current user: public




Query: d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]}, from SCOP206

Results of FFAS03 search in SCOP206
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .
# Score Template Links and tools%idFirst MQLFDLPLDQLQTYKPEKTAPKDFSEFWKLSLEELAKVQAEPDLQPVDYPADGVKVYRLTYKSFGNARITGWYAVPDKEGPHPAIVKYHGYNASYDGEIHEMVNWALHGYATFGMLVRGQQRSEDTSISPHGHALGWMTKGILDKDTYYYRGVYLDAVRALEVISSFDEVDETRIGVTGGSQGGGLTIAAAALSDIPKAAVADYPYLSNFERAIDVALEQPYLEINSFFRRNGSPETEVQAMKTLSYFDIMNLADRVKVPVLMSIGLIDKVTPPSTVFAAYNHLETKKELKVYRYFGHEYIPAFQTEKLAFFKQILKGLast
1 -129.000d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors  100  1MQLFDLPLDQLQTYKPEKTAPKDFSEFWKLSLEELAKVQAEPDLQPVDYPADGVKVYRLTYKSFGNARITGWYAVPDKEGPHPAIVKYHGYNASYDGEIHEMVNWALHGYATFGMLVRGQQRSEDTSISPHGHALGWMTKGILDKDTYYYRGVYLDAVRALEVISSFDEVDETRIGVTGGSQGGGLTIAAAALSDIPKAAVADYPYLSNFERAIDVALEQPYLEINSFFRRNGSPETEVQAMKTLSYFDIMNLADRVKVPVLMSIGLIDKVTPPSTVFAAYNHLETKKELKVYRYFGHEYIPAFQTEKLAFFKQILKG 318
2 -117.000d3fcya_ c.69.1.0 (A:) automated matches {Thermoanaerobacterium sp. [TaxId: 60708]}  ali model 3D-neighbors follow..  36  1...FDMPLQKLREYTGTNPCPEDFDEYWNRALDEMRSVDPKIELKESSFQVSFAECYDLYFTGVRGARIHAKYIKPKTEGKHPALIRFHGYSSNS-GDWNDKLNYVAAGFTVVAMDVRGQGGQSQDGGVTGNTLNGHIIRGLDDADNMLFRHIFLDTAQLAGIVMNMPEVDEDRVGVMGPSQGGGLSLACAALEPRVRKVVSEYPFLSDYKRVWDLDLAKAYQEITDYFRLFPRHERENEVFTKLGYIDVKNLAKRIKGDVLMCVGLMDQVCPPSTVFAAYNNIQSKKDIKVYPDYGHEPMRGFGDLAMQFMLELY.. 316
3 -28.700d2jbwa1 c.69.1.41 (A:8-365) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]}  ali model 3D-neighbors follow..  15  81............................DERRQKGQARKVELYQKAAPLLSPPAERHELVV---DGIPMPVYVRIPEGPGPHPAVIMLGGLESTKEESFQMENLVLDRGMATATFDGPGQGEMF-------------EYKRIAGDYEKYTSAV-------VDLLTKLEAIRNDAIGVLGRSLGGNYALKSAACEPRLAACISWGGFSD-----LDYWDLETPLTKESWKYVSKVDTLEEARLHVHAALETRDVLSQIACPTYILHGVHDEVPLSFVDTVLELVPAEHLNLVVEKDGDHNLGIRPRLEMADWLYDVLVA 345
4 -28.600d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]}  ali model 3D-neighbors follow..  17  2....................................................RVRTERLTLAGL--------VLARIPEAPKALLLALHGLQGSKEHILALLPGYAERGFLLLAFDAPRHGEREGPPP--------------SSKSPRYVEEVYRVALGFKEVAEEAERRFGLPLFLAGGSLGAFVAHLLLAEGFRPRGVLA-------------FIGSGFPMKLPQG-----QVVEDPGVLALYQAPPATRGEAYGGVPLLHLHGSRDHIVPLARMEKTLEALEGRLARFVEEGAGHTLTPLMARVGLAFLEHWLEA 237
5 -27.700d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]}  ali model 3D-neighbors follow..  15  8...................................................SIAGSRLVWVESFDGSRVPTYVLESGRATPGPTVVLVHGFAEDSDSWDTFAASLAAAGFHVVMPNYRGST--------------GYGEEWRLKIIGDPCGGELEDVSAAARWARESGLAS--ELYIMGYSYGGYMTLCALTMKPGLFKAGVAGASVVDWEEMYELSDAAFRNFIEQLTGGSR---------EIMRSRSPINHVDRIKEPLALIHPQNDSRTPLLRLMGELLARGKTFEAHIIPDAGHAINTMEDAPAVFFLATQRE. 259
6 -24.300d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]}  ali model 3D-neighbors follow..  1....................................................QCKTIAHVLRVNNGQELHVWETPPKENVKNNTILIASGFARRMDHFAGLAEYLSTNGFHVFRYDSLHHVGLSSG-----------------SIDEFTMTTGKNSLCTVYHWLQTK---GTQNIGLIAASLSARVAYEVIS-DLELSFLITAVGVVNLRDTLEKALGFDPIDELPNDLDFEGHKLGSEVFVRDCTLDSTLDKVANTSVPLIAFTANNDDWVKQEEVYDMLAHITGHCKLYSLLGSSHD................... 239
7 -22.900d4eb0a_ c.69.1.0 (A:) automated matches {Uncultured bacterium [TaxId: 77133]}  ali model 3D-neighbors follow..  21  2..............NPYQRGPNPTRSALTAD----------------PFSVATYTVSRLSVSGFGGGVIY----YPTGSLTFGGIAMSPGYTADASSLAWLGRRLASHGFVVLVINTNSRFDYPDSRASQ---------------------SAALNYLRTSSPSAVRARLDANRLAVAGHSMGGGGTLRIAEQNPSLKAAVPLTPWHTD--------------------------------------------TFNTSVPVLIVGAEADTVAPVSQAIPFYQNLTTPKVYVELDNASHSNNAAISVYTISWMKLWVDN 231
8 -20.100d4x00a_ c.69.1.0 (A:) automated matches {Burkholderia cenocepacia [TaxId: 216591]}  ali model 3D-neighbors follow..  13  5...........................................................TVTAPDGVVLA---VQEAGDPEGSPIIFIHGLLGSRLNWSKQLQDPRLQHYRLITYDLRGHGLSGKP----------------AEASSYTDGRRWADDLAAI-----IESTHARKPVLVGWSLGGAVAVYVDGVIELKPDQIVAHPEVYRIASDLQTHLDGERAFLRLCFHRQPDATTFSLLLANAALVEAAKGLSKAEVPLLLLYGAQDALVKAKPSIARAKSLNPRIRSELYADSGHEEPERFNRDLSDFVRMALS. 272
9 -19.500d3e3aa1 c.69.1.0 (A:-5-262) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}  ali model 3D-neighbors follow..  12  3..................................................................PEFRVINLAYDDNGTGDPVVFIAGRGGAGR-HPHQVPAFLAAGYRCITFDNRGIGAT-------------------ENAEGFTTQTMVADTAALIE------TLDIAPARVVGVSMGAFIAQELMVVAPELVSSAVLMATRGRLDRARQFFNKAEAELYDSGVQLPPTYDARARLLENFS-TNRLPAYRNIAAPVLVIGFADDVVTPPYLGREVADALPNGR-YLQIPDAGHLGFFERPEAVNTAMLKFFAS 265
10 -19.400d3kxpa_ c.69.1.0 (A:) automated matches {Mesorhizobium loti [TaxId: 381]}  ali model 3D-neighbors follow..  15  2........................................................FISRRVDIGRITLN------REKGSGPLMLFFHGITSNSA-VFEPLMIRLSDRFTTIAVDQRGHGLS-------------------DKPETGYEANDYAD-----DIAGLIRTLARGHAILVGHSLGARNSVTAAAKYPDLVRSVVAIDFTPYIEDAIRIRAESGYQPVDGGLRPLASSAAMAQTARGLR--DLVPAYRDVTKPVLIVRGESSKLVSAAAL-AKTSRLRPDLPVVVVPGADHYVNEVSPEITLKAITNFIDA 268
11 -19.200d4zv9a1 c.69.1.0 (A:60-294) automated matches {Escherichia coli [TaxId: 83334]}  ali model 3D-neighbors follow..  17  1.............................................QVEFTDPEIFAEYITYPSPNGHEVRGYLVKPAKSGKTPAVVVVHENRGLNPYIEDVARRVAKAGYIALAPDGLNSVGGYPGNDDKGRELQQQVDP----------TKLMNDFFAAIEFMQRYPQ-ATGKVGITGFCYGGGVSNAAAVAYPELACAVPFY-----------------------------------------GRQAPTADVAKIEAPLLLHFAELDTRINEGAYEAALKANNKVYEAYIYPGVNHSAADLAWQRTLKWFDKYL.. 235
12 -19.100d2ocga_ c.69.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  13  6............................................................KVAVNGVQLH---YQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRP-------------------PDRDFPADFFER--DAKDAVDLMKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSR-LHLMPEGKHNLHLRFADEFNKLAEDFLQ. 254
13 -18.600d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]}  ali model 3D-neighbors follow..  14  1................................TSPMTPDITGKPFVAADASNDYIKREVMIPMRDGVKLHTVIVLPKGAKNAPIVLTRTPYDASGRTERLASPHFVEGGYIRVFQDVRGKYGSEGD----------VMTRPLRGPLNPSEVDHATDAWDTIDWLVKNVSESNGKVGMIGSSYEGFTVVMALTNPPALKVAVPESPMIDGWAGSAGDFAKAAGLEQLPWWHKLTEHAAYDAFWQEQALDKVMARTP-LKVPTMWLQGLWDQEDMWGAIMEPRDKRNTLNYLVMGPWR-HSQVNYRHDVLRPFFDQYLVD 355
14 -18.500d3rm3a_ c.69.1.0 (A:) automated matches {Bacillus sp. [TaxId: 129908]}  ali model 3D-neighbors follow..  15  17..............................................................................ENGPVGVLLVHGFTGTPHSMRPLAEAYAKAGYTVCLPRLKGHGTHYEDMERTT------------------FHDWVASVEEGYGWLKQR-----QTIFVTGLSMGGTLTLYLAEHHPDICGIVPINAAVGELPRYLDSIGSDLKNPDVKELAYEKTPTASLLQLARL-MAQTKAKLDRIVCPALIFVSDEDHVVPPGNADIIFQGISSTKEIVRLRNSYHVATLDYDQPMIEFFAKH... 248
15 -18.400d1zi8a_ c.69.1.9 (A:) automated matches {Pseudomonas putida [TaxId: 303]}  ali model 3D-neighbors follow..  14  1.....................................................MLTEGISIQSYDGHTFGALVGSPAK-APAPVIVIAQDIFGVNAFMRETVSWLVDQGYAAVCPDL----ARQAPGTALDPQDERQREQAYKLWQAFDMEAGVGDLEAAIRYARHQPYSNG-KVGLVGYSLGGALAFLVAS---------------------------------------------KGYVDRAVGYYGVLNKVPEVKHPALFHMGGQDHFVPAPSRQLITEGFGANPQVHWYEEAGHSAAALANERTLDFLVPLQS. 233
16 -18.200d3dkra_ c.69.1.0 (A:) automated matches {Lactobacillus rhamnosus [TaxId: 486408]}  ali model 3D-neighbors follow..  15  10..............................................................................EGTDTGVVLLHAYTGSPNDMNFMARALQRSGYGVYVPLFSGHGTVEPLDILTKGNPDIW----------------WAESSAAVAHMTA----KYAKVFVFGLSLGGIFAMKALETLPGITAGGVFSSPILPGKHHLVPGFLKYAEYMNRLAGKSDESTQILAYLAAIDQFTVAADLNLVKQPTFIGQAGQDELVDGRLAYQLRDALAARVDFHWYDDAKHSAHHALEEDVIAFMQQENE. 241
17 -18.200d3pe6a_ c.69.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  13  15...........................................................HLVNADGQYLFCRYWAPTGTPK-ALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSD-----------------FHVFVRDVLQHVDSMQK--DYPGLPVFLLGHSMGGAIAILTAAERPGFAGMVLISPLVLANPESATTFKVLAAKVLNSVLPNLSSGPIDSSVLDPLICRAGLKVLPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSDKTLKIYEGAYHVLHKELPEVTNMWVSQRTA. 289
18 -17.700d4a5sa2 c.69.1.0 (A:509-766) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  11...............................................................LNETKFWYQMILPPHSKKYPLLLDVYAGPCSQKADTVFRLNWSTENIIVASFDGRGSGYQGDKIMHAINRRLGTFE--------------VEDQIEAARQFSKMGFVDNKRIAIWGWSYGGYVTSMVLGSGSGVFKCGIAVAPVSRWEYYDSV-----------YTERYMGLPTPEDNLDHYRNSTVMSRAENFKQVEYLLIGTADDNVHFQQSAQISKALVDVGQAMWYTDEDHGIASSTAHQHIHFIKQCFS. 256
19 -17.600d3i2ka1 c.69.1.21 (A:2-351) automated matches {Rhodococcus sp. [TaxId: 104109]}  ali model 3D-neighbors follow..  18  10.........................................................NVMVPMRDGVRLAVDLYRPDADGPVPVLLVRNPYDKFDVFAWSTQSTFVRDGYAVVIQDTRGLFAS-----------EGEFVPHVDDEA---------DAEDTLSWILEQAWCDG-NVGMFGVSYLGVTQWQAAVSGVGGLKAIAPSMASADLYRAPWYGPGGALRLIPWVIDQVVDHPDNDESWQSISLFERLG---GLATPALITAGWYDGFVGESLRTFVAVKDNADARLVVGPWS-HSNIQEATTMHKAFFDRHLRG 323
20 -17.500d4rnca1 c.69.1.0 (A:1-280) automated matches {Rhodococcus sp. [TaxId: 1831]}  ali model 3D-neighbors follow..  13  5...........................................................EAVSVDGTSI---VYRVTGNSAGTPLVLLHGWAQSSQCWGEQVLADLAADYRLIAVDLRGHGYSDAPES------------GYDDSANW-----------AGDVAAVLAAEGTENAILLGWSYGGLVICAITSIGRGEKGGKVGSAMRSAVPGAMSEDPREAIRALGAFGNALTGPPEGKGAASQARAVGHDELLRNLDIPVLVLHGTDDSVVDVSAGKHAEELIPKSQ-ASYWVGCNHGPFVEDPTRFVSEVRTFISS 273
21 -17.200d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]}  ali model 3D-neighbors follow..  15  8..............................................................................EAGERAVLLLHGFTGNSADVRMLGRFLESKGYTCHAPIYKGHGVPPEELVHTG------------------PDDWWQDVMNGYEFLKNK-----EKIAVAGLSLGGVFSLKLGYTVPIEGIVTMCAPMYIKSEETMYEGVLEYAREYKKREGKSEEQIEQEKTLKALQELDVRDHLDLIYAPTFVVQARHDEMINPDSANIIYNEIESPKQIKWYEQSGHQEKDQLHEDIYAFLESL... 240
22 -17.200d4nmwa_ c.69.1.26 (A:) automated matches {Salmonella enterica [TaxId: 99287]}  ali model 3D-neighbors follow..  11  12..................................................................................CHLVLLHGWGLN-AEVWHCIREELGSHFTLHLVDLPGYGRSSGFGAMT-----------------------------LEEMTAQVAKNAPDQAIWLGWSLGGLVASQMALTHPERVQALVTVASSPCFGGFQQQLSDDFQRTVERFLALQTLGTETARQLEILKTVDLREALKNVNMPFLRLYGYLDGLVPRKIVPLLDTLWPH-STSQIMAKAAHAPFISHPAAFCQALMTLKSS 253
23 -16.700d4uhca1 c.69.1.0 (A:2-275) automated matches {Planctomycetes bacterium [TaxId: 1331910]}  ali model 3D-neighbors follow..  11  11...................................................................TPGEIELAFEDTGTGLPVLLVHGFPLDRT-MWKAQREELCDEFRVIVPDLRGFGESQ-------------------IPGVATMEAMADDLAGLCNHLG------TGKIVLGGLSMGGYVAFAFARKYRDRLAGLILCDTRARCCESTFRNHPEVIEKIRQMILSAPPEGVAAAALGMAERPDSTDLLPALSCPTLVLVGQFDAISPPEEMEAMARTIPQSQ-FVVIPDAGHLPPMEQPERVTQAIREWLRK 269
24 -16.500d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  10...............................................................IDDYNLPMQILKPATTTHYPLLLVVDGTPGSQSVAEKFEVSWSSHGAVVVKCDGRGSGFQGTKLLHEVRRRLGLLE--------------EKDQMEAVRTMLKEQYIDRTRVAVFGKDYGGYLSTYILPAKGEFTCGSALSP-ITDFKLY-----ASAFSE--RYLGLHGLDNRAYEMTKVAHRVSALE-----EQQFLIIHPTADEKIHFQHTAELITQLIRGKSLQIYPDESHYFTSSSLKQHLNFFVECFR. 257
25 -16.200d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]}  ali model 3D-neighbors follow..  13  8...................................................................NAGGVETRYLEAGKGQPVILIHGGGAGAESNWRNVIPILARHYRVIAMDMLGFGKT-------------------AKPDIEYTQDRRIRHLHDFIKAMNFD----GKVSIVGNSMGGATGLGVSVLHSELRPIINYDFTREGMVHLVKALTNDGFKIDDAMINSRYTYATDEATRKAYGLFYDPEFIRKVQVPTLVVQGKDDKVVPVETAYKFLDLID-DSWGYIIPHCGHWAMIEHPEDFANATLSFLSL 267
26 -16.100d3og9a_ c.69.1.0 (A:) automated matches {Lactococcus lactis [TaxId: 272623]}  ali model 3D-neighbors follow..  13  4........................................................................YVFKAGRKDLAPLLLLHSTGGDEH----QLVEIAEM--SHPILSIRGRINEQGVNRYFKLRGLGGFTKENFDLESLDEETDWL--TDEVSLLAEKHDLDVHKMIAIGYSNGANVALNMFLRGKINFDKII--------------------------------------AFHGMQLEDFEQTVQLDDKHVFLSYAPNDMIVPQKNFGDLKGDLEDSGCQLEIYESGHQLTQEEVLAAKKWLTE.... 204
27 -16.100d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]}  ali model 3D-neighbors follow..  18  2.........................................................EVIFNGPAG-RLEGRYQPSKEKSAPIAIILHPGGTMNNQIVYQLFYLFQKRGFTTLRFNFRSIGRSQ-----------GEFDHGAGELS---------DAASALDWVQSL-HPDSKSCWVAGYSFGAWIGMQLLMRRPEIEGFMSIAPQPNTYD---------------------------------------FSFLAPCPSSGLIINGDADKVAPEKDVNGLVEKLKTQKTHRTLPGANHGKVDELMGECEDYLDRRLNG 212
28 -16.000d4i3fa1 c.69.1.0 (A:1-282) automated matches {Cycloclasticus sp. [TaxId: 385025]}  ali model 3D-neighbors follow..  12  18............................................................................AGTDKDTSILLLHGSGPGANANWQYALPFLAENYHCLAPDIAGFGLSQ---------------HNCPPNGTSHWIDIWVQQQIDL-----LDAKGIEQTHIVGNSMGGGVTLHLLNRHPERFKKAVLMEGLTKGWEFYKDPSKEALEYLITKFLFDPSLLGNDIASIAAQRFDNVDELNNISHQMLVTHAREDFFIPLNNAYYLIDRIP-NAQLHVFDHCGHWVQIEKKKAFNNLTKLFFDG 278
29 -15.800d4pw0a_ c.69.1.0 (A:) automated matches {Chitinophaga pinensis [TaxId: 485918]}  ali model 3D-neighbors follow..  12  2..........................................DHATAPTQYIEVNGTRYAYRSLG------------APSDIPLIC-FQHFTGTLDNWDPLITNGLSKGRQLIIFDNKGVGLSSGTTPDNVAAM-------------------------TADALEFITALGIRYFDVLGFSLGGFIVQYMAHIQPDMIRKIIIVRFLFIFFEQSEHSRSKGLATLGRLYERTTDRDQDASAQAIGAQLTAIFEITSIQHPVFVVQGSNDEMMDTYNSYELFKQLPD-AILSLYPDAAHGSFYQYPELFVSQTEYFLDS 274
30 -15.800d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]}  ali model 3D-neighbors follow..  13  1....................................................................MMKHVFQKGKDTSKPVLLLLHGTGGNEL----DLLPLAEI--EASVLSVRG-----NVLENGMPRFFRRLAEGIFDEEDLIFRT---ELNEFLDEAAKEYKFDRNNIVAIGYSNGANIAASLLFHYENALKGAV--------------------------------------LHHPMVPRRGMQLANLAGKSVFIAAGTNDPICSSAESEELKVLLENANANVTMHWEGHQLTMGEVEKAKEWYDKAF.. 202
31 -15.500d4j7aa_ c.69.1.0 (A:) automated matches {Uncultured bacterium [TaxId: 77133]}  ali model 3D-neighbors follow..  15  57................................AEQAWQTLFAMLGSQGEPSNPVDVREETIKGRGGNEIKLYIHSPTGSDPLPCVVHTHGGGMVILTAADAN-ELAATGLVVVGVEFR---------------------NAAGALGNHPFPAGLHDCADAAKWVAS-EALGISTLIMSGESGGGNLSLATTMLAEEIAGVYAQCPYISLENDAYFLDMKTMGAMVKPYDPTGENASNPLAWPYHASLEDLAGLP-----PHVISVNELDPLRDEGLAHYKLLKAGVSTVGRTVHGTCH.................... 326
32 -15.500d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]}  ali model 3D-neighbors follow..  13  9...................................................................LAAGVLTNYHDVGEGQPVILIHGSGPGVSANWRLTIPALSKFYRVIAPDMVGFGFTDRPENYN------------------YSKDSWVDHIIGI-----MDALEIEKAHIVGNAFGGGLAIATADVTEGLNAVWGYTPSIENMRNLLDIFAYDRSLVTDELARLRYEASIQPGFQESFALASSDEDIKTLPNETLIIHGREDQVVPLSSSLRLGELID-RAQLHVFGRCGHWTQIEQTDRFNRLVVEFFN. 269
33 -15.500d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]}  ali model 3D-neighbors follow..  14  21............................................................................AGDPQSPAVVLLHGAGPGAHANWRPIIPDLAENFFVVAPDLIGFGQS-------------------EYPETYPGHIMSWVGMRVEQILGLMNHFGIEKSHIVGNSMGGAVTLQLVVEAPRFDKVALMGS-LARLLAFYADPRLTPYRELIHSFVYDPENFPGMEEIVKSRFEVAND-LGRLPHDVLVFHGRQDRIVPLDTSLYLTKHLK-HAELVVLDRCGHWAQLERWDAMGPMLMEHFRA 281
34 -15.500d4inza_ c.69.1.0 (A:) automated matches {Bacillus megaterium [TaxId: 1404]}  ali model 3D-neighbors follow..  12  6...................................................................NVNGVNLHYISKGQGELMLFLHGFPDFSHI-WRHQIDEFSNDFHTVALDLRGYNLSEKP----------------SGLESYEIDVLVEDIRQVIEGL------GYSSCTLVVHDWGAGIGWTFAYRYPEYKLIAFNGPHPYTFMRELRTNKNQQKAS--EYAKWFQKQEVQDYMERDLSYYRNLKIEEVLNIPVQIIWGNQDPTFMPENLDGIEEYVPN--SVHRLAEASHAPQHEKPQEVNNVMWNFLN. 285
35 -15.500d3qvma_ c.69.1.0 (A:) automated matches {Oleispira antarctica [TaxId: 188908]}  ali model 3D-neighbors follow..  11  24..................................................................................KTVLLAHGFGCDQN-MWRFMLPELEKQFTVIVFDYVGSGQSDLESTKRYSSLEGY----------------------AKDVEEILVALDLVNVSIIGHSVSSIIAGIASTHVGDITMICPSPCFMNFPPDYVGGFERDDLEELINLMDKNTDPIVAKTFAKATFFSDYRSLLEDISTPALIFQSAKDSLASPEVGQYMAENIPN-SQLELIQAEGHCLHMTDAGLITPLLIHFIQN 272
36 -15.300d3bdia1 c.69.1.0 (A:1-206) automated matches {Thermoplasma acidophilum [TaxId: 273075]}  ali model 3D-neighbors follow..  17  6...........................................................EFIDVNGTRVFQRKMVTDSNR--RSIALFHGYSFTSMDWDKADLNYSKIGYNVYAPDYPGFGRSASSEKYGIDRG---------------------DLKHAAEFIRDLKANGVARSVIMGASMGGGMVIMTTLQYPDIVDGII--------------------------------------AVAPAWVESLKGDMKKIRQKTLLVWGSKDHVVPIALSKEYASIISGSR-LEIVEGSGHPVYIEKPEEFVRITVDFLRN 205
37 -15.200d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]}  ali model 3D-neighbors follow..  16  4.PTLDPELAAALTMLPKVDF--------ADLPNARATYDALIGAMLADLSFDGVSLRELSAPGLDGDPVKIRFVTPDNAGPVPVLLWIHGIGTAESSDPFCVEVARELGFAVANVEYR--------------------------APETTFPGPVNDCYAALLYIHAHAEIDPSRIAVGGQSAGGGLAAGTVLKAVPVAFQFLEIPELDDFVDTPLWHRPNAILSWKYYLGESYSGPEDPDVSIYAAPSRATDLTG----PTYLSTMELDPLRDEGIEYALLLQAGVSVELHSFPGTFHAVSERGAAEALTAIRRGLRS 317
38 -14.500d1vkha1 c.69.1.32 (A:1-261) Putative serine hydrolase Ydr428c {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  10  20........................................................................TFQEISQNTREAVIYIHGGAWNDPENTPNDFMDTESTVCQYSIEYR--------------------------SPEITNPRNLYDAVSNITRLVK--EKGLTNINMVGHSVGATFIWQILGLLQIVKRVFLLD--IYSLKELLIEYPEYDCFTRLAFPDGIQMYEEEPSRVMPYV----KKALSRFSIDMHLVHSYSDELLTLRQTNCLISCLQDSFKLYLDDLGLHNDV--KNGKVAKYIFDNI.. 260
39 -14.000d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]}  ali model 3D-neighbors follow..  10  13.......................................................................YRLLGAGKESRECLFLLHGSGVDET----TLVPLARR--TATLVAARG-----RIPQEDGFRWFERIDPTRFEQKSILAET---AFAAFTNEAAKRHGLNLDHATFLGYSNGANLVSSLMLLHPGIVRLAA--------------------------------------LLRPMPVLDHVPATDLAGIRTLIIAGAADETYGPFVLVTLLSRHGAEVDARIIP-SGHDIGDPDAAIVRQWLAG.... 208
40 -13.800d1ehya1 c.69.1.11 (A:3-294) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]}  ali model 3D-neighbors follow..  12  1..................................................IRRPEDFKHYEVQLPDVKIH------VREGAGPTLLLLHGWP-GFWWEWSKVIGPLAEHYDVIVPDLRGFGDSEKPDLNDLSK--------------------YSLDKAADDQAALLDALGIEKAYVVGHDFAAIVLHKFIRKYSKAAIFDPIQPDFGPVYFGLGHVHESWYEELEVHVDNCMKPDNIHGGFNYYRANIRPDAATMSDLPVTMIWGLGDTCVPYAPLIEFVPKYYSNYTMETIEDCGHFLMVEKPEIAIDRIKTAFR. 292
41 -13.800d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]}  ali model 3D-neighbors follow..  15  18............................................................................EDHGTGQPVVLIHGFPLSGHSWERQSAALLDAGYRVITYDRRGFGQSSQPTTG-------------YDYDTF-----------AADLNTVLETLDLQDAVLVGFSTGTGVSSYGTARIAKVAFLASLEPFLLGIVAAVKADRYAFYTGFFNDFYNLDENLGTRISEEAVRNSDFRADIPRIDVPALILHGTGDRTLPIENTARVFHKALPSAEYVEVEGAPHGLLWTHAEEVNTALLAFLA. 276
42 -13.700d2rhwa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]}  ali model 3D-neighbors follow..  15  26.............................................................................EAGNGETVIMLHGGGPGAGGWSNNVGPFVDAGYRVILKDSPGFNKSDAVVMDE------------------QRGLVNARAVKGL-----MDALDIDRAHLVGNAMGGATALNFALEYPRIGKLILMGPGGLGPSMFAPMPMEG-IKLLFKLYA-EPSYETLKQMLQVFLY-DVTARLGEIKAKTFITWGRDDRFVPLDHGLKLLWNID-DARLHVFSKCGHWAQWEHADEFNRLVIDFLR. 281
43 -13.600d4h0ca1 c.69.1.0 (A:1-207) automated matches {Dyadobacter fermentans [TaxId: 471854]}  ali model 3D-neighbors follow..  15  13...........................................................................VPVQRAKKAVVMLHGRGGT------------AADIISLQKVLKLDEMAIYAPQATNNSWYPYSFMAPVQQNQPALDSALALVGEVVAEIEAQ-GIPAEQIYFAGFSQGACLTLEYTTRNAKYGGIIAFTGGLIGQELAIGNYK-----------------------------------GDFKQTPVFISTGNPDPHVPVSRVQESVTILEDAVSQVVYPGRPHTISGDEIQLVNNTILK.... 207
44 -13.500d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]}  ali model 3D-neighbors follow..  16  10.........................................................ALTLDGPVG-PLDVAVDLPEPDVAVQPVTAIVCHPLSTEGGSMHN-ALRELGITVVRFNFRSVGTSA-----------GSFDHGDGEQD---------DLRAVAEWVRA--QRPTDTLWLAGFSFGAYVSLRAAAALEPQVLISIAPP---------------------------------------AGRWDFSDVQ--PPAQWLVIQGDADEIVDPQAVYDWLETLEQQPTLVRMPDTSH.................... 193
45 -13.300d2xuaa_ c.69.1.0 (A:) automated matches {Burkholderia xenovorans [TaxId: 266265]}  ali model 3D-neighbors follow..  13  2............................................................YAAVNGTELHYRIDGERHGNA-PWIV-LSNSLGTDLSMWAPQVAALSKHFRVLRYDTRGHGHSE------------------APKGPYTIEQLTGDVLGLMDTL------KIARANFCGLSMGGLTGVALAARHADLCNTAARIGSPEVWVPRAVKARTEGMHALARWFTADYMEREPVVLCEAIDAADLRPEAPGIKVPALVISGTHDLAATPAQGRELAQAIAGARYVEL--DASHISNIERADAFTKTVVDFLT. 259
46 -13.100d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]}  ali model 3D-neighbors follow..  15  41..................................................................DLIKIQIIRPKSTEKLPVVMTASPYHLGINDKANDLALFLTRGFASIYVAGVGTRSSDTSGDYQQIYSMTAVIDWLNGRARAYTSRKKTHEIKA--------SWANGKVAMTGKSYLGTMAYGAAGLELILAEAGISSWYNYYRENGLVRSPGGFPGEDLDVLALDRKSGDYNQFWHDRNYLI----TDKVKADVLIVHGLQDWNVTPEQAYNFWKALPEGHAKHAFLHRGAHIYMDFSETINAYFVAKLLD 378
47 -13.100d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]}  ali model 3D-neighbors follow..  18  18.............................................................................GDPADPALLLVMGGNLSALGWPDEFARLADGGLHVIRYDHRDTGRSTTRDFAAHP---------------YGFGELAADAVAVLDGW------GVDRAHVVGLSMGATITQVIALDHHDVAKRVSKWRILSGTGVPFDDAEYARWEERAIDHAGGVLAEPYAHYSLTLPPPSRAAELREVTVPTLVIQAEHDPIAPAPHGKHLAGLIPTAR-LAEIPGMGHALPSSVHGPLAEVILAHTR. 294
48 -13.100d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]}  ali model 3D-neighbors follow..  17  2...........................................................ICTTRDGVEIF------KDWGQGRPVVFIHGWPLNGDAWQDQLKAVVDAGYRGIAHDRRGHGHSTPVWDGY-------------DFDTF-----------ADDLNDLLTDLDLRDVTLVAHSMGGGVGRHGTGRLRSAVLLSAIPPVMIALKNGVLTERSQFWKDTAEFFSANRPGNKVTQCVDAFGYTDFTEDLKKFDIPTLVVHGDDDQVVPIDATGRKSAQIIPNAELKVYEGSSH.................... 252
49 -12.900d1r3da1 c.69.1.35 (A:2-263) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]}  ali model 3D-neighbors follow..  12  1....................................................................LSNQLHFAKPTARTPLVVLVHGLLGSGADWQPVLSHLARTQCAALTLDLPGHGTNPERHCDN-----------------------FAEAVEMIEQTVQAHVTSEVPVILVGYSLGGRLIMHGLAQGAFSRLIEGGHFGLQDQQWAQRFSQQPIEHVLSDWYQQAVFSSLNHEQRQTLIAQRSANLGSSVKLPIHYVCGEQDS---------KFQQLAESSSYSQVAQAGHNVHHEQPQAFAKIVQAMIHS 259
50 -12.900d4jnca1 c.69.1.11 (A:238-548) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  10......................................................................RVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPP----------------EIEEYCMEVLCKEMVTFLDKL------GLSQAVFIGHDWGGMLVWYMALFYPERVRAVANTPFIPANPNMSPLESIKANPVFDYQLYFQEPGVAEAELFKKSGFRGPLNWGRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHI-EDCGHWTQMDKPTEVNQILIKWLDS 307
51 -12.900d4f21a1 c.69.1.0 (A:1-222) automated matches {Francisella tularensis [TaxId: 177416]}  ali model 3D-neighbors follow..  13  4........................................................................ELMEPAKQARFCVIWLHGLGADGHDVSLDEIRFIFPHADIIPVTINM-----------GMQMRAWYDIKSLDANSLNRVVDVEGINSSIAKVNKLQGIASENIILAGFSQGGIIATYTAITSQR----LGGIMALSTY-------------------------------LPAWDNFKGKITSINKGLPILVCHGTDDQVLPEVLGHDLSDKLKVANEYKHYVGMQHSVCMEEIKDISNFIAKTFK. 221
52 -12.600d3wj1a_ c.69.1.0 (A:) automated matches {Sulfolobus shibatae [TaxId: 2286]}  ali model 3D-neighbors follow..  14  19.............................GKASVDEVRKIFRQLASAAPKAEVRKVEDIKIPGSETS-INARVYFPKAKGPYGVLVYLHGIGDVESYDPLCRAITNACNCVVVSVDYR--------------------------APEYKFPSAVIDSFDATNWIYNNLD--EMGIAIAGDSAGGNLAAVVALLSLDLKYQILIYPAVGEYSDGFFLTREHIEWFGSQYLR--SPADLLDFRFSPIIAQDLSGLP-----PALIITAEYDPLRDQGEAYARLLQAGVPVTSVRFNNVIH.................... 273
53 -12.500d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]}  ali model 3D-neighbors follow..  12  12............................................................................AGVAGAPLFVLLHGTGGDEN----QFFDFGAR--QATILSPVGD---------------------SEHGAARFFRRTGEGVYDMVDLERATGKMQAGPVIGLGFSNGANILANVLIEQPELFDAAV--------------------------------------LMHPLIPFEPKISPAKPTRRVLITAGERDPICPVQLTKALEESLKAQGGTVETVWHGHEIRSGEIDAVRGFLAAY... 202
54 -12.500d1fj2a1 c.69.1.14 (A:1-224) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  14  7........................................................................AIVPAARKATAAVIFLHGLGDTGHG-WAEAFAGIRSSHIKYICPHAPVRPVTLNMNVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFPQGPIGGANR---------------------------------DISILQCHGDCDPLVPLMFGSLTVEKLKTNVTFKTYEGMMHSSCQQEMMDVKQFIDKLL.. 221
55 -12.500d2xmza_ c.69.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}  ali model 3D-neighbors follow..  13  1....................................................................MTHYKFYEANVETNQVLVFLHGFLSDSR-TYHNHIEKFTDNYHVITIDLPGHGEDQSSMD-----------------------ETWNFDYITTLLDRILDKYKDKSITLFGYSMGGRVALYYAINGHI-LILESTSPGIKEEKLPLFQSQLELPVEIQHQIRQQRLSQSPHKMAKALRDYNLWPRLKEIKVPTLILAGEYDE--KFVQIAKKMANLIPNSKCKLISATGHTIHVEDSDEFDTMILGFLK. 262
56 -12.500d3u0va_ c.69.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  12  4........................................................................CIVSPAGRHSASLIFLHGSGDSGQGMWIKQVLNQDLTFQHIKI-IYPTAPPRSYTPMKGGISNVWFDRFKITNDCPEHLESIDVMCQVLTDLIDEEGIKKNRILIGGFSMGGCMAMHLARNHQDVAGVFALSSFLN----------------------------------KASAVYQALQKSNGVLPELFQCHGTADELVLHSWAEETNSMLKSTTKFHSFPNVYHELSKTELDILKLWILTKL.. 221
57 -12.400d2xdwa2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}  ali model 3D-neighbors follow..  14  3...................................................SDYQTVQIFYPSKDGTKIPMFIVHKKGDGSHPAFL--YGYGGFNISSVSRLIFVRHMGGVLAVANIRGGGEYGETWHKGGILAN---------------QNCFDDFQCAAEYLIKEGYTSPKRLTINGGSNGGLLVATCANQRPDLFGCVIAQVGVMDMLKFHKYTIGHA------WTTDYGCSDSKQHFEWLIKYSPLHNVDIQYPSMLLLTADHDDRVVPLHSIVGRSRKQNNPLLIHVDTKAGHGAGK................ 254
58 -11.600d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Thermoplasma acidophilum [TaxId: 2303]}  ali model 3D-neighbors follow..  13  13.....................................................................YIYYKLCKAPEEKAKLMTMHGGPGMSHDYLLSLRDMTKEGITVLFYDQFGCGRSEEP------------------DQSKFTIDYGVEEAEALRSKLFG-----EKVFLMGSSYGGALALAYAVKYQDVSGGLSSVPAIKKYGSSGSYENPEYQEAVNYFYHQHLLRPNEFTITGTIKDWDITDKISAIKIPTLITVGEYDE-VTPNVARVIHEKIAGSE-LHVFRDCSHLTMWEDREGYNKLLSDFIL. 287
59 -11.600d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]}  ali model 3D-neighbors follow..  15  5........................................................................LILQPAKPADACVIWLHGLGADRY------------DFMPVAEALQESLLTTRFVLPQAPTRPVTINGGYEMPSWYDIKAMLEVSAKMVTDLIEAQGIDASRIFLAGFSQGGAVVFHTAFIQGPLGGVIALSTYAPTFGDELELSASQQ------------------------------------RIPALCLHGQYDDVVQNAMGRSAFEHLKSTVTWQEYPM-GHEVLPQEIHDIGAWLAARL.. 217
60 -11.500d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  13...............................................................VQGQALFFREALPGSGQARFSVLLLHGIRFSSE-NLGTLHRLAQAGYRAVAIDLPGLGHSKEAAAPAP----------------------IGELAPGSFLAAVVDALELGPPVVISPSLSGMYSLPFLTAPGQLPGFVPVAPICTDKINAANY--------------------------------------ASVKTPALIVYGDQDPMGQTS--FEHLKQLPNHR-VLIMKGAGHPCYLDKPEEWHTGLLDFLQG 207
61 -11.400d4b6ga1 c.69.1.0 (A:3-275) automated matches {Neisseria meningitidis [TaxId: 122586]}  ali model 3D-neighbors follow..  13  13......................................................QVWAHHAQTLQCEMKFAVYLPNNPERPLGVIYWLSGLTCTEQNFITKQRYAAEHQVIVVAPDTSPRGEQPNDDAYDLGQSAGFYLNATEQPWAANYQ-MYDYILNELPRLIEKHFPTNGKRSIMGHSMGGHGALVLALRNQRYQSVSAFSPILSPSLVPWGEKA------FTAYLGKDR---------EKWQQYDANSLIQQGYQGMRIDQGLEDEFLPTEDFIETCRAANQPVDVRFHKGYDHSYYASFIGEHIAYHAAFLK. 273
62 -11.300d3w06a_ c.69.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}  ali model 3D-neighbors follow..  11  17..................................................................................ATIVLGHGFGTDQS-VWKHLVPHLVDDYRVVLYDNMGAGTT--------------------NPDYFDFDRYSNLEGYSFDLIAILEDLKIESCIFVGHSVSAMIGVLASLNRPDLIVMISASPRYVNDVDYQGGFEQEDLNQLFEAIRSNMRPDIALSVGQTIFQSDMRQILPFVTVPCHILQSVKDLAVPVVVSEYLHANLGCESVVEVIPSDGHLPQLSSPDSVIPVILRHIR. 264
63 -11.100d4v2ia_ c.69.1.0 (A:) automated matches {Thalassospira sp. [TaxId: 1485225]}  ali model 3D-neighbors follow..  13  1.PVLEPTTQKFINALSASGGPA-------YTLTPAEARDVLSGAQSGEIAKPAVDITDTTFAVGPTGATKVRIIRPQGTDRLPVIVYFHGAG------------WVMGDTGTHDRLVRELSVRANAAL---------VFVDYERSPEARYPVAIEQDYAVTKYVAEHSEVDPTRLAIAGDSVGGNMTAVVSLLAPDITAQVLFYPVTDEFANGPWLTKPAMDWFWNQYLPEGIDRTDPKITPIHATSEQLSGQA-----PALVITAENDVLRDEGEAYARLSQAGVDVTVTRYNGTIHDAAKGAIAQAGQYLHTALHG 315
64 -10.800d3faka_ c.69.1.0 (A:) automated matches {Uncultured bacterium [TaxId: 77133]}  ali model 3D-neighbors follow..  14  43.........................................................DIQVEQVTVAGCAAEWVRAPGCQAGKAILYLHG-GGYVMGSINTHRSMVGSQAAALLLDYR--------------------------APEHPFPAAVEDGVAAYRWLLD-QGFKPQHLSISGDSAGGGLVLAVL--LPMPASAIPISPWADSFKTRAEADPMVAPGGINKMAARYLNGADAKHPYASPNFANLKGLP-----PLLIHVGRDEVLLDDSIKLDA-KADGVKSTLEIWDDMIHPEGKQAIVRVGEFMREQWAA 297
65 -10.600d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]}  ali model 3D-neighbors follow..  12  24........................................................YLDDLPGYPGLRAH--YLDEGNSDAEDVFLCLHGEPTWSYLYRKMIPVFAESGARVIAPDFFGFGKSDKPV----------------DEEDYTFEFHRNFLLALIE------RLDLRNITLVVQDWGGFLGLTLPMADPRFKRLIITPSDLRLDQFMKRWAPTLTEAEASAYAAPFPDTSYQAGVRKFPKMVAISFWQNDWNGQTFMAIGMKDKLLGPDVMYPMKALINGCPEPLEIADAGHFVQEFGEQVAREALKHFAE. 308
66 -10.400d4wy5a_ c.69.1.0 (A:) automated matches {Rhizomucor miehei [TaxId: 4839]}  ali model 3D-neighbors follow..  13  8............VYAAAFAAMKERPPIHTLDLKVVRES-SEARQLAANIKLPEVIEEDKVVESDGKT-LKLTIVRPPGTQILPVLIFLHG-----------------GGFVFGSKYTHIK------RDLTVKANVVTVFVDYSLSPEAKFPTAIEEIYAAILWVRENASINAEALAVAGDSAGATLSAAVSIYAAAIKTQVLIYPATAKYESYKLFGNGDYIAEDLKFFSNAYLPAPASELNDKLATLELATKADLEGLPALLFTAESDVLRDEGEKYAQLAEAGVDVAAVRVLGAVHG................... 290
67 -10.100d3pi6a1 c.69.1.0 (A:25-319) automated matches {Pseudomonas aeruginosa [TaxId: 208963]}  ali model 3D-neighbors follow..  10  4..................................................FPVPNGFESAYREVDGVKLHY-----VKGGQGPLVMLVHGFG-QTWYEWHQLMPELAKRFTVIAPDLPGLGQSEPP------------------KTGYSGEQVAVYLHKLARQF-------DRPFDLVAHDIGIWNTYPMVVKNQRLVYMEAPIPDAR-IKSHASNTEVFSERLLDLYARSYAKPHSLNASFEYYRALNEELAKTRLQMPTMTLAG-GGHGGMGTFQLEQMKAYAEDVEGHVLPGCGHWLPEECAAPMNRLVIDFLSR 293
68 -10.100d4q34a_ c.69.1.0 (A:) automated matches {Parabacteroides distasonis [TaxId: 435591]}  ali model 3D-neighbors follow..  10  29.................................................................GDHAYVFYQKPVGARKYPLVF-AHGVGQFSKGREGFQNIFLRRRFCVYLVD-RGNAGRGTEGIWPDYFEGVQFKRDKETLDQYFRQMT-TDFEVYSDAYAALFDKIGPGVFIT--SQGGPVGWNTLLKTRNIKAIASYEPGGAVPFPEGQLPEEAKFITLSKKMEGIEVPMSVFMEYTKVPIV-IYYGDNLPETDERPELYEWTRRLRLMKIWAKMNDQGGDVTVIHLPENTHFPMSDLNNIEVEWLHTK... 318
69 -10.100d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]}  ali model 3D-neighbors follow..  18  7...................................................................HLYGLNLVFDRVGKGPPVLLVAEEA-------SRWPEALPEGYAFYLLDLPGYGRTEGPR--------------------------MAPEELAHFVAGFAVMMNLGAPWVLLRGLGLALGPHLEALGLRALPAEGVE.................................................................................................................. 110
70 -10.100d4nvra_ c.69.1.0 (A:) automated matches {Salmonella enterica [TaxId: 99287]}  ali model 3D-neighbors follow..  12  11............................................................IPGFALKDVRGLTVRVAIGGSGSPLVLLHGHP-QNHTTWRKVAPTLAQNHTVILPDLRGYGDSDKPTSDPAHRT-------------------YSKRTMAQDIVMLMDALGFSRFAFVGHDRGGRVGHRLALDYPDRVTFIDIAPTATMYALTDKSFATRYFWAFNEYLRCYQNPEMIHAICEDYR-DDAADTSARIRCPLQLLWGGLGTVGQLYNVVGTWKEKALNVQGEALP-CGHSPQEECPEYFIQKLQSFLHS 300
71 -10.000d2cb9a_ c.69.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  12  35.........................................................................................................................................LALQLNHKAAVYGFHFIEEDSRIEQYVSRITEIQPEGYVLLGYSAGGNLAFEVVQAMEQKGLEVSDFIIVDAYKKDQSITADTENDDSAAYLPEAVRETVMQKKRCYQEYWAQLINEGRIKSNIHFIEAGIQTETSGAMVLQKWQDAAEEGYAEYTGYGAHKDMGEFAEKNANIILNILD. 217
72 -10.000d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]}  ali model 3D-neighbors follow..  14  31.............................................................................NPNGKPAVFIHGGPGGGIS--PHHRQLFDPERYKVLLFDQRGCGRSRPHASLDNNTT---------------------HLVADIERLREMAGVE--QWLVFGGSWGSTLALAYAQTHPRVSEMVLRGIFTLRYQDGASRFFPEKWERVLSILSDDERKDVIAAYRQRLTSADPQVQLEAAKLPAVIVHGRYDMACQVQNAWDLAKAWP-EAELHIVEGAGHSYDEPGILHQLMIATDRFAG 313
73 -9.840d3r40a_ c.69.1.0 (A:) automated matches {Rhodopseudomonas palustris [TaxId: 1076]}  ali model 3D-neighbors follow..  12  5............................................................FPGFGSEWINSGRIFARVGGDGPPLLLLHGFP-QTHVMWHRVAPKLAERFKVIVADLPGYGWSDMPESDEQHTP-------------------YTKRAMAKQLIEAMEQLGHVHFALAGHNRGARVSYRLALDSPGRLAVLDILPTYEYWQRMNRAYALKIYHAVEHYRIAFADPMRRHVMYRAGAYADFEH-GNKIPVPMLALWGASGIAQSAATPLDVWRKWASDVQGAPIE-SGHFLPEEAPDQTAEALVRFFSA 297
74 -9.760d3wi7a_ c.69.1.0 (A:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}  ali model 3D-neighbors follow..  11  9........................................................AKAYDVPAFGLQIH------VEHGSGAPIVFLHGNPTSSY-LWRHIFRRLHGHGRLLAVDLIGYGQS-------------------SKPDIEYTLENQQRYVDAW-----FDALDLRNVTLVLQDYGAAFGLNWASRNPRVRAVAFFEPVLRNIDSVWFFLTPLAPEDLRQYQTPFPTPHSRKAILAGPRNLPVVNWLNTSDTPKLLLTFKPGFLLTDAIL-KWSQVTIRNLEIEAAGAGIHFVQEEQPETIARLLDAWLT. 288
75 -9.280d3stya_ c.69.1.0 (A:) automated matches {Lycopersicon hirsutum [TaxId: 283673]}  ali model 3D-neighbors follow..  10  4..................................................................................KHFVLVHAAFHGAWCWYKIVALMRSSGHNVTALDLGASGINPKQ------------ALQIPNFSDY--------LSPLMEFMASLP--ANEKIILVGHALGGAISKAMETFPEKISVAVFLSGLMPGPNIDATTVCTKAGSAVLGQLDNCVTYENGPTNPPTTLIAGPKFLATNVSVKRVFIVATENDALKKEFLKLMIEK-NPPDEVKEIEGSDHVTMMSKPQQLFTTLLSIAN. 255

FFAS is supported by the NIH grant R01-GM087218-01
8 3 0 3 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ginalski K, Grishin NV, Godzik A., Rychlewski L. Practical lessons from protein structure prediction. Nucleic Acids Res. 2005 Apr 1;33(6):1874-91.