current user: public

Query: d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]}, from SCOP175

Results of FFAS03 search in SCOP175
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .
1 -52.500d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]}  ali model 3D-neighbors  100  1MDRVLSRADKERLLELLKLPRQLWGDFGRMQQAYKQQSLLLHPDKGGSHALMQELNSLWGTFKTEVYNLRMNLGGTGFQ 79
2 -36.800d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]}  ali model 3D-neighbors follow..  29  3.....MREESLQLMDLLGLERSAWGNIPLMRKAYLKKCKEFHPDKGGDEEKMKKMNTLYKKMEDGVKYAHQPDFGGFWD 76
3 -33.800d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  17  2.........KQDYYEILGVSKTAEERE--IRKAYKRLAMKYHPDRNQGEAKFKEIKEAYEVLTDSQKRAAYDQYGHA.. 71
4 -32.700d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  21  9...ALEQTLKKDWYSILGADPSANMSD--LKQKYQKLILLYHPDKQSAMQKFIEIDQAWKILGNEETKKKYDLQRSG.. 90
5 -26.500d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  12......GSILKEVTSVVEQAWKLPESE--RKKIIRRLYLKWHPDKNPENEVFKHLQNEINRLE---KQAFLDQNADR.. 82
6 -21.200d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]}  ali model 3D-neighbors follow..  19  31........AGETKWKPVGMADLVTPEQ--VKKVYRKAVLVVHPDKATGKMIFMELNDAWSEFENQGQKPLY........ 98
7 -21.000d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  20  2...........DYFTLFGLPARYQLDTQALSLRFQDLQRQYHPDKFASGSQAEQINQAWQTLRHPLMRAEY........ 70
8 -5.870d1a6qa1 a.159.1.1 (A:297-368) Protein serine/threonine phosphatase 2C, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  11  9.EAELDKYLECRVEEIIKKQGEGVPDLVHVMRTLASENIPSLPPGGELASKRNVIEAVYNRL................. 69
9 -5.840d1wgfa_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  13  33...............................EEKRRQLQEERPELS-ESELTRLLARMWNDLSEKKKA........... 68
10 -5.830d1ig6a_ a.4.3.1 (A:) MRF-2 DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  48YETITARRQWKHIYDELGGNPGSTSAATCTRRHYERLILPYE..................................... 89

FFAS is supported by the NIH grant R01-GM087218-01
8 0 3 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7.