current user: public




d1l7aa_
Query: d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]}, from SCOP175

Results of FFAS03 search in SCOP175
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .
# Score Template Links and tools%idFirst MQLFDLPLDQLQTYKPEKTAPKDFSEFWKLSLEELAKVQAEPDLQPVDYPADGVKVYRLTYKSFGNARITGWYAVPDKEGPHPAIVKYHGYNASYDGEIHEMVNWALHGYATFGMLVRGQQRSEDTSISPHGHALGWMTKGILDKDTYYYRGVYLDAVRALEVISSFDEVDETRIGVTGGSQGGGLTIAAAALSDIPKAAVADYPYLSNFERAIDVALEQPYLEINSFFRRNGSPETEVQAMKTLSYFDIMNLADRVKVPVLMSIGLIDKVTPPSTVFAAYNHLETKKELKVYRYFGHEYIPAFQTEKLAFFKQILKGLast
1 -127.000d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors  100  1MQLFDLPLDQLQTYKPEKTAPKDFSEFWKLSLEELAKVQAEPDLQPVDYPADGVKVYRLTYKSFGNARITGWYAVPDKEGPHPAIVKYHGYNASYDGEIHEMVNWALHGYATFGMLVRGQQRSEDTSISPHGHALGWMTKGILDKDTYYYRGVYLDAVRALEVISSFDEVDETRIGVTGGSQGGGLTIAAAALSDIPKAAVADYPYLSNFERAIDVALEQPYLEINSFFRRNGSPETEVQAMKTLSYFDIMNLADRVKVPVLMSIGLIDKVTPPSTVFAAYNHLETKKELKVYRYFGHEYIPAFQTEKLAFFKQILKG 318
2 -30.100d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]}  ali model 3D-neighbors follow..  13  81............................DERRQKGQARKVELYQKAAPLLSPPAERHELVV---DGIPMPVYVRIPEGPGPHPAVIMLGGLESTKEESFQMENLVLDRGMATATFDGPGQGEMFEYKRIAGDYEK---------------------TSAVVDLLTKLEAIRNDAIGVLGRSLGGNYALKSAACEPRLAACISWGGFSD-----LDYWDLETPLTKESWKYVSKVDTLEEARLHVHAALETRDVLSQIACPTYILHGVHDEVPLSFVDTVLELVPAEHLNLVVEKDGDHNLGIRPRLEMADWLYDVLVA 345
3 -27.700d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]}  ali model 3D-neighbors follow..  16  10.....................................................AGSRLVWVESFDGSRVPTYVLESGRATPGPTVVLVHGGPFAEDSDSWDTFALAAAGFHVVMPNYRGS--------------TGYGEEWRLKIIGDPCGGELEDVSAAARWARESGLAS--ELYIMGYSYGGYMTLCALTMKPGLFKAGVAGASVVDWEEMYELSDAAFRNFIEQLTGGSR---------EIMRSRSPINHVDRIKEPLALIHPQNDSRTPLKPLLRLMGELLATFEAHIIPDAGHEDAVKILLPAVFFLATQRE. 259
4 -25.500d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]}  ali model 3D-neighbors follow..  16  3..........................................................VRTERLTLAGLSVLARIP--EAPKALLLALHGLQGSKEHILALLPGYAERGFLLLAFDAPRHGEREGPPP--------------SSKSPRYVEEVYRVALGFKEVAEEAERRFGLPLFLAGGSLGAFVAHLLLAEGFRPRGVLA-------------FIGSGFPMKLPQG-------VEDPGVLALYQAPPATRGEAYGGVPLLHLHGSRDHIVPLARMEKTLEALRGRLARFVEEGAGHTLTPLMARVGLAFLEHWLEA 237
5 -24.100d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]}  ali model 3D-neighbors follow..  1....................................................QCKTIAHVLRVNNGQELHVWETPPKENFKNNTILIASGFARRMDHFAGLAEYLSTNGFHVFRYDSLHHVGLSSG-----------------SIDEFTMTTGKNSLCTVYHWLQTK---GTQNIGLIAASLSARVAYEVIS-DLELSFLITAVGVVNLRDTLEKALGFDYLSLPIDELPNDLDFEGHKLGSEVFTLDSTLDKVANTSVPLIAFTANNDDWVKQEEVYDMLAHIRTHCKLYSLLGSSHDLGENLVVLR-NFYQSVTK. 256
6 -23.000d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]}  ali model 3D-neighbors follow..  21  20...............................................PYATSQTSVSSLVASGFGGGTIY--YPTSTADGTFGAVVISPGFTAYQSSIAWLGPRLASQGFVVFTIDTNTTLDQPDSRG--------------------------RQLLSALDYLTQRSRVDATRLGVMGHSMGGGGSLEAAKSRTSLKAAIPLTG------------------------------------------WNTDKTWPELRTPTLVVGADGDTVAPVATH-PFYESLPGDKAYLELRGASHFTPTTIAKYSISWLKRFIDS 231
7 -19.500d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]}  ali model 3D-neighbors follow..  14  1.....................................................MLTEGISIQSYDGHTFGALVGSPAK-APAPVIVIAQEIFGVNAFMRETVSWLVDQGYAAVCPDL-----RQAPGTALDPQDERQREQAYKLWQAFDMEAGVGDLEAAIRYARHQPYSNG-KVGLVGYCLGGALAFLVAA---------------------------------------------KGYVDRAVGYYKQLNKVPEVKHPALFHMGGQDHFVPAPSRQLITEGFGANPQVHWYEEAGHSAAALANERTLDFLAPLQS. 233
8 -19.000d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  12  12..................................................................................VHLVLLHGWGLNAE-VWRCIDEELSSHFTLHLVDLPGFGRSRG-----------------------------FGALSLADMAEAVLQQAPDKAIWLGWSLGGLVASQIALTHPE-LVTVASSPCFSALAGFQQQLSDDQQRTVERFLALQTMGTETARQLEILKTVDLRQPLQNVSMPFLRLYGYLDGLVPRKVVPMLDKLWPH-SESYIFAKAAHAPFISHPAEFCHLLVALKQ. 252
9 -18.900d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]}  ali model 3D-neighbors follow..  18  2.........................................................EVIFNGPAG-RLEGRYQPSKEKSAPIAIILHPGGTMNNQIVYQLFYLFQKRGFTTLRFNFRSIGRSQ-----------GEFDHGAGELS---------DAASALDWVQSL-HPDSKSCWVAGYSFGAWIGMQLLMRRPEIEGFMSIAPQPNTYD---------------------------------------FSFLAPCPSSGLIINGDADKVAPEKDVNGLVEKLKTQKTHRTLPGANHGKVDELMGECEDYLDRRLNG 212
10 -18.800d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]}  ali model 3D-neighbors follow..  18  7.........................................................NVMVPMRDGVRLAVDLYRPDADGPVPVLLVRNPYDFAWSTQSTNWLEFVRDGYAVVIQDTRGLFAS-----------EGEFVPHVDDEA---------DAEDTLSWILEQAWCDG-NVGMFGVSYLGVTQWQAAVSGVGGLKAIAPSMASADLYRAPWYGPGGALRLIPWVIDQVVDHPDNDESWQSISLFERLG---GLATPALITAGWYDGFVGESLRTFVAVKDNADARLVVGPWS-HSNLTEATTMHKAFFDRHLRG 320
11 -18.500d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]}  ali model 3D-neighbors follow..  12  7......................................DITGKPFVAADASNDYIKREVMIPMRDGVKLHTVIVLPKGAKNAPIVLTRTPYDASGRTERLASPHFVEGGYIRVFQDVRGKYGSEGDYVMTRPLRGPLNPSEVDHAT---------DAWDTIDWLVKNVSESNGKVGMIGSSYEGFTVVMALTNPHPALKVAVPESPMIDGWMGDDWFNYGAFREQLPWWHKLTEHAAYDAFWQEQALDKVMARTP-LKVPTMWLQGLWDQEDMWGAAMEPRDKRNTLNYLVMGPWR-HSQVNYRHDVLRPFFDQYLVD 355
12 -18.200d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]}  ali model 3D-neighbors follow..  13  9...................................................................LAAGVLTNYHDVGEGQPVILIHGSGPGVSANWRLTIPALSKFYRVIAPDMVGFGFTDRPENYN------------------YSKDSWVDHIIGI-----MDALEIEKAHIVGNAFGGGLAIATALRYSELNAVWGYTPSIENMRNLLDIFAYDRSLVTDELARLRYEASIQPGFQESFSSMSSDEDIKTLPNETLIIHGREDQVVPLSSSLRLGELID-RAQLHVFGRCGHWTQIEQTDRFNRLVVEFFN. 269
13 -17.800d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]}  ali model 3D-neighbors follow..  12  1....................................................................MMKHVFQKGKDTSKPVLLLLHGTGGNELDLLPLAEIVDSE---ASVLSVRG-------NVLENGMPRFFRRLAEGIFDEEDLIFRTKELNEFLDEAAKEYKFDRNNIVAIGYSNGANIAASLLFHYENALKGAV--------------------------------------LHHPMVPRRGMQLANLAGKSVFIAAGTNDPICSSAESEELKVLLENANANVTMHWEGHQLTMGEVEKAKEWYDKAF.. 202
14 -17.700d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}  ali model 3D-neighbors follow..  15  5.........................................................KLDFIILNETKFWYQMILPPHSKKYPLLLDVYAGPCSQKADTVFRLNWSTENIIVASFDGRGSG-------YQGDKIMHAINRRLGTFEV-------EDQIEAARQFSKMGFVDNKRIAIWGWSYGGYVTSMVLGSGSGVFKCGIAVAPVSRWEYYDSV-----------YTERYMGLPTPEDNLDHYRNSTVMSRAENFKVEYLLIHGTADDNVHFQQSAQISKALVDVGQAMWYTDEDHGIASSTAHQHIHFIKQCFS. 256
15 -17.100d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]}  ali model 3D-neighbors follow..  14  7...........................................................KRFPSGTLASH---ALVAGDPQSPAVVLLHGAGPGAHANWRPIIPDLAENFFVVAPDLIGFGQSEYPETYPGHIM--------------SWVGMRVEQILGL-----MNHFGIEKSHIVGNSMGGAVTLQLVVEAPRFDKVALM-PELARLLAFYADPRLTPYRELIHSFVYDPENFPGMEEIVKSRF-IPPATLGRLPHDVLVFHGRQDRIVPLDTSLYLTKHLK-HAELVVLDRCGHWAQLERWDAMGPMLMEHFRA 281
16 -16.800d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]}  ali model 3D-neighbors follow..  15  6.....................................................TESAALTLDGPVGPDVAVDLPEPDVAVQPVTAIVCHPEGGSMHNKVVTMAALRELGITVVRFNFRSVGTSA-----------GSFDHGDGEQD---------DLRAVAEWVRA--QRPTDTLWLAGFSFGAYVSLRAAAALEPQVLISIAPP---------------------------------------AGRWDFSDVQ--PPAQWLVIQGDADEIVDPQAVYDWLETLEQQPTLVRMPDTSHRKLIDLRGALQHGVRRWLPA 216
17 -16.700d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]}  ali model 3D-neighbors follow..  13  8...........................................................KFVKINEKGFSDFNIHYNEAGNGETVIMLHGGGPGAGG--RNVGPFVDAGYRVILKDSPGFNKSDAVVMDE------------------QRGLVNARAVKGL-----MDALDIDRAHLVGNAMGGATALNFALEYPRIGKLILMGPGIKLLFKLYAEPSYETLKQMLQVFLYDQSLITEELLQGRWEAIDVTARLGEIKAKTFITWGRDDRFVPLDHGLKLLWNID-DARLHVFSKCGHWAQWEHADEFNRLVIDFLR. 281
18 -16.700d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]}  ali model 3D-neighbors follow..  12  8...................................................................NAGGVETRYLEAGKGQPVILIHGGGAGAESNWRNVIPILARHYRVIAMDMLGFGKT-------------------AKPDIEYTQDRRIRHLH--DFIKAMN---DGKVSIVGNSMGGATGLGVSVLHSELRPIINYDFTREGMVHLVKALTNDGFKIDDAMINSRYTYATDEATRKAYVAT-DPEFIRKVQVPTLVVQGKDDKVVPVETAYKFLDLID-DSWGYIIPHCGHWAMIEHPEDFANATLSFLS. 266
19 -16.500d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]}  ali model 3D-neighbors follow..  10  13.......................................................................YRLLGAGKESRECLFLLHGSGVDETTLVPLARRIAPT---ATLVAARG-------RIPQEDGFRWFERIDPTRFEQKSILAETAAFAAFTNEAAKRHGLNLDHATFLGYSNGANLVSSLMLLHPGIVRLAA--------------------------------------LLRPMPVLDHVPATDLAGIRTLIIAGAADETYGPFVPALVLSRHGAEVDARIIP-SGHDIGDPDAAIVRQWLAG.... 208
20 -16.500d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]}  ali model 3D-neighbors follow..  15  1...........................................................................PPKEAGERAVLLLHGFTGNSADVRMLGRFLESKGYTCHAPIYKGHGVPP------------------EELVHTGPDDWWQDVMNGYEFLKNKG----EKIAVAGLSLGGVFSLKLGYTVPIEGIVTMCAPVLEYAREYKKREGKSEEQIEQEMEKFKQTPMKTLKALQELI--DVRDHLDLIYAPTFVVQARHDEMINPDSANIIYNEIESPKQIKWYEQSGHQEKDQLHEDIYAFLESL... 240
21 -16.300d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  14  10...............................................................IDDYNLPMQILKPATTTHYPLLLVVDGTPGSQSVAEKFEVSWSSHGAVVVKCDGRGSG-------FQGTKLLHEVRRRLGLLEE-------KDQMEAVRTMLKEQYIDRTRVAVFGKDYGGYLSTYILPAKGEFTCGSALSP-ITDFKLYASAFSE-------RYLGLHGLDNRAYEMTKVAHRVSALE-----EQQFLIIHPTADEKIHFQHTAELITQLIRGKSLQIYPDESHSLKQHLYRSIINFFVECFR. 257
22 -15.600d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]}  ali model 3D-neighbors follow..  12  1.................................................AIRRPEDFKHYEVQLPDVKIH------VREGAGPTLLLLHGWP-GFWWEWSKVIGPLAEHYDVIVPDLRGFGDSEKPDL--------------NDLSKYSLDKAADDQAALLDAL------GIEKAYVVGHDFAAIVLHKFIRKYSKAAIFDPIQPDFGPVYFGLGHVHESWYEELEVHVDNCMKP---DNIHGGFNYYWTDLDHTMSDLPVTMIWGLGDTCVPYAPLIEFVPKYYSNYTMETIEDCGHFLMVEKPEIAIDRIKTAFR. 293
23 -15.500d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]}  ali model 3D-neighbors follow..  18  18.............................................................................GDPADPALLLVMGGNLSALGWPDEFARLADGGLHVIRYDHRDTGRSTTRDFAAHP---------------YGFGELAADAVAVLDGW------GVDRAHVVGLSMGATITQVIALDHHDVAKRVSKWRILSGTGVPFDDAEYARWEERAIDHAGGVLAEPYAHYSLTLPPPSRAAELREVTVPTLVIQAEHDPIAPAPHGKHLAGLIPTAR-LAEIPGMGHALPSSVHGPLAEVILAHTR. 294
24 -15.400d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  10  22........................................................................TFQEISQNTREAVIYIHGGAWNDPENTPNDFMDTESTVCQYSIEYR--------------------------SPEITNPRNLYDAVSNITRLVK--EKGLTNINMVGHSVGATFIWQILGLLQIVKRVFLLD--IYSLKELLIEYPEYDCFTRLAFPDGIQMYEEEPSRVMP----YVKKALSRFSIDMHLVHSYSDELLTLRQTNCLISCLQDSFKLYLDDLGLHNDV--KNGKVAKYIFDNI.. 262
25 -15.400d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]}  ali model 3D-neighbors follow..  15  25LATFGLDAVAAAPPVSASDDLPTVLAAVGASHDGFQAV-YDSIALDLPTDRDDVETSTETILGVDGNEITLHVFRPAGEGVLPGLVYTHGGGLTTDNRVHRRWDLAAAGSVVVMVDFRNAWTAEG---------------------HHPFPSGVEDCLAAVLWVDEHESLGLSGVVVQGESGGGNLAIATTLLADAIDGVYASIPYITELPSLVENDGYFIENGGMALLVRAYDPTGEHAEDPIAWPYFASEDELRGLPPFVVAVNELDPLRDEGIAFARLARAGVDVAARVNIGLVH.................... 326
26 -15.000d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]}  ali model 3D-neighbors follow..  17  42...............................................DLSFDGVSLRELSAPGLDGDPVKIRFVTPDNAGPVPVLLWIHGIGTAESSDPFCVEVARELGFAVANVEYR--------------------------APETTFPGPVNDCYAALLYIHAHAEIDPSRIAVGGQSAGGGLAAGTVLKVVPVAFQFLEIPELDDFVDTPLWHRPNAILSWKYYLGESYSGPEDPDVSIYAAPSRATDLTG----PTYLSTMELDPLRDEGIEYALLLQAGVSVELHSFPGTFHAVSERGAAEALTAIRRGLRS 317
27 -15.000d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]}  ali model 3D-neighbors follow..  15  12............................................................................AGVAGAPLFVLLHGTGGDENQFFDFGARLLPQ---ATILSPVG-------DVSEHGAARFFRRTGEGVYDMVDLERATGKMADFIKANRE--HYQAGPVIGLGFSNGANILANVLIEQPELFDAAV--------------------------------------LMHPLIPFEPKISPAKPTRRVLITAGERDPICPVQLTKALEESLKAQGGTVETVWHGHEIRSGEIDAVRGFLAAY... 202
28 -14.900d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]}  ali model 3D-neighbors follow..  14  2........................................................CIENYAKVNGIYIY-YKLCKAPEEKAKLMT-MHGGPGMSHDYLLSLRDMTKEGITVLFYDQFGCGRSEEP-----------------DQSKFTIDYGVEEAEALRSKLFGN-----EKVFLMGSSYGGALALAYAVKYQDMNRLIDELPAIKKYGSSGSYENPEYQEAVNYFYHQHMNGPNEFTITGTIKDWDITDKISAIKIPTLITVGEYDEVTPNVAR--VIHEKIAGSELHVFRDCSHLTMWEDREGYNKLLSDFIL. 287
29 -14.600d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  9...........................................................GTIQVQGQALFFREALPGSGQARFSVLLLHGIRFSSETNLGTLHRLAQAGYRAVAIDLPGLGHSKEAAAPAP----------------------IGELAPGSFLAAVVDALELGPPVVISPSLSGMYSLPFLTAPGQLPGFVPVAPICTD----------------------------------------NAANYASVKTPALIVYGDQDPMGQ--TSFEHLKQLPNHR-VLIMKGAGHPCYLDKPEEWHTGLLDFLQG 207
30 -13.800d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  1.............................................PLPTSCNPSDMSHGYVTVKPRVRLH------VELGSGPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPP----------------EIEEYCMEVLCKEMVTFLDKL------GLSQAVFIGHDWGGMLVWYMALFYPERVRAVANTPFINPNMSPLESIKANPVFDYQLYFQEPGVAEAEVQQFKKSGFRGPLNWYRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHI-EDCGHWTQMDKPTEVNQILIKWLDS 318
31 -13.600d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]}  ali model 3D-neighbors follow..  14  41..................................................................DLIKIQIIRPKSTEKLPVVMTASPYHLGINDKANDLAYFLTRGFASIYVAGVGTRSSQTSGDYQQIYSMTAVIDWLNGRARAYTSRKKTHEIKA--------SWANGKVAMTGKSYLGTMAYGAATTGVEGLELILAEAGISSWYNYYRENDGADFLKGNAEYEKRLAEMTAALDRKSGDY-NYLINTDKVKADVLIVHGLQDWNVTPEQAYNFWKALPEGHAKHAFLHRGAHIYMDFSETINAYFVAKLLD 378
32 -13.300d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]}  ali model 3D-neighbors follow..  14  5..........................................................VGQENSTSIDLY------EDHGTGQPVVLIHGFPLSGHSWERQSAALLDAGYRVITYDRRGFGQSSQ-------PTTGY------DYDTF-----------AADLNTVLETLDLQDAVLVGFSTGTGVSSYGTARIAKVAFLASLEPFLLGIVAAVKADRYAFYTGFFNDFYNLDENLGTRISEEAVRNSDFRADIPRIDVPALILHGTGDRTLPIENTARVFHKALPSAEYVEVEGAPHGLLWTHAEEVNTALLAFLA. 276
33 -13.300d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]}  ali model 3D-neighbors follow..  12  7........................................................................LHFAKPTARTPLVVLVHGLLGSGADWQPVLSHLARTQCAALTLDLPGHGTNPERHCDN-----------------------FAEAVEMIEQTVQAHVTSEVPVILVGYSLGGRLIMHGLAQGAFSRLNLRGAIIEGDQQWAQRFSQQPIEHVLSDWYQQAVFSSLNHEQRQTLIAQRSANLGSSVKLPIHYVCGEQDSKFQQLAESS-------GLSYSQVAQAGHNVHHEQPQAFAKIVQAMIHS 261
34 -13.200d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}  ali model 3D-neighbors follow..  13  3...................................................SDYQTVQIFYPSKDGTKIPMFIVHKKGDGSHPAFL--YGYGGFNISSVSRLIFVRHMGGVLAVANIRG-GGEYGETWHKGGILAN--------------QNCFDDFQCAAEYLIKEGYTSPKRLTINGGSNGGLLVATCANQRPDLFGCVIAQVGVMDMLKFHKYTIG------HAWTTDYGCSDSKQHFEWLIKYSPLHNVKLPEA-SMLLLTADHDDRVVPLHSLKFIATLQNPLLIHVDTKAGHGAGK................ 254
35 -13.200d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]}  ali model 3D-neighbors follow..  16  2...........................................................ICTTRDGVEIF------KDWGQGRPVVFIHGWPLNGDAWQDQLKAVVDAGYRGIAHDRRGHGHSTPVWDG-------------YDFDTF-----------ADDLNDLLTDLDLRDVTLVAHSMGGGVGRHGTGRLRSAVLLSAIPPVMIKSDKNPDGVPDEVFDALKNGVLTERSQEGGVRCVDAFGYTDFTEDLKKFDIPTLVVHGDDDQVVPIDATGRKSAQIIPNAELKVYEGSSHGDKEKFNRDLLEFLNK.... 274
36 -13.000d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  14  12........................................................................AIVPAARKATAAVIFLHGLGDTGHG-WAEAFAGIRSSHIKYICPHAPVRPVTLNMNVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALSLYTATTQQKLAGVTALSCWLPLRASFPQGPIG----------------------------------GANRDISILQCHGDCDPLVPLMFGSLTVEKLKTNVTFKTYEGMMHSSCQQEMMDVKQFIDKLL.. 226
37 -12.700d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]}  ali model 3D-neighbors follow..  12  9............................DQRFSNLDQYPFSPNYLDDLPGYPGLRAH---------------YLDEGNSDAEDVFLCLHGEPTWSYLYRKMIPVFAESGARVIAPDFFGFGKSDKP----------------VDEEDYTFEFHRNFLLALIERL------DLRNITLVVQDWGGFLGLTLPMADPRFKRLIIM-PTLTEAEASAYAAPFPDTSYQAGVRKFPKMVAQRDQACIDISTEAISFWQNDWNGQTFMAIGMKDKLLGPDVMYPMKALINGCPEPLEIADAGHFVQEFGEQVAREALKHFAE. 308
38 -12.200d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]}  ali model 3D-neighbors follow..  16  1....................................................................MTEPLILQPAKPADACVIWLHGLGADRYD-FMPVAEALQESLLTTRF-VLPQAPTRPVTINGGYEMPSWYDIKAMSPARSISLEELEVSAKMVTDLIEAQGIDASRIFLAGFSQGGAVVFHTAFIQGPLGGVIALSTYAPTFGDELELSASQQ------------------------------------RIPALCLHGQYDDVVQNAMGRSAFEHLKSRGVTVTWQEYGHEVLPQEIHDIGAWLAARL.. 217
39 -11.600d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]}  ali model 3D-neighbors follow..  17  24.................................SAQQFRSQQSLFPPVKKEPVAEVREFDMDLPGRT-LKVRMYRPEGEPPYPALVYYHGGG------------------------VVGDLETHDPVCRVLAKDGRAVVFSVDYRPEHKFPAAVEDAYDALQWIAERAALDPARIAVGGDSAGGNLAAVTSILGPALAFQLLIYPSTGENAEGYLLTGGMSLWFLDQYLN--SLEELTHPWFSPVLYPDLSGLP-----PAYIATAQYDPLRDVGKLYAALNKAGVKVEIENFEDLIH.................... 280
40 -10.500d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]}  ali model 3D-neighbors follow..  17  7...................................................................HLYGLNLVFDRVGKGPPVLLVAEEA-------SRWPEALPEGYAFYLLDLPGYGRTEGPR---------------------MAPEELAHFVAGF-----AVMMNLGAPWVLLRGLGLALGPHLEALGLRALPAEGVE.................................................................................................................. 110
41 -9.610d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]}  ali model 3D-neighbors follow..  11  2.................................................................................FAHFVLIHTICHGAWIWHKLKPLLEALGHKVTALDLAASGVDPRQIE----------IGSFDE-----YSEPLLTFLEALP--------PGEKVILVGESCGGNIAIAADKYCEKIAAAVFHNSVLPDTEHCPSYVVDKLMEVFPDWKDTTYFTYTKDGKEITGLKLGFTLLRENLSIKKIYVWTDQDEIFLPEFQLWQIENYK-PDKVYKVEGGDHKLQLTKTKEIAEILQEVAD. 253
42 -9.380d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]}  ali model 3D-neighbors follow..  14  25.......................................................................YWELSGNPNGKPAVFIHGGPGGGIS--PHHRQLFDPERYKVLLFDQRGCGRSRPHASLDNNTT---------------------HLVADIERLREMAGVE--QWLVFGGSWGSTLALAYAQTHPRVSEMVLRGIFTLRYQDGASRFFPEKWERVLSILSDDERKDVIAAYRQRLTSADLRNVPLIRHIPAVIVHGRYDMACQVQNAWDLAKAWP-EAELHIVEGAGHSYDEPGILHQLMIATDRFAG 313
43 -9.290d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]}  ali model 3D-neighbors follow..  55...........................................................................DRAEGRAVLVGCTGTAANGGPHEFLRLSTSFQEERDFLAVPLPGYGTGTGTGTALLPA---------------------LDTALDAQARAILRAAGDAPVVLLGHSGGALLAHELAFRLERAHGAPPAGIVLVDYPPGHQEPIEVWSRQLGEGLFAGELEPMSDARLLAMGYARFLA-PGRSSAPVLLVRASEPLGDWQEERGDWRAHWDLPHTVADVPGDHFTMMRDHAPAVAEAVLSWLDA 281
44 -9.190d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]}  ali model 3D-neighbors follow..  12  1.....MELDDAYANGAYIEGAADYPPRWAASAEDFRNSLQDRARLNLSYGEGDRHKFDL---------------FLPEGTPVGLFVFVHGMAFDKSSWSHLAVGALSKGWAVAMPSYE---------------------------PEVRISEITQQISQAVTAAAKE----DGPIVLAGHSAGGHLVARMLDPEVLPEAVGARIRNVVPISPLSDLRP----------LLRTSMNEKFKMDADAAIAESPVEMQNRYDAKVTVWVGGAERPAFLDQAIWLVEAWDA--DHVIAFEKHHFNVIEPLADPESDLVAVI.. 259
45 -9.080d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  13  1...............................................................................SYKPVIV-VHGLFDSSYSHLLEYINETHPGTVVTVLDL--------------------------FDGRESLRPLWEQVQGFREAVVPIMAKAPQGVHLICYSQGG-ISLSSPQMGQYGDTDYLKWLFPTSMRSNLYRICYSPWGQEFSICNYWHDPHHDDLYLNASSFLALINGERDHPNATVWRKNFDDGVITPSSFFGFYDTLLARGAIVRCPMAGHTAWHSNRTLYETCIEPWLS. 268
46 -9.080d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]}  ali model 3D-neighbors follow..  12  1..............................SLPTMPPSGYDQVRNGVPRGQVVNISY---FSTATNSTRPARVYLPSKDKKYSVLYLLHGIGGSEND-------WFEGGGRANVIADNLIAEGKIKPLIIVTPNTNAAGPGIADGYENFTKDLLNSLIPYIESNYSV-YTDREHRAIAGLSMGGGQSFNIGLTNLDK------FAYIGPISAAPNTYPNERLFP-----------DGGKAAREKLKLL-------------FIACGTNDSLIGFGQRVEYCVANNINHVYWLIQGGGHDF-NVWKPGLWNFLQMADE. 249
47 -9.030d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]}  ali model 3D-neighbors follow..  11  1......................................................SLGAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSS--LWRNIMPHCAGLGRLIACDLIGMGDSDKLDP--------------SGPERYAYAEHRDYLDALWEALD------GDRVVLVVHDWGSALGFDWARRHRRVQGIAYMEAIAMPVEQVLPGLILRPLSEAEMAAYREPFLAAGEARRPTLSW-DYAGWLSESPIPKLFINAEPGALTTGRMR-----CRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVR. 290
48 -9.030d1pv1a_ c.69.1.34 (A:) Hypothetical esterase YJL068C {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  12  15......................................................IKLSHNSNSTKTSMNVNIYLPKHRNKRIPTVFYLSGLTCTPDNASEKQFQADKYGFAIVFPDTRGDEANDPEGSWDFGQGAGFYLNATQEPYAQHYQMYDYIHKELPQTLDSHFNKNGDNVAITGHSMGGYGAICGYLKGKRYKSCSAFAPIVNPSNVPWGQKA------FKGYLGEEKAQWEAYDPCLLIK-----NIRHVGDDRILIHVGDSDPFLEPELLLEAVKATSWQDYVEIKKVHGFDHSSTFVPEHAEFHARNL.. 296

FFAS is supported by the NIH grant R01-GM087218-01
6 2 0 3 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Jaroszewski L, Li W, Godzik A. In search for more accurate alignments in the twilight zone. Protein Sci. 2002 Jul;11(7):1702-13.