current user: public



Announcement: our server is upgraded to a faster system. If you experience any issues during this period please let us know.

d1iura_
Query: d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]}, from SCOP175

Results of FFAS03 search in SCOP175
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .
# Score Template Links and tools%idFirst MHHHHHHLVPRGSILKEVTSVVEQAWKLPESERKKIIRRLYLKWHPDKNPENHDIANEVFKHLQNEINRLEKQAFLDQNADRASRRTFLast
1 -57.300d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors  100  1MHHHHHHLVPRGSILKEVTSVVEQAWKLPESERKKIIRRLYLKWHPDKNPENHDIANEVFKHLQNEINRLEKQAFLDQNADRASRRTF 88
2 -39.200d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  26  1.............AKQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKE-AEAKFKEIKEAYEVLQKRAAYDQYGHAAFEQ.. 75
3 -37.900d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  20  15..............KKDWYSILGADPSANMSDLKQKYQKLILLYHPDKQSADMEECMQKFIEIDQAWKILETKKKYDLQRSGPSSG.. 94
4 -25.500d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]}  ali model 3D-neighbors follow..  7...........RADKERLLELLKLPRQLWGDRMQQAYKQQSLLLHPDKGGS-----HALMQELNSLWGTFKYNLRMNLGGTGF..... 78
5 -24.500d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]}  ali model 3D-neighbors follow..  12  3..........MREESLQLMDLLGLERSAWGNLMRKAYLKKCKEFHPDKGGD-----EEKMKKMNTLYKKMEKYAHQPDFGGFWDATE. 79
6 -23.900d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]}  ali model 3D-neighbors follow..  23  33...............ETKWKPVGMADLVTPEQVKKVYRKAVLVVHPDKATGQEQYAKMIFMELNDAWSEFENQGQKPLY......... 98
7 -12.800d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  15  2................DYFTLFGLRYQLDTQALSLRFQDLQRQYHPDKSQAEQLAAVQQSATINQAWQTLRMRAEY............ 70
8 -6.510d1jkwa2 a.74.1.1 (A:162-287) Cyclin H (mcs2) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  13  82.....TCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLDRCHSAEL........................................ 124
9 -6.200d1lxja_ d.58.48.1 (A:) Hypothetical protein YB1001C {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  14  47...........TTIEGPWDDVMGLIGEIHEYGHEKGYVRVHTDIRVGTRTDKHQTAQDKIDVVLKKIS.................... 103
10 -6.000d1o17a2 c.27.1.1 (A:71-343) Anthranilate phosphoribosyltransferase (TrpD) {Archaeon Sulfolobus solfataricus [TaxId: 2287]}  ali model 3D-neighbors follow..  15  34VAKHGNRAVSGKSGSADVLEALGYNIIVPPERAKELVNKTAQYYHPLTNPANAKYSKDHLDLLSKSAYELDFNKIILVYGEPGID... 153

FFAS is supported by the NIH grant R01-GM087218-01
6 1 0 5 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Nika K, Tautz L, Saito K, Cerignoli F, Friedberg I, Godzik A, Mustelin T. Identification and characterization of DUSP27, a novel dual-specific protein phosphatase. FEBS Lett. 2007 May 29;581(13):2527-33. Epub 2007 Apr 30.