current user: public

Query: d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]}, from SCOP175

Results of FFAS03 search in SCOP175
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .
1 -50.300d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors  100  1GVTKEIRIPTLEECDVCHGSGAKPGTQPQTCPTCHGSGQVQMRQGFFAVQQTCPHCQGRGTLIKDPCNKCHGHGRVERS 79
2 -22.100d1m1qa_ a.138.1.3 (A:) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella oneidensis [TaxId: 70863]}  ali model 3D-neighbors follow..  25  13............GCESCHKDGTPSADGAAQCQSCHGKLSEMDAVDGNLVCADCHAVHDMNVGQKPTCESCHDDGRTSAS 86
3 -22.000d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  35  5.............CKECEGRGGKKGA-VKKCTSCNGQGIKQMGPMIQRFQTECDVCHGTGDIIKDRCKSCNGKKVENE. 74
4 -12.300d3caoa_ a.138.1.1 (A:) Cytochrome c3 {Desulfovibrio africanus [TaxId: 873]}  ali model 3D-neighbors follow..  23  25..DEHNEKAGIESCNACHHVWVNGDSVGTPCSDCHALEQDGDTPGLQAYHQQCWGCHEKQAKGPVMCGECH........ 100
5 -11.000d1qo8a1 a.138.1.3 (A:2-102) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella frigidimarina [TaxId: 56812]}  ali model 3D-neighbors follow..  25  12...........GSCQSCHAKPIKVTDENAQCKSCHGEYAELANDK--LGDINCTSCHKGHEEPKFYCNECH........ 82
6 -10.900d1y0pa1 a.138.1.3 (A:1-102) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella frigidimarina [TaxId: 56812]}  ali model 3D-neighbors follow..  25  12...........QECDSCHTPDGELSNDNTQCVSCHGTLAEVAETSHFPGEVACTSCHSAHEKSMVYCDSCH........ 86
7 -9.920d1gyoa_ a.138.1.1 (A:) Cytochrome c3 {Desulfovibrio gigas, di-tetraheme cytochrome c3 [TaxId: 879]}  ali model 3D-neighbors follow..  18  29......AKHRNVSCVSCHHM-FDGCGDFQKCADCHIDRDDRSYERGFESEISCRGCHKAMKAKNEQLQGCH........ 104
8 -9.810d1ofwa_ a.138.1.1 (A:) Nine-heme cytochrome c {Desulfovibrio desulfuricans, ATCC 27774 [TaxId: 876]}  ali model 3D-neighbors follow..  22  223...........ILCATCH-HRSPLSLTPPKCGSCHTKEIDKANPG--AYHLQCMGCHDVARPRDTDCTTCHKA...... 290
9 -9.450d2cy3a_ a.138.1.1 (A:) Cytochrome c3 {Desulfovibrio desulfuricans, different strains [TaxId: 876]}  ali model 3D-neighbors follow..  26  42...........VECVQCHHEADGGAVKKCTTSGCHDSLEFRDKANAKAFHTQCIDCHKALKKDKKPCGKCHTTN..... 118
10 -8.950d1aqea_ a.138.1.1 (A:) Cytochrome c3 {Desulfovibrio desulfuricans, different strains [TaxId: 876]}  ali model 3D-neighbors follow..  18  35...........IACQQCHHTPDTYTIESCMTEGCHDNIKERTEISSVDSEKSCVGCHRELKRQGPSCNSCH........ 108

FFAS is supported by the NIH grant R01-GM087218-01
6 2 7 2 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Godzik A. VISSA: a program to visualize structural features from structure sequence alignment. Bioinformatics. 2006 Apr 1;22(7):887-8. Epub 2006 Jan 24.