current user: public




d1l7aa_
Query: d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]}, from SCOP175

Results of FFAS03 search in SCOP175
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .
# Score Template Links and tools%idFirst MQLFDLPLDQLQTYKPEKTAPKDFSEFWKLSLEELAKVQAEPDLQPVDYPADGVKVYRLTYKSFGNARITGWYAVPDKEGPHPAIVKYHGYNASYDGEIHEMVNWALHGYATFGMLVRGQQRSEDTSISPHGHALGWMTKGILDKDTYYYRGVYLDAVRALEVISSFDEVDETRIGVTGGSQGGGLTIAAAALSDIPKAAVADYPYLSNFERAIDVALEQPYLEINSFFRRNGSPETEVQAMKTLSYFDIMNLADRVKVPVLMSIGLIDKVTPPSTVFAAYNHLETKKELKVYRYFGHEYIPAFQTEKLAFFKQILKGLast
1 -115.000d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors  100  1MQLFDLPLDQLQTYKPEKTAPKDFSEFWKLSLEELAKVQAEPDLQPVDYPADGVKVYRLTYKSFGNARITGWYAVPDKEGPHPAIVKYHGYNASYDGEIHEMVNWALHGYATFGMLVRGQQRSEDTSISPHGHALGWMTKGILDKDTYYYRGVYLDAVRALEVISSFDEVDETRIGVTGGSQGGGLTIAAAALSDIPKAAVADYPYLSNFERAIDVALEQPYLEINSFFRRNGSPETEVQAMKTLSYFDIMNLADRVKVPVLMSIGLIDKVTPPSTVFAAYNHLETKKELKVYRYFGHEYIPAFQTEKLAFFKQILKG 318
2 -52.700d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]}  ali model 3D-neighbors follow..  16  2.............................................PEDLRRSIAGSRLVWVESFDGSRVPTYVLESGRATPGPTVVLVHGGPFAEDSWDTFAASLAAAGFHVVMPNYRGS--------------TGYGEEWRLKIIGDPCGGELEDVSAAARWARESGLAS--ELYIMGYSYGGYMTLCALTMKPGLFKAGVAGASVVDWEEMYELSDAAFRNFIEQLT----------GSREIMRSRSPINHVDRIKEPLALIHPQNDSRTPLKPLLRLMGELLATFEAHIIPDAGHAINTMEDLPAVFFLATQRE. 259
3 -42.700d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]}  ali model 3D-neighbors follow..  14  59.....LSAGELLMSAALCAQYAQFL-WFDERRQKGQARKVELYQKAAPLLSPPAERHELVV---DGIPMPVYVRIPEGPGPHPAVIMLGGLESTKEESFQMENLVLDRGMATATFDGPGQGEMFE--------------------YKRIAGDYEKYTSAVVDLLTKLEAIRNDAIGVLGRSLGGNYALKSAACEPRLAACIS-WGGFSDLDYWDLETPL----TKESWKYVSKVDTLEEARLHVHAALETRDVLSQIACPTYILHGVHDE-VPLSFVDTVLELVPAHLNLVVEKDGDHCCHNLPRLEMADWLYDVLVA 345
4 -38.500d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  12  4.........................................................EYRDIEIDDYNLPMQILKPATTTHYPLLLVVDGTPGSQFEVSWETVMVSSHGAVVVKCDGRGSG--------------FQGTKLLHEVRRRLGLLEEKDQMEAVRTMLKEQYIDRTRVAVFGKDYGGYLSTYILPAKGQTFTCGSALSPITDFKLYASAFS-------ERYL------GLHGLDNRAYEMTKVAHRVSALEQQFLIIHPTADEKIHFQHTAELITQLKANYSLQIYPDESHYFTSSLYRSIINFFVECFR. 257
5 -38.400d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}  ali model 3D-neighbors follow..  15  1.....................................................MPSKKLDFIILNETKFWYQMILPPHSKKYPLLLDVYAGPCSQFRLNWATYLASTENIIVASFDGRGSGYQGDKIMHAINRRLGTFE--------------VEDQIEAARQFSKMGFVDNKRIAIWGWSYGGYVTSMVLGSGSGVFKCGIAVAPVSRWEYY------------SVYTERYMGLPTPEDNLDHYRNSTVMSRAENFKVEYLLIHGTADDNVHFQQSAQISKALGVDFQAMWYTDEDHGIASSIYTHMSHFIKQCFS. 256
6 -34.500d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]}  ali model 3D-neighbors follow..  15  4..............................................................RTERLTLAGLSVLAIPEAPKALLLALHGLQGSKEHILALLPGYAERGFLLLAFDAPRHGEREGPPPS----------SKSPRYVEEVYRVALGFKEEARRVAEEAERRFGLPLFLAGGSLGAFVAHLLLAEGFRPRGVLA----FIGSGFPMKLPQG----------------VEDPGVLALYQAPPATRGEAYGGVPLLHLHGSRDHIVPLARMEKTLEALRPRLARFVEEGAGHTLTPLMARVGLAFLEHWLEA 237
7 -32.900d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]}  ali model 3D-neighbors follow..  16  1.....................................................MLTEGISIQSYDGHTFGALVGSPAK-APAPVIVIAQEIFGVNAFMRETVSWLVDQGYAAVCPDLYARQAPGTALDPQDERQREQAYKLWQAFDM---EAGVGDLEAAIRYARHQPYSNG-KVGLVGYCLGGALAFLVAA-KGYVDRAVGYYGVGLE---------------------------------------KQLNKVPEVKHPALFHMGGQDHFVPAPSRQLITEGFGANPQVHWYEEAGHSFARTSSERTLDFLAPLQS. 233
8 -32.600d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]}  ali model 3D-neighbors follow..  18  23.....................................................TSQTSVSSLVASGF-GGGTIYYPTSDGTFGAVVISPGFTAYQSSIAWLGPRLASQGFVVFTIDTNTTLDQPDSRG--------------------------RQLLSALDYLTQRSRVDATRLGVMGHSMGGGGSLEAAKSRTSLKAAIPLTGWNTD------------------------------------------KTWPELRTPTLVVGADGDTVAPVATHSKPFYESSLDKAYLELRGASHFTPNTIAKYSISWLKRFIDS 231
9 -32.000d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]}  ali model 3D-neighbors follow..  1....................................................QCKTIAHVLRVNNGQELHVWETPPKENFKNNTILIASGFARRMDHFAGLAEYLSTNGFHVFRYDSLHHVGLSSGSIDEFT-----------------MTTGKNSLCTVYHWLQTKG---TQNIGLIAASLSARVAYEVIS-DLELSFLITAVGVVNLRDTLEKALGFDYLSLPIDELPNDLDFEGHKLGSEVFTLDSTLDKVANTSVPLIAFTANNDDWVKQEEVYDMLAHIRTHCKLYSLLGSSHDLGEN-LVVLRNFYQSVTK. 256
10 -30.900d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]}  ali model 3D-neighbors follow..  12  1................................TSPMTPDITGKPFVAADASNDYIKREVMIPMRDGVKLHTVIVLPKGAKNAPIVLTRTPYDASGRTERLASDVFVEGGYIRVFQDVRGKYGSEGDYVMTRPLRGPLNPSEVDHAT---------DAWDTIDWLVKNVSESNGKVGMIGSSYEGFTVVMALTNPHPALKVAVPESPMIDGAGSAGDFAKAAGLEQLPWWHKLTEHAAYDAFWQEQALDKVMARTP-LKVPTMWLQGLWDQE--MWGAIHSYAAMEPLNYLVMGP--RHSARQFRHDVLRPFFDQYLVD 355
11 -30.700d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]}  ali model 3D-neighbors follow..  13  6.....................................................TESAALTLDGPVG-PLDVAVDLPDVAVQPVTAIVCHPLSTEGGSMHNKARALRELGITVVRFNFRSVGTSAGSFDHGDGE--------------------QDDLRAVAEWVRAQR--PTDTLWLAGFSFGAYVSLRAAA-ALEPQVLISIAPPAGRWDFS----------------------------------------DVQPPAQWLVIQGDADEIVDPQAVYDWLETLEQQPTLVRMPDTSHFFHIDLRGALQHGVRRWLPA 216
12 -30.100d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]}  ali model 3D-neighbors follow..  17  2.........................................................EVIFNGPAG-RLEGRYQPSKEKSA-PIAIILHPHPQFGGTMNNQIVYFQKRGFTTLRFNFRSIGRSQGEFDHGAGE--------------------LSDAASALDWVQSL-HPDSKSCWVAGYSFGAWIGMQLLMRRPEIEGFMSIAPQPNTYD---------------------------------------FSFLAPCPSSGLIINGDADKVAPEKDVNGLVEKLKTQKTHRTLPGANHFFNDELMGECEDYLDRRLNG 212
13 -29.700d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]}  ali model 3D-neighbors follow..  16  6........................................................SNVMVPMRDGVRLAVDLYRPDADGPVPVLLVRNPYDKFDVFAWSNWLEFVRDGYAVVIQDTRGLFASE-----------GEFVPHVDDEA---------DAEDTLSWILEQAWCDG-NVGMFGVSYLGVTQWQAAVSGGGLKAIAPSMASADLYRAPWYGPGGALSVEALLGWSALIGTGLITSRSDARQSISLFERLGGLATPALITAGWYDGFV--GESLRTFVAVKADARLVVGP--SHSNIQEATTMHKAFFDRHLRG 320
14 -28.600d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]}  ali model 3D-neighbors follow..  12  13LATFDSSEREVLWVESPVDSEQR-------RPKSTEKLPVVMTASPYKANDLALHDMNVELEEKTSHEIHVEQKLPQKKAKELPIVDKAPYRFTHGWTYSLNDYFLTRGFASIYVAGVGTRSSDGFQTSGDYQQ----IYSMTAVIDWLNGRARAYTSRKKTHEIKASWANG-KVAMTGKSYLGTMAYGAATTGVEGLELILAEAGISSWYNYYRENGLVRSPGGFPGEDLDVLAAKSGDYNQFWHDRNYLINTDKVKADVLIVHGLQDWNVTPEQAYNFWKALPEGAKHAFLHRGAHIYSIDFSETINAYFVAKLLD 378
15 -26.700d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]}  ali model 3D-neighbors follow..  17  3...........................................................RIVPSGDVELW---SDDFGDPADPALLLVMGGNLSALGWPDEFRRLADGGLHVIRYDHRDTGRSTTRDFAAHP---------------YGFGELAADAVAVLDGW------GVDRAHVVGLSMGATITQVIALDHHDRLSSLTMLLGLSGTGVPFDDAEYARWEERAIDHAGGVLAEPYAHYSLTLPPPSRAAELREVTVPTLVIQAEHDPIAPAPHGKHLAGLIPT-ARLAEIPGMGHALPSSVHGPLAEVILAHTR. 294
16 -26.500d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]}  ali model 3D-neighbors follow..  13  4.........................................................TVGQENSTSIDLY------EDHGTGQPVVLIHGFPLSGHSWERQSAALLDAGYRVITYDRRGFGQSSQPT------------------TGYDYDTFAADLNTVLETL------DLQDAVLVGFSTGTGEVARYVSSTARIAKVAFPQEFFDGIVAAVKADRYAFYTGFFNDFYNLDENLGTRISEEAVRNSDFRADIPRIDVPALILHGTGDRTLPIENTARVFHKALPSAEYVEVEGAPHGLLWTHAEEVNTALLAFLA. 276
17 -25.800d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  22........................................................................TFQEISQNTREAVIYIHGGAWNDPENTPNKSMDTESTVCQYSIEYR--------------------------SPEITNPRNLYDAVSNITRLVK--EKGLTNINMVGHSVGATFIWQILAALKDPQKRVFLLDGIYSLKELLIEYPEYDCFTRLAF----PDGIQMYEEEPSRVMPYVKKALSRFSIDMHLVHSYSDELLTLRQTNCLISCLQLSFKLYLDDLGLHNDV--KNGKVAKYIFDNI.. 262
18 -25.600d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]}  ali model 3D-neighbors follow..  12  1....................................................................MMKHVFQKGKDTSKPVLLLLHGTGGNELDLLPLAEIVDSE---ASVLSVRG-------NVLENGMPRFFRRLAEGIFDEEDLIFRTKELNEFLDEAAKEYKFDRNNIVAIGYSNGANIAASLLFHYENALKGAV--------------------------------------LHHPMVPRRGMQLANLAGKSVFIAAGTNDPICSSAESEELKVLLENANANVTMHNRGHQLTMGEVEKAKEWYDKAF.. 202
19 -25.600d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]}  ali model 3D-neighbors follow..  16  6............................................................YAKVNGIYI--YYKLCKAPEEKAKLMTMHGGPGMSHDYLLSLRDMTKEGITVLFYDQFGCGRSEEP-----------------DQSKFTIDYGVEEAEALRSKLFGN-----EKVFLMGSSYGGALALYAVKYQDHLKGLIVSRDAIKKYGSSGSYENPEYQEAVNYFYHQH-NGPNEFTITGTIKDWDITDKISAIKIPTLITVGEYDEVTP-NVARVIHEKIA-GSELHVFRDCSHEDREGYNKLLSDFILKHL.. 290
20 -25.400d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]}  ali model 3D-neighbors follow..  15  8..............................................................................EAGERAVLLLHGFTGNSADVRMLGRFLESKGYTCHAPIYKGHGVPPEELVHTG------------------PDDWWQDVMNGYEFLKNK---GYEKIAVAGLSLGGVFSLKLGYTVPIEGIVTMCAPVLEYAREYKKREGKSEEQIEQEMEKFKQTPMKTLKALQELIA-DVRDHLDLIYAPTFVVQARHDEMINPDSANIIYNEIESPKQIKWYEQSGHVITDQLHEDIYAFLES.... 239
21 -25.300d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]}  ali model 3D-neighbors follow..  13  1.....MELDDAYANGAYIEGAADYPPRWAASAEDFRN------------SLQDRARLNLSYGEGDRHKFD--LFLPEGT-PVGLFVFVHGGYFDKSSWSHLAVGALSKGWAVAMPSYELCPEVR-------------------------ISEITQQISQAVTAAAKE----DGPIVLAGHSAGGHLVARMLDPEVLPEAVGARIRNVVPISPLSDLRP----------LLRTSMNEKFKMDADAAIAESPVEMQNRYDAKVTVWVGGAERPAFLDQAIWLVEAWDA--DHVIAFEKHHFNVIEPLADPESDLVAVI.. 259
22 -25.100d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  11  2........................................................................IWWQTKGQGNVHLVLLHGWGLNAEVWRCIDEELSSH-FTLHLVDLPGFGRSRG-----------------------------FGALSLADMAEAVLQQAPDKAIWLGWSLGGLVASQIALTHPERVRALVTVASSPCFAGFQQQLSDDQQRTVERFLALQTMGTETARQLEILKTVDLRQPLQNVSMPFLRLYGYLDGLVPRKVVPMLDKLWP-HSESYIFAKAAHAPFISHPAEFCHLLVALKQ. 252
23 -25.000d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]}  ali model 3D-neighbors follow..  16  3............................................................CTTRDGVEIF------KDWGQGRPVVFIHGWPLNGDAWQDQLKAVVDAGYRGIAHDRRGHGHSTPVW------------------DGYDFDTFADDLNDLLTDL------DLRDVTLVAHSMGGGELARYVGRTGRLRSAVLLSAIPP-KNGVLTERSQFWKDTAEGFFSANRPGNKVTQGNDAFGYTDFTEDLKKFDIPTLVVHGDDDQVVPIDATGRKSAQIIPNAELKVYEGSSHGDKEKFNRDLLEFLNK.... 274
24 -24.600d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]}  ali model 3D-neighbors follow..  14  7...........................................................KRFPSGTLASH---ALVAGDPQSPAVVLLHGAGPGAHANWRPIIPDLAENFFVVAPDLIGFGQSEYPETYPG--------------HIMSWVGMRVEQILGL-----MNHFGIEKSHIVGNSMGGAVTLQLVVEAPERFDKVALMGSVGELARLLAFYADPRLTPYRELIHSFVYDPENFPGMEEISLVIPPATLGRLPHDVLVFHGRQDRIVPLDTSLYLTKHLK-HAELVVLDRCGHWAQLERWDAMGPMLMEHFRA 281
25 -24.400d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}  ali model 3D-neighbors follow..  13  1.................................................DASDYQTVQIFYPSKDGTKIPMFIVHKKGDGSHPAFLYGYGGSITPNYSVSRLIFVRHMGGVLAVANIRGGGE--------------YGETWHKGGILANKQNCFDDFQCAAEYLIKEGYTSPKRLTINGGSNGGLLVATCANQRPDLFGCVIAQVGVMDMLKFHKYT-------IGHAWTTDYGCSDSKQHFEWLIKYSPLHNVKLPEADMLLLTADHDDRVVPLHSLKFIATLQYPLLIHVDTKAGHGAGKPTAKVIFAFIARCLN. 275
26 -23.900d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]}  ali model 3D-neighbors follow..  14  2................................................TESSTSKFVKINEKGFSDFNIH------NEAGNGETVIMLHGGGPGAGGYYRNVGPFVDAGYRVILKDSPGFNKSDAV------------------VMDEQRGLVNARAVKGL-----MDALDIDRAHLVGNAMGGATALFALEYPDRIGKLILMGPGMEGIKLLFKLYAEPSYETLKQMLQVFLYDQSISAQKAPLSTWDVTARLGEIKAKTFITWGRDDRFVPLDHGLKLLWNID-DARLHVFSKCGHWAQWEHADEFNRLVIDFLR. 281
27 -23.700d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]}  ali model 3D-neighbors follow..  12  6...........................................................KSILAAGVLTN------HDVGEGQPVILIHGSGPGVSAYANWRLTIPSKFYRVIAPDMVGFGFTDRP------------------ENYNYSKDSWVDHIIGI-----MDALEIEKAHIVGNAFGGGLAIATALRYSERVDRMVLMPSIENMRNLLDIFAYDRSLVTDELARLRYEASIQPGFQESFSSMSSDEDIKTLPNETLIIHGREDQVVPLSSSLRLGELID-RAQLHVFGRCGHWTQIEQTDRFNRLVVEFFN. 269
28 -22.900d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]}  ali model 3D-neighbors follow..  10  13.......................................................................YRLLGAGKESRECLFLLHGSGVDETTLVPLARRIAPT---ATLVAARG-------RIPQEDGFRWFERIDPTRFEQKSILAETAAFAAFTNEAAKRHGLNLDHATFLGYSNGANLVSSLMLLHPGIVRLAA--------------------------------------LLRPMPVLDHVPATDLAGIRTLIIAGAADETYGPPALVTLLSRHGAEVDARIIP-SGHDIGDPDAAIVRQWLAG.... 208
29 -22.400d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]}  ali model 3D-neighbors follow..  13  27...........................................................DLPGYPGLRAH--YLDEGNSDAEDVFLCLHGEPTWSYLYRKMIPVFAESGARVIAPDFFGFGKSDKP----------------VDEEDYTFEFHRNFLLALIERL------DLRNITLVVQDWGGFLGLTLPMADPSRFKRLIIMPTLTEAEASAYAAPFPDTSYQAGVRKFPKMVAQRDQACIDISTEAISFWQNDWNGQTFMAIGMKDKLLGPDVMYPMKALINGCPEPLEIADAGHFVQEFGEQVAREALKHFAE. 308
30 -22.200d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]}  ali model 3D-neighbors follow..  10  1.............VPKTPAGP---------TLSGQGSFFVGGRDVTSETLSLSPKYDAHGTVTVDQMYVR--YQIPQRAKRYP-ITLIHGCCLTGMGRMGWDEYFLRKGYSTYVIDQSGRGRSATDISAINAVKLG----------------------KAPASSLPDLFAAGHEAAWAIFRFGPRYPDAFKDTQFPVQAQAELWQQMVPDWLGSMPTPNPTVANLSKLAIKLDGAAMNPKGITAIVSVEPEDVKPLTSIPVLVVFGDHIEEFPRHAFIDALNAAGGKGQLMSLPGNSHMMMLQVADLILDWIGRNTA. 318
31 -22.100d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]}  ali model 3D-neighbors follow..  13  7...................................................PLAAYDSGWLDTGDGHRIY---WELSGNPNGKPAVFIHGGPGGGISPHHRQLFDPE-RYKVLLFDQRGCGRSRPH----------------ASLDNNTTWHLVADIERLREMA--------EQWLVFGGSWGSTLALYAQTHPERVSEMVLRGIFTLRKQRLHWYYQDGASRFFPEKWERVLSILSDDERKDVIAYFTHLGFLESRHIPAVIVHGRYDMACQVQNAWDLAKAWP-EAELHIVEGAGHSYDPGILHQLMIATDRFAG. 313
32 -22.000d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]}  ali model 3D-neighbors follow..  15  11...........................................................................RAGVAGAPLFVLLHGTGGDENQFFDFGARLLPQ---ATILSPVG-------DVSEHGAARFFRRTGEGVYDMVDLERATGKMADFIKANRE--HYQAGPVIGLGFSNGANILANVLIEQPELFDAAV--------------------------------------LMHPLIPFEPKISPAKPTRRVLITAGERDPICPVQLTKALEESLKAQGGTVETVPGGHEIRSGEIDAVRGFLAAY... 202
33 -22.000d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  1.............................................PLPTSCNPSDMSHGYVTVKPRVRLH------VELGSGPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAP----------------PEIEEYCMEVLCKEMVTFLDKL------GLSQAVFIGHDWGGMLVWYMALFYPEVASLNTPFIPANPNMSPLESIKANPVFDYQLYFQEPGVAEAEVQQFKKSGFRGPLNWGRKILIPALMVTAEKDFVLVPQMSQHMEDWIP-HLKRGHIEDCGHWTQMDKPTEVNQILIKWLDS 318
34 -21.900d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]}  ali model 3D-neighbors follow..  12  13..................................................................VQLPDVKIHYVREGAGPTLLLLHGWPGFWWEWSKVIGPLAE-HYDVIVPDLRGFGDSEKPDL--------------NDLSKYSLDKAADDQAALLDAL------GIEKAYVVGHDFAAIVLHKFIRKYSDRVIKAAQLDMAVEFDHWSYRDELLTEEELEVHVDNCMKPDNIHGGFNYYRALWTDLDHTMSDLPVTMIWGLGDTCVPYAPLIEFVPKYYSNYTMETIEDCGHFLMVEKPEIAIDRIKTAFR. 293
35 -21.800d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]}  ali model 3D-neighbors follow..  15  25LATFGLDAVAAAPPVSASDDLPTVLAAVGASHDGFQAV-YDSIALDLPTDRDDVETSTETILGVDGNEITLHVFRPAGEGVLPGLVYTHGGGMTILTTDNRVTDLAAAGSVVVMVDFRNAWTAEGHHPFPSG---------------------VEDCLAAVLWVDEHESLGLSGVVVQGESGGGNLAIATTLLADAIDGVYASIPYITELPSLVENDGYFIENGGMALLVRAYDPTGEHAEDPIAWPYFASEDELRGLPPFVVAVNELDPLRDEGIAFARLARAGVDVAARVNIGLVHGALESTVRDVAGFAADRAR. 356
36 -21.600d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]}  ali model 3D-neighbors follow..  16  3FPTLDPELAAALTMLPKVDF--------ADLPNARATYDALIGAMLADLSFDGVSLRELSAPGLDGDEVKIRFVTPDNAGPVPVLLWIHGGGGTAESSDPFCVEVAREGFAVANVEYR--------------------------APETTFPGPVNDCYAALLYIHAHAEIDPSRIAVGGQSAGGGLAAGTVLKAVPVAFQFLEIPELDDRLETVSMTNFVHRPNAILSWKYYLGESYSGPEDPDVSIYAAPSRATDLT-PTYLSTMELDPLRDEGIEYA-LLQAGVSVELHSFPGTFHGSSERGAAEALTAIRRGLRS 317
37 -21.500d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  14  12........................................................................AIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHA-----VRPVTLNMNVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFP---------------------------------QGPIGGANRDISILQCHGDCDPLVPLMFGSLTVEKLKTNVTFKTYEGMMHSSCQQEMMDVKQFIDKLL.. 226
38 -21.300d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]}  ali model 3D-neighbors follow..  12  7..................................................................VNAGGVETRYLEAGKGQPVILIHGGGAGAESNWRNVIPILARHYRVIAMDMLGFGKTAKPDI---------------EYTQDRRIRHLHDFIKAMNF--------DGKVSIVGNSMGGATGLGVSVLHSELVNALVLMFTREGMVHLVKALTNDGFKIDDAMINSRYTYATDEATRKAYVATYDPEFIRKVQVPTLVVQGKDDKVVPVETAYKFLDLID-DSWGYIIPHCGHWAMIEHPEDFANATLSFLS. 266
39 -21.200d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]}  ali model 3D-neighbors follow..  10  7........................................................................LHFAKPTARTPLVVLVHGLLGSGADWQPVLSHLARTQCAALTLDLPGHGTNPERHCDN-----------------------FAEAVEMIEQTVQAHVTSEVPVILVGYSLGGRLIMHGLAQGAFSRLNLRGAIIEGDQQWAQRFSQQPIEHVLSDWYQQAVFSSLNHEQRQTLKQPYLLPALQALKLPIHYVCGEQDSKFQQLAESS-------GLSYSQVAQAGHNVHHEQPQAFAKIVQAMIHS 261
40 -20.100d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  16  9...........................................................GTIQVQGQALFFREALPGSGQARFSVLLLHGIRFSSETWQNTLHRLAQAGYRAVAIDLPGLGHSKEA-----------------AAPAPIGELAPGSFLAAV-----VDALELGPPVVISPSLSGMYSLFLTAPGSQLPGFVPVAPICTD----------------------------------------NAANYASVKTPALIVYGDQDPMGQTS--FEHLKQLP-NHRVLIMKGAGHPCYLDKPEEWHTGLLDFLQG 207
41 -18.900d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]}  ali model 3D-neighbors follow..  16  1....................................................................MTEPLILQPAKPADACVIWLHGLGADRYDFMPVAEALQESLLTTRFVLPQAP--TRPVTINGGYEMPSWYDIKAMSPARSISLEELEVSAKMVTDLIEAQKIDASRIFLAGFSQGGAVVFHTANWQGPLGGVIALSTYAPTFGDELELSA------------------------------------SQQRIPALCLHGQYDDVVQNAMGRSAFEHLKSTVTWQEYP-MGHEVLPQEIHDIGAWLAARLG. 218
42 -18.500d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]}  ali model 3D-neighbors follow..  12  14...............................................RNGVPRGQVVNISYFST-NSTRPARVYLPPGDKKYSVLYLLHGIGGSEND-------WFEGGGRANVIADNLIAEGKIKPLIIVTPNTNAAGPGIADGYENFTKDLLNSLIPYIESNYSV-YTDREHRAIAGLSMGGGQSFNIGLTNLDKFAYIGPISAAPNTYPNERL------------------------------FPDGGKAAREKLKLLFIACGTNDSLIGFGQRVEYCVANNINHVYWLIQGGGHDFNKPGLWNFLQMADEAGL. 252
43 -18.100d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]}  ali model 3D-neighbors follow..  17  1...LDPVIQQVLDQLNRMPAPD----YKHLSAQQFRSQ---QSLFPPVKKEPVAEVREFDMDLPGR-TLKVRMYRPEGEPPYPALVYYHGGGWVVGDLETHRVLAKDGRAVVFSVDYR--------------------------APEHKFPAAVEDAYDALQWIAERAALDPARIAVGGDSAGGNLAAVTSILAPALAFQLLIYP-STGYDPAHPPASIEENAEMSLWFLDQYLNSLEELTHPWFSPVLYPDLSG---PPAYIATAQYDPLRDVGKLYAALNKAGVKVEIENFEDLIHGFATKALVRIAEKLRDALA. 308
44 -16.900d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]}  ali model 3D-neighbors follow..  12  9.................................................QAPEIPAKEIIWKSE-KNSRRVWIFTTGDAEERPLAVLLDGEFWAQSMPVWPVLSLTHRQAVYVLIDAIDTTHRAHEL----------------PCNADFWLAVQQELLPLVKVIAPFSD-RADRTVVAGQSFGGLSALYAGLHWPERFGCVLSQSGSYWW------------------------PHRGGQQEGVLLEKLKAGEVSAEGLRIVLEAGIREPMIANQALYAQLHPIKESIFWRQVDG-GHDALRGGLMQGLIDLWQPL.. 245
45 -16.600d2d81a1 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymerase {Penicillium funiculosum [TaxId: 28572]}  ali model 3D-neighbors follow..  13  2...................................................................................................................................................................ALPAFNVNPNSVSVSGLASGGYMAAQLGVAYSDVFNVGFGVFAGGPYDCARNQYYT------SCMYNGYPSITTPTANMKSWSGNQIASVANLGQRKIYMWTGSSDTTVGPNVMNQLKAQLGANVSYVTTTGAVHTF.................. 137
46 -16.300d1pv1a_ c.69.1.34 (A:) Hypothetical esterase YJL068C {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  12  21.............................................................SNSTKTSMNVNIYLPPRNKRIPTVFYLSGLTCTPDNASEKQFQADKYGFAIVFPDTRGDEANDPEGSWDFGQGAGFYLNATQEPYAQHYQ-IHKELPQTLDKNGDVKLDFLDNVAITGHSMGGYGAICGY--GKRYKSCSAFAPIVNPSNV----------------WGQKAFKGYLGEEKAQWEAYDPCLLIKNIRDRILIHVGDSDPFLEPELLLEAVKATSWQDYVEIKKVHGFDFVSTFVPEHAEFHARNLG. 297
47 -15.800d2gzsa1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  11  4..............................................ADKGSVFYHFSATSFDSVDTRHYRVWTAVPNTASGYPILYMLDGNA-DRLDDELLKQLSEKTPPVIVAVGYQTNLNSRAYDYTPAAESRKTDLHSGRFSRKSGGSNNFRQLLRIAPKVEQGLNIDRQRRGLWGHSYGGLFVLDSWLSSSYFRSYYSASPSL--------------------------------GYDALLSRVTAVEPLQFCTKHLAIMEGSATQGDNRETTLTILKDKGVNAVFWDFPNLGHPMFNASFRQALLDI...... 262
48 -15.400d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]}  ali model 3D-neighbors follow..  13  1......................................................SLGAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAG-LGRLIACDLIGMGDSDKLDPS--------------GPERYAYAEHRDYLDALWEAL-------GDRVVLVVHDWGSALGFDWARRHRERVQGIAYMEAIA-VEQVLPGLILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQIGWLSESPIPKLFINAEPGALTT-GRMRDFCRTWPNQTEITV--AGAHFIQEDSPDEIGAAIAAFVR. 290
49 -15.300d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]}  ali model 3D-neighbors follow..  10  1................................................................................AFAHFVLIHTICHGAWIWHKLKPLLEALGHKVTALDLAASGVDPRQIEEIGS-----------------FDEYSEPLLTFLEALP-----PGEKVILVGESCGGLIAIAADKYCEKIAAAVFHNSVLPDTEHCPSYVVDKLMEVFPDWKDTTYFTYTKDGKEITGLKLGFTLLRENLSIKKIYVWTDQDEIFLPEFQLWQIENYKP-DKVYKVEGGDHKLQLTKTKEIAEILQEVAD. 253
50 -15.000d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  10  1...............................................................................SYKPVIV-VHGLFDSSYSFRHLLEYINETGTVVTVLDLFDGRES--------------------------LRPLWEQVQGFREAVVPIMAKAPQGVHLICYSQGGLVCRALLSVMDDHNMGQYGDTDYLKWLFPTSMRSNLYRICYSPWGQEFSICNYWHDPHHDDLYLNASSFLALINGELVLIGGPDDGVITPWQSSFFLKTLRGAIVRCPMAGISHTAWHSNRTLYETCIEPWLS. 268
51 -14.800d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  4....................................................................................VYIIHGYRASSTNHWFPKKRLLADGVQADILNMPNPLQP--------------------------------RLEDWLDTLSLYQHTLHENTYLVAHSLGCPAILRFLELRAALGGIILVSGFAKSL-------------------------PTLQMLDEFTQGSFDHQKIIESAKHRAVIASKDDQIVPFSFSKDLAQQIDA--ALYEVQHGGHFLEDEGFPIVYDVLTSYFS. 185
52 -14.800d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]}  ali model 3D-neighbors follow..  13  24....................................................GYPAEEYEVVTEDGYRIPYGRKNSENIGRRPVAFLQHGLLASATPNNSLAFILADAGYDVWLGNSRGNTWARRNLYYSPDSVEFW--------AFSFDEMAKYDLPATIDFILKK--TGQDKLHYVGHSQGTTIGFIAFSTNPKLAKRIKTFYALAPVATSVQNVLHWSQAVKSGKFQAFDWGSPVQNMMHYHQSMPPYYNLTDMHVPIAVWNGGNDLLADPHDVDLLLSKLPNLIYHRKIPPYNHDAPQAVYNEIVSMMGT.... 376
53 -14.500d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]}  ali model 3D-neighbors follow..  13  1..................................................RPGLPVEYLQVPSASGRDIKVQFQGG----GPHAVYLLDGLRAQDDYNTPAFEEYYQSGLSVIMPV--GGQSSFYTDWYQPSQSNG------QNYTYKWETFLTREM---PAWLQANKGVSPTGNAAVGLSMSGGSALILAAYYPQQFPYAASLSGFLNPSESWWPTLIGLAMNDSGGYNANSMWGPSSD--PAWKRNDPMVQIPRLVTRIWVYCGNGTPRTNQTFRDTYAADGGRNGVFNFPPNGTHSYWNEQLVAMKADIQHVLNG 280
54 -14.000d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]}  ali model 3D-neighbors follow..  15  1.............................................................RRAGYLHLYGLNLVFDRVGKGPPVLLVAEE-------ASRWPEALPEGYAFYLLDLPGYGRT--------------------EGPRMAPEELAHFVAGFAVMM------NLGAPWVLLRGLGLALGPHLEALGLRALPAEGVE.................................................................................................................. 110
55 -13.300d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]}  ali model 3D-neighbors follow..  54..........................................................................TDRAEGRAVLVGCTGTAANGGPHEFLRLSTSFQEERDFLAVPLPGYGTGTGTGTAL----------------------LPADLDTALDAQARLRAAGDAPVVLLGHSGGALLAHELAFRLERAHGAPPAGIVLVDYPPGHQEPIEVWSRQLGEGLFAGELEPMSDARLLAMGRYARF--PGRSSAPVLLVRASEPLGDWQEERGDWRAHWDLPHTVADVPGDHFTMMRDHAPAVAEAVLSWLDA 281
56 -13.200d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]}  ali model 3D-neighbors follow..  1.........................SFKYESAVQYRPAPDSYLNPCPQAG----RIVKETYTGINGTK-SLNVYLPYGNKKYNIFYLMHGGGENENTIFSNLDHAIMNGLIVVTPTFNGGNCTAQN----------------------FYQEFRQNVIPFVEYSTYAESTTPQGIGFGGFAMGGLTTWYVMVNCLDYVAYFMPLSGDYWYG------------------------NSPQDKANSIAEAINRSGLSKREYFVFAATGSEDIAYANMNPQYTSDFSKGNFYFLVAPGATHWWGRHYIYDALPYF...... 272
57 -11.400d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]}  ali model 3D-neighbors follow..  10  27............................................................................PSSVSKPILL-VPGTGTTGPQSFDSIPLSTQLGYTPCWISPPPFMLNDTQVNTEY-------------------------MVNAITALYAG--SGNNKLPVLTWSQGGLVAQWGLTFFPSIRSKVDRLMAFA--PDYKGTVLAGPLDALAVSAPSVWQQTTGSALTTALRNAGGLT-----IVPTTNLYSATDEIVQPQVSNSPGKNVQAQAVCGPLFVIDHAGS--TSQFSYVVGRSALRS 243
58 -11.200d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  10  1...............................................................................EHNPVVM-VHGIGGASFNFAGIKSYLVSQGWSRDKLYAVDFWDKTGT-----------------------NYNNGPVLSRFVQKVLD--ETGAKKVDIVAHSMGGANT----------LYYIKNLDGGNKVANVVTLGGANRLTTGKALPGTDPNQK----------------------ILYTSIYSSADMIVMNYLS-----RLDGARNVQI-HGVGHIGL-LYSSQVNSLIKEGLNG 174
59 -10.900d1qe3a_ c.69.1.1 (A:) Thermophilic para-nitrobenzyl esterase (PNB esterase) {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  17  26IPYAKPPVGQWRFKAPEPPEV------WEDVLDATAYGPICPQ------PSDLLSLSYTELPRQSEDCLYVNVFAPDPSQNLPVMVWIHGGAGAGSEPLYDGSKLAAQGVIVVTLNYR--------------GPFGFLHLSSFD-EAYSDNLGLLDQAAALKWVREN---DPDNVTVFGESAGGMSIAALLAMP---AAKGLFQKAIMESGASRTMTKEQAASTAAAFLQVLGINESQLDRLHTVAAEDLLKAADQLRIQLFFQPALDPKTLPEEPEKSIAEGAASGIPLLI.......................... 303
60 -10.400d2h7ca1 c.69.1.1 (A:1021-1553) Mammalian carboxylesterase (liver carboxylesterase I) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  13  33IPFAKPPLGPLRFTPPQPAEP------WSFVKNATSYPPMCTQDPKAGQLLSELFTNRKENIPLKLSELYLNIYTPAKKNRLPVMVWIHGGGVGAASTYDGLALAAHENVVVVTIQYR--------------GIWGFFSTGDEHSRGNWG---HLDQVAALRWVQDN---NPGSVTIFGESAGGESVLVLSPLAKNLFHRAISESGVALTSVLVKKGDVKPLAEQIAITA---KTTTSAVMVHCLRQKTEEELLE............................................................... 276
61 -10.300d1ea5a_ c.69.1.1 (A:) Acetylcholinesterase {Pacific electric ray (Torpedo californica) [TaxId: 7787]}  ali model 3D-neighbors follow..  13  30IPFAEPPVGNMRFRRPEPKKP------WSGVWNASTYPNNCQQYVDEQFPGFSGSEMWNPNREMSEDCLYLNIWVPSRPKSTTVMVWIYGGGSSTLDVYNGKYLAYTEEVVLVSLSYR--------------GAFGFLA--LHGSQEAPGNVGLLDQRMALQWVHDN---DPKTVTIFGESAGGASVHILSPGSRDLFRRAILQSGSPNCPWASVSVAEGRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWVPVI------DGEFFPTSLESMLNSGNFKKTQILLGVNKDE................... 324
62 -10.200d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]}  ali model 3D-neighbors follow..  14  1............................................................................DPPAPLPLVI-WHGMGDSCCGAIKKMVEKKIPGIHVLSLEIGKTLREDVENSFFLN---------------------VNSQVTTVCQILAKDPKLQQGYNAMGFSQGGQFLLISVGGQHQGVFGLPRCPGESSHICDFIRKTLNAGAYNKAIQERLVQAEYWHDPIREDIYRNHSIFLADINQEFVMVKFLNDTIVDPVDSEWFLKAMDKAGQLVFLALEGHLQLSE--EWFYAHIIPFLE. 279
63 -10.000d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]}  ali model 3D-neighbors follow..  17  3...........................................................................TYAATRYPVIL-VHGLAGTDDYWYGIQSDLQSHGAKVYVANLSGFQSDDGPNGRGE------------------------QLLAYVKQVLA--ATGATKVNLIGHSQGGLTSRYVAAVAPQLVASVTTIGT................................................................................................................ 112
64 -9.510d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]}  ali model 3D-neighbors follow..  10  19VSIPDEQLDDLKTLVRLSKIAPTMREKWLSEFD--------------RPFEARLNSFPQFTTEIEGLTIHFAALFSEREDAVPIAL-LHGWPGSFVEFYPILQLFREEPFHLVVPSLPGYTFSSGPP-----LDKDFGLMDN--------ARVVDQLMKDLGF--------GSGYIIQGGDIGSFVGRLLGVGFDACKAVHLNLCAMR------------APPEGPSIESLSAAEKEGIARMEKFMTDGLAYAMEHSTRPSTIGHVLSSSPIALLEKYLQWVDKPLPSETILEMVSLYWLTESFPRAIHTYRET.... 315
65 -9.350g1wht.1 c.69.1.5 (A:,B:) Serine carboxypeptidase II {Wheat (Triticum vulgare) [TaxId: 4565]}  ali 3D-neighbors follow..  13  25..........................................................ITVDEGAGRSLFYLLQEAPEDQPAPLVLWLNGGPGCSS----AYGASEELG-AGLVLNEYRWNKVANVLFLDSPAGVGFSTNTSSDIYTSGDNRTAHDSYAFLKWFERFPHYKYRDFYIAGESYAGHINLKGFMVGNGLIDDYHDYVGTFEFWWNHGIVSDDTYRRLKEACLHDSFIHPSPACDAATDYYNRRDVQMALHARIWVFSGDTDAVVPLTATRYSIGALGKGLTLVSVRGAGHEVPLHRPRQALVLFQYFLQG 404

FFAS is supported by the NIH grant R01-GM087218-01
6 0 5 4 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ye Y, Li Z, and Godzik A. Modeling and Analyzing Three-Dimensional Structures of Human Disease Proteins Pacific Symposium on Biocomputing 11:439-450(2006) [PDF]