHEVRRRLGLL---------------EKDQMEAVRTMLKEQYIDRTRVAVFGKDYGGYLSTYILPAKGEFTCGSALSP-ITDFKLYASAFS-------ERYLGLHGLDNRAYEMTKVAHRVSALE-----EQQFLIIHPTADEKIHFQHTAELITQLKANYSLQIYPDESHSLKQHLYRSIINFFVECFR. 257
8 -24.400d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]}  ali model 3D-neighbors follow..  21  20...............................................PYATSQTSVSSLVASGFGGGTIY----YPTADGTFGAVVISPGFTAYQSSIAWLGPRLASQGFVVFTIDTNTTLDQPDSRG--------------------------RQLLSALDYLTQRSRVDATRLGVMGHSMGGGGSLEAAKSRTSLKAAIPLTG------------------------------------------WNTDKTWPELRTPTLVVGADGDTVAPVATH-PFYESLPGDKAYLELRGASHTSDTTIAKYSISWLKRFIDS 231
9 -22.700d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]}  ali model 3D-neighbors follow..  15  1.....................................................MLTEGISIQSYDGHTFGALVGSPAK-APAPVIVIAQEIFGVNAFMRETVSWLVDQGYAAVCPDLYARQAPGTALDPQDER----REQAYKLWQAFDMEAGVGDLEAAIRYARHQPYSNG-KVGLVGYCLGGALAFLVAA-KGYVDRAVGYYGVGLE---------------------------------------KQLNKVPEVKHPALFHMGGQDHFVPAPSRQLITEGFGANPQVHWYEEAGHSAAALANERTLDFLAPLQS. 233
10 -21.300d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]}  ali model 3D-neighbors follow..  18  2.........................................................EVIFNGPAG-RLEGRYQPSKEKSAPIAII-QFGGTMNNQIVYQLFYLFQKRGFTTLRFNFRSIGRSQ-----------GEFDHG---------AGELSDAASALDWVQSL-HPDSKSCWVAGYSFGAWIGMQLLMRRPEIEGFMSIAPQPNTYD---------------------------------------FSFLAPCPSSGLIINGDADKVAPEKDVNGLVEKLKTQKTHRTLPGANHGKVDELMGECEDYLDRRLNG 212
11 -21.100d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]}  ali model 3D-neighbors follow..  15  7......................................DITGKPFVAADASNDYIKREVMIPMRDGVKLHTVIVLPKGAKNAPIVLTRTPYDASGRTERLASPVFVEGGYIRVFQDVRGKYGSEGDYV---------MTRPLRGPLNPSEVDHATDAWDTIDWLVKNVSESNGKVGMIGSSYEGFTVVMALTNPPALKVAVPESPMIDGWMG-AGDFAKAAGLEQLPWWHKLTEHAAYDAFWQEQALDKVMARTP-LKVPTMWLQGLWDQEDMWGAAMEPRDKRNTLNYLVMGPWR-HSQVNYRHDVLRPFFDQYLVD 355
12 -20.800d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]}  ali model 3D-neighbors follow..  18  7.........................................................NVMVPMRDGVRLAVDLYRPDADGPVPVLLVRNPYDKFDVFAWSNWLEFVRDGYAVVIQDTRGLFASE-----------GEFVPHVDDEA---------DAEDTLSWILEQAWCDG-NVGMFGVSYLGVTQWQAAVSGVGGLKAIAPSMASADLYRAPWYGPGGALRLIPWVIDQVVDHPDNDESWQSISLFERLG---GLATPALITAGWYDGFVGESLRTFVAVKDNADARLVVGPWS-HSNLTEATTMHKAFFDRHLRG 320
13 -19.600d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]}  ali model 3D-neighbors follow..  14  6.....................................................TESAALTLDGPVGPDVAVDLPEPDVAVQPVTAIVCHPLSTEGGSMHNKVVALRELGITVVRFNFRSVGTSAGSFDHGDGEQD--------------------DLRAVAEWVRA--QRPTDTLWLAGFSFGAYVSLRAAA-ALEPQVLISIAPPAGRWDFSD-----------------------------------------QPPAQWLVIQGDADEIVDPQAVYDWLETLEQQPTLVRMPDTSHRKLIDLRGALQHGVRRWLPA 216
14 -19.000d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  12  2........................................................................IWWQTKGQGNVHLVLLHGWGLNA-EVWRCIDEELSSHFTLHLVDLPGFGRSRG-----------------------------FGALSLADMAEAVLQQAPDKAIWLGWSLGGLVASQIALTHPRVRALVASSPCFSALAGFQQQLSDDQQRTVERFLALQTMGTETARQLEILKTVDLRQPLQNVSMPFLRLYGYLDGLVPRKVVPMLDKLWP-HSESYIFAKAAHAPFISHPAEFCHLLVALKQR 253
15 -18.700d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]}  ali model 3D-neighbors follow..  14  1....................................................................MMKHVFQKGKDTSKPVLLLLHGTGGNELDLLPLAEIVDSE---ASVLSVRGN-------VLENGMPRFFRRLAEGIFDEEDLIFRTKELNEFLDEAAKEYKFDRNNIVAIGYSNGANIAASLLFHYENLKGAVLHHPMVP---------------------------------------RRGMQLANLAGKSVFIAAGTNDPICSSAESEELKVLLENANANVTMHWEGHQLTMGEVEKAKEWYDKAF.. 202
16 -18.700d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]}  ali model 3D-neighbors follow..  13  9...................................................................LAAGVLTNYHDVGEGQPVILIHGSGPGVSANWRLTIPALSKFYRVIAPDMVGFGFTDRP------------------ENYNYSKDSWVDHIIGI-----MDALEIEKAHIVGNAFGGGLAIATADVTEGLNAVWGYTPSIENMRNLLDIFAYDRSLVTDELARLRYEASIQPGFQESFSSMSSDEDIKTLPNETLIIHGREDQVVPLSSSLRLGELID-RAQLHVFGRCGHWTQIEQTDRFNRLVVEFFN. 269
17 -18.600d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  22........................................................................TFQEISQNTREAVIYIHGGAWNDPENTPNKSMDTESTVCQYSIEYR--------------------------SPEITNPRNLYDAVSNITRLVK--EKGLTNINMVGHSVGATFIWQILAALKDPQELLQIVKRVFLLDGIYSLKELLIEYPEYDCFTRLAFPDGIQEEEPSRVMPYVKKALSRFSIDMHLVHSYSDELLTLRQTNCLISCLQDSFKLYLDDLGLHNDV--KNGKVAKYIFDNI.. 262
18 -17.900d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]}  ali model 3D-neighbors follow..  15  7...........................................................KRFPSGTLASH---ALVAGDPQSPAVVLLHGAGPGAHANWRPIIPDLAENFFVVAPDLIGFGQSEYPETYPGHIM--------------SWVGMRVEQILGL-----MNHFGIEKSHIVGNSMGGAVTLQLVVEAPRFDKVAARPPELARLLAFYADPRLTPYRELIHSFVYDPENFPGMEEIVKSRFEVAND-LGRLPHDVLVFHGRQDRIVPLDTSLYLTKHLK-HAELVVLDRCGHWAQLERWDAMGPMLMEHFRA 281
19 -17.800d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]}  ali model 3D-neighbors follow..  16  6............................................................YAKVNGIYIY-YKLCKAPEEKAKLMT-MHGGPGMSHDYLLSLRDMTKEGITVLFYDQFGCGRSEEP-----------------DQSKFTIDYGVEEAEALRSKLFGN-----EKVFLMGSSYGGALALAAVKYQDHLKGLIKYRDAIKKYGSSGSYENPEYQEAVNYFYHQHMNGPNEFTITGTIKDWDITDKISAIKIPTLITVGEYDEVTPNVA--RVIHEKIAGSELHVFRDCSHEDREGYNKLLSDFILKHL.. 290
20 -17.800d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]}  ali model 3D-neighbors follow..  14  16...................................................................GFSDFNIHYNEAGNGETVIMLHGGGPGAGGWSNNVGPFVDAGYRVILKDSPGFNKSDAV------------------VMDEQRGLVNARAVKGL-----MDALDIDRAHLVGNAMGGATALNFALEYPRIGKLILMGPGIKLLFKLYAEPSYETLKQMLQVFLYDQSLITEELLQGRWEAIDVTARLGEIKAKTFITWGRDDRFVPLDHGLKLLWNID-DARLHVFSKCGHWAQWEHADEFNRLVIDFLR. 281
21 -17.400d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]}  ali model 3D-neighbors follow..  16  25LATFGLDAVAAAPPVSASDDLPTVLAAVGASHDGFQAV-YDSIALDLPTDRDDVETSTETILGVDGNEITLHVFRPAGEGVLPGLVYTHGGGLTTDNRVHRRWDLAAAGSVVVMVDFRNAWTAEGHHP---------------------FPSGVEDCLAAVLWVDEHESLGLSGVVVQGESGGGNLAIATTGRLDAIDGVYASIPYISAWDHERRLTELPSLVENDGYFIENGGMALLVRAYDPTGEHAEDPIAWPYFAPFVVAVNELDPLRDEGIAFARLARAGVDVAARVNIGLVH.................... 326
22 -17.300d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]}  ali model 3D-neighbors follow..  14  8...................................................................NAGGVETRYLEAGKGQPVILIHGGGAGAESNWRNVIPILARHYRVIAMDMLGFGKT-------------------AKPDIEYTQDRRIRHLH--DFIKAMN---DGKVSIVGNSMGGATGLGVSVLHSELRPIINYDFTREGMVHLVKALTNDGFKIDDAMINSRYTYATDEATRKAYGLFYDPEFIRKVQVPTLVVQGKDDKVVPVETAYKFLDLID-DSWGYIIPHCGHEHPEDFANATLSFLSLR... 268
23 -17.200d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]}  ali model 3D-neighbors follow..  15  1...........................................................................PPKEAGERAVLLLHGFTGNSADVRMLGRFLESKGYTCHAPIYKGHGVPPEELVHTG------------------PDDWWQDVMNGYEFLKNKG----EKIAVAGLSLGGVFSLKLGYTVPIEGIVTMCAPVLEYAREYKKREGKSEEQIEQEMEKFKQTPMKTLKALQEL---DVRDHLDLIYAPTFVVQARHDEMINPDSANIIYNEIESPKQIKWYEQSGHQEKDQLHEDIYAFLES.... 239
24 -17.100d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]}  ali model 3D-neighbors follow..  10  13.......................................................................YRLLGAGKESRECLFLLHGSGVDETTLVPLARRIAPT---ATLVAARGR-------IPQEDGFRWFERIDPTRFEQKSILAETAAFAAFTNEAAKRHGLNLDHATFLGYSNGANLVSSLMLLHPGIVRLAA--------------------------------------LLRPMPVLDHVPATDLAGIRTLIIAGAADETYGPPALVTLLSRHGAEVDARIIP-SGHDIGDPDAAIVRQWLAG.... 208
25 -16.400d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]}  ali model 3D-neighbors follow..  11  1.................................................AIRRPEDFKHYEVQLPDVKIH------VREGAGPTLLLLHGWPGFWWE-WSKVIGPLAEHYDVIVPDLRGFGDSEKPDLNDLSK--------------------YSLDKAADDQAALLDALGIEKAYVVGHDFAAIVLHKFIRKYSKAAIFDPIQPDFGPFDHWSYRDELLTEEELEVHVDNCMKPDNIHGGFNYYRANIRPDAATMSDLPVTMIWGLGDTCVPYAPLIEFVPKYYSNYTMETIEDCGHFLMVEKPEIAIDRIKTAFR. 293
26 -16.300d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]}  ali model 3D-neighbors follow..  14  1.......LDNHYHFFNDKSLAT-FDS--SLLEREVLWVESPVD------------------SEQRGENIKIQIIRPKSTEKLPVVMTASPYHLGINDKANDLAYFLTRGFASIYVAGVGTRSS-------------------DGFQTSGDYQQIYSMTAVIDWLNGRARAYTSKVAMTGKSYLGTMAYGAATTGVEGLELILAEAGISSWYNYYRENDGADFLKGNAEYEKRLAEMTAALDRKSGDY-NYLINTDKVKADVLIVHGLQDWNVTPEQAYNFWKALPEGHAKHAFHRGAHIYMNSWQETINAYFVAKLLD 378
27 -16.200d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}  ali model 3D-neighbors follow..  13  3...................................................SDYQTVQIFYPSKDGTKIPMFIVHKKGDGSHPAFLYGYGGSITPNYSVSRLIFVRHMGGVLAVANIRGGGEYGETWHKGGILAN---------------QNCFDDFQCAAEYLIKEGYTSPKRLTINGGSNGGLLVATCANQRPDLFGCVIAQVGVMDMLKFHKYTIGHAW-------TTDYGCSDSKQHFEWLIKYSPLHNVKLPEADMLLLTADHDDRVVPLHSLKFIATLNNPLLIHVDTKAGHGAGKPTAKV........... 259
28 -16.200d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]}  ali model 3D-neighbors follow..  17  18.............................................................................GDPADPALLLVMGGNLSALGWPDEFARLADGGLHVIRYDHRDTGRSTTRDFAAHP---------------------YGFGELAADAVAVLDGWGVDRAHVVGLSMGATITQVIALDHHDVAKRVSKWRILSGTGVPFDDAEYARWEERAIDHAGGVLAEPYAHYSLTLPPPSRAAELREVTVPTLVIQAEHDPIAPAPHGKHLAGLIPT-ARLAEIPGMGHALPSSVHGPLAEVILAHTR. 294
29 -15.900d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]}  ali model 3D-neighbors follow..  16  3FPTLDPELAAALTMLPKVDF--------ADLPNARATYDALIGAMLADLSFDGVSLRELSAPGLDGDEVKIRFVTPDNAGPVPVLLWIHGGGTAESSDPFCVEVARELGFAVANVEYR--------------------------APETTFPGPVNDCYAALLYIHAHAEIDPSRIAVGGQSAGGGLAAGTVLKAVPVAFQFLEIPELDDFVDTPLWHRPNAILSWKYYLGESYSGPEDPDVSIYAAPSRATDLTG----PTYLSTMELDPLRDEGIEYALLLQAGVSVELHSFPGTFHAVSERGAAEALTAIRRGLRS 317
30 -15.800d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]}  ali model 3D-neighbors follow..  15  12............................................................................AGVAGAPLFVLLHGTGGDENQFFDFGARLLPQ---ATILSPVG-----DVSEHGAARFFRRTGEGVYDMVD-----LERATGKMADFIKANEHYQAGPVIGLGFSNGANILANVLIEQPEFDAAVLMHPLIP---------------------------------------FEPKISPAKPTRRVLITAGERDPICPVQLTKALEESLKAQGGTVETVWHGHEIRSGEIDAVRGFLAAY... 202
31 -15.800d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  16  1.............................................PLPTSCNPSDMSHGYVTVKPRVRLH------VELGSGPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAP----------------PEIEEYCMEVLCKEMVTFLDKL------GLSQAVFIGHDWGGMLVWYMALFYPRVRAVASNTPFINPNMSPLESIKANPVFDYQLYFQEPGVAEAEVQQFKKSGFRGPLNWYRKILIPALMVTAEKDFVLVPQMS-QHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLDS 318
32 -15.600d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]}  ali model 3D-neighbors follow..  14  4.........................................................TVGQENSTSIDLY------EDHGTGQPVVLIHGFPLSGHSWERQSAALLDAGYRVITYDRRGFGQSSQPTTG-------------YDYDTF-----------AADLNTVLETLDLQDAVLVGFSTGTGVSSYGTARIAKVAFLASLEPFLNDFYNLDENLGTRISEEAVRNSWNTAASGGFFAAAAAPTTWDFRADIPRIDVPALILHGTGDRTLPIENTARVFHKALPSAEYVEVEGAPHGLLWTHAEEVNTALLAFLA. 276
33 -14.900d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  12..............................................................QVQGQALFFREALPGSGQARFSVLLLHGIRFSSETWQNTLHRLAQAGYRAVAIDLPG--------------------LGHSKEAAAPAPIGELAPGSFLAAV--VDALELGPPVVISPSLSGMYSLPFLTAPGQLPGFVPVAPICTD----------------------------------------NAANYASVKTPALIVYGDQDPMGQTSFEHLK-----PNHRVLIMKGAGHPCYLDKPEEWHTGLLDFLQG 207
34 -14.800d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]}  ali model 3D-neighbors follow..  16  2...........................................................ICTTRDGVEIF------KDWGQGRPVVFIHGWPLNGDAWQDQLKAVVDAGYRGIAHDRRGHGHSTPVWDG-------------YDFDTF-----------ADDLNDLLTDLDLRDVTLVAHSMGGGVGRHGTGRLRSAVLLSAIPPVMIKSDKNPDGVPDEVFDALKNGVLTERSQEGGVRCVDAFGYTDFTEDLKKFDIPTLVVHGDDDQVVPIDATGRKSAQIIPNAELKVYEGSSHGDKEKFNRDLLEFLNK.... 274
35 -14.300d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  12........................................................................AIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYIC-----HAPVRPVTLNMNVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEGIPSNRIILGGFSQGGALSLYTA----TTQQKLAGVTALSCWLPLRA------------------------------SFPQGPIGGANRDISILQCHGDCDPLVPLMFGSLTVEKLKTNVTFKTYEGMMHSSCQQEMMDVKQFIDKLL.. 226
36 -14.000d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]}  ali model 3D-neighbors follow..  16  1....................................................................MTEPLILQPAKPADACVIWLHGLGADRYDFMPVAEALQESLLTTRFVLPQA--PTRPVTINGGYEMPSWYDIKAMSPARSISLEELEVSAKMVTDLIEAQGIDASRIFLAGFSQGGAVVFHTAFINGPLGGVIALSTYAPTFGDELELSASQQ------------------------------------RIPALCLHGQYDDVVQNAMGRSAFEHLKSTVTWQEYP-MGHEVLPQEIHDIGAWLAARL.. 217
37 -13.800d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]}  ali model 3D-neighbors follow..  13  9............................DQRFSNLDQYPFSPN-------------YLDDLPGYPGLRAH--YLDEGNSDAEDVFLCLHGEPTWSYLYRKMIPVFAESGARVIAPDFFG---------------------GKSDKPVDEEDYTFEFHRNFLLAL--IERLDLRNITLVVQDWGGFLGLLPMADPSRFKRLIIMAPTLTEAEASAYAAPFPDTSYQAGVRKFPKMVAQRDQACIDISTEAISFWQNDWNGQTFMAIGMKDKLLGPDVMYPMKALINGCPEPLEIADAGHFVQEFGEQVAREALKHFAE. 308
38 -13.400d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]}  ali model 3D-neighbors follow..  12  7........................................................................LHFAKPTARTPLVVLVHGLLGSGADWQPVLSHLARTQCAALTLDLPGHGTNPERHCDN-----------------------FAEAVEMIEQTVQAHVTSEVPVILVGYSLGGRLIMHGLAQGAFSRLNLRGAIIEGDQQWAQRFSQQPIEHVLSDWYQQAVFSSLNHEQRQTLIAQRSANLGSSVKLPIHYVCGEQDSKFQQLAESS-------GLSYSQVAQAGHNVHHEQPQAFAKIVQAMIHS 261
39 -13.000d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]}  ali model 3D-neighbors follow..  19  1...LDPVIQQVLDQLNRMPAPD----YKHLSAQQFRSQ---QSLFPPVKKEPVAEVREFDMDLPGR-TLKVRMYRPEGEPPYPALVYYHGG-----------------GWVV------GDLETHDPVCRVLAKDGRAVVFSVD-APEHKFPAAVEDAYDALQWIAERAALDPARIAVGGDSAGGNLAAVTSILAPALAFQLLIYP-STGYDPAHPPASIEENAEMSLWFLDQYLNSLEELTHPWFSPVLYPDLSG---PPAYIATAQYDPLRDVGKLYAALNKAGVKVEIENFEDLIHG................... 281
40 -11.700d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]}  ali model 3D-neighbors follow..  15  7...................................................................HLYGLNLVFDRVGKGPPVLLVAEEA-------SRWPEALPEGYAFYLLDLPG--------------------YGRTEGPRMAPEELAHFVAGFAVMM------NLGAPWVLLRGLGLALGPHLEALGLRALPAEG.................................................................................................................... 108
41 -11.600d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]}  ali model 3D-neighbors follow..  12  1.....MELDDAYANGAYIEGAADYPPRWAASAEDFRNSLQDRARLNLSYGEGDRHKFDL---------------FLPEGTPVGLFVFVHGGAFDKSSWSHLAVGALSKGWAVAMPSYE---------------------------PEVRISEITQQISQAVTAAAKE----DGPIVLAGHSAGGHLVARMLDPEVLPEAVGARIRNVVPISPLSDLRP----------LLRTSMNEKFKMDADAAIAESPVEMQNRYDAKVTVWVGGAERPAFLDQAIWLVEAWDA--DHVIAFEKHHFNVIEPLADPESDLVAVITA 261
42 -10.700d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]}  ali model 3D-neighbors follow..  13  15................................................NGVPRGQVVNISYFSATNSTRPARVYLPPGDKKYSVLYLLHGIGGSEND-------WFEGGGRANVIADNLIAEGKIKPLIIVTPNTNAAGPGIADGYENFTKDLLNSLIPYIESNYSVYT-DREHRAIAGLSMGGGQSFNIGLTNLDKFAYIGPISAAPNTYPNERL------------------------------FPDGGKAAREKLKLLFIACGTNDSLIGFGQRVEYCVANNINHVYWLIQGGGHD................... 232
43 -10.100d1pv1a_ c.69.1.34 (A:) Hypothetical esterase YJL068C {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  12  25.................................................................KTSMNVNIYLPPRNKRIPTVFYLSGLTCTPDNASEKQFQADKYGFAIVFPDTRGDEANDPEGSWDFGQGAGFYLNATQEPYAQHYQMYDYIHKELPQTLDSHFNKNGDNVAITGHSMGGAICGYLKGYSGRYKSCSAFAPIVNPSNVPWGQKA------FKGYLGEEKAQWEAYDPCLLIK-----NIRHVGDDRILIHVGDSDPFLEPELLLEAVKATSWQDYVEIKKVHGFDHSSTFVPEHAEFHARNL.. 296
44 -9.670d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]}  ali model 3D-neighbors follow..  11  9.................................................QAPEIPAKEIIWKSERKNSRRVWIFTTGDAEERPLAVLLDG------------EFWAQSMPVWPVLTSLTHRQQLPPAVYVLIDAIDTTHRAHEPCNADFWLAVQQELLPLVKVIAPFSD-RADRTVVAGQSFGGLSALYAGLHWPEFGCVLSQSGSY---------------------------PHRGGQQEGVLLEKLKAGEVSAEGLRIVLEAGIREPMIMRANQALYAQLHPIKESIFWRQVDGGHDALCWRGGLMQGLIDLWQ. 243
45 -9.580d2gzsa1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  12  1.........................................PNIADKGSVFYHFSATSFD-SVDGTRHYRVWTAVPNTASGYPILYMLDGNAVLKQLSEKTPPVIVAVGYLPFDLNSRAYDYTPAAESRKTDLHSGRFSRKSGGSNN------FRQLLRIAPKVEQGLNIDRQRRGLWGHSYGGLFVLDSWLSSSYFRSYYSASPSL--------------------------------GYDALLSRVTAVEPLQFCTKHLAIMEGSATQGDNRETTLTILKDKGVNAVFWDFPNLGH.................... 247
46 -9.560d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]}  ali model 3D-neighbors follow..  10  5....................................................................................FVLIHTICHGAWIWHKLKPLLEALGHKVTALDLAASGVDPRQ------------------IEEIGSFDEYSEPL--LTFLEALP--PGEKVILVGESCGGNIAIAADKYCEKIAAAVFHNSVLPDTEHCPSYVVDKLMEVFPDWKDTTYFTYTKDGKEITGLKLGFTLLRENLSIKKIYVWTDQDEIFLPEFQLWQIEN-YKPDKVYKVEGGDHKLQLTKTKEIAEILQEVAD. 253
47 -9.370d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]}  ali model 3D-neighbors follow..  11  55............................................................................DRAEGRAVLVGCTGTAANG----------GPHEFLRLSTSFQEE------------DFLAVPLPGYGTGTGTGTALLPADLDTALDAQARLRAAGDAPVVLLGHSGGALLAHELAFRLERAHGAPPAGIVLVDYPPGHQEPIEVWSRQLGEGLFAGELEPMSDARLLAMRYARFLA-PGRSSAPVLLVRASEPLGDWQEERGDWRAHWDLPHTVADVPGDHFTMMRDHAPAVAEAVLSWLDA 281
48 -9.360d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]}  ali model 3D-neighbors follow..  13  25.......................................................................YWELSGNPNGKPAVFIHGGPGGGIS--PHHRQLFDPERYKVLLFDQRGCGRSRPHASLDNNTT---------------------HLVADIERLREMAGVE--QWLVFGGSWGSTLALAYATHPERVSEMVLRGIFTLRKQRLHWYYQDGASRFFPEKWERVLSILSDDERKDVIAAYQLLRNVPLIRIPAVIVHGRYDMACQVQNAWDLAKAWP-EAELHIVEGAGHSYDEPGILHQLMIATDRFAG 313
49 -9.260d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]}  ali model 3D-neighbors follow..  5.............................ESAVQYRPAPDSYLNPCPQAG----RIVKETYTGINGTK-SLNVYLPYGNKKYNIFYLMHGGGEN------ENTIFSNDVKLQNILDHAIMNGELEPLIVVTPTFNG------NCTAQNFYQEFRQNVIPFVESKYST-AASRMHRGFGGFAMGGLTTWYVMVNCLDY------------------------VAYFMPLSGDYWYGNSPQDKANSIAEAINRSGLSKREYFVFAATGSEDIAYANMNPQITSDFSKGNFYFLVAPGATHW................... 257
50 -9.230d1qe3a_ c.69.1.1 (A:) Thermophilic para-nitrobenzyl esterase (PNB esterase) {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  17  26IPYAKPPVGQWRFKAPEPPEV------WEDVLDATAYGPICPQ------PSDLLSLSYTELPRQSEDCLYVNVFAPDTPSNLPVMVWIHGGAGAGSEPLYDGSKLAAQGVIVVTLNYR--------------GPFGFLHLSSFD-EAYSDNLGLLDQAAALKWVRE----DPDNVTVFGESAGGM---SIAALLAMPAAKGLFQKAIMESGASRTMTKEQAASTAAAFLQVLGINESQLDRLHTVAAEDLLKAADQLRIAEKENIFALDPKTLPEEPEKSIAEGAASGIPLLIGTTRDEG.................. 310

FFAS is supported by the NIH grant R01-GM087218-01
6 4 6 0 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Rychlewski L, Godzik A. Secondary structure prediction using segment similarity. Protein Eng. 1997 Oct;10(10):1143-53.