current user: public




Query: d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]}, from SCOP206

Results of FFAS03 search in SCOP206
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .
# Score Template Links and tools%idFirst GVTKEIRIPTLEECDVCHGSGAKPGTQPQTCPTCHGSGQVQMRQGFFAVQQTCPHCQGRGTLIKDPCNKCHGHGRVERSLast
1 -51.100d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors  100  1GVTKEIRIPTLEECDVCHGSGAKPGTQPQTCPTCHGSGQVQMRQGFFAVQQTCPHCQGRGTLIKDPCNKCHGHGRVERS 79
2 -21.600d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  35  5.............CKECEGRGGKKGA-VKKCTSCNGQGIKQMGPMIQRFQTECDVCHGTGDIIKDRCKSCNGKKVENE. 74
3 -19.400d1m1qa_ a.138.1.3 (A:) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella oneidensis [TaxId: 70863]}  ali model 3D-neighbors follow..  24  10.........ESGGCESCHKDGTPSADGAAQCQSCHGKLSEMDAVDGNLVCADCHAVHDMNVGQKPTCESCHDDGRTSAS 86
4 -11.800d3caoa_ a.138.1.1 (A:) Cytochrome c3 {Desulfovibrio africanus [TaxId: 873]}  ali model 3D-neighbors follow..  23  25..DEHNEKAGIESCNACHHVWVNGDSVGTPCSDCHALEQDGDTPGLQAYHQQCWGCHEKQAKGPVMCGECH........ 100
5 -11.000d1qo8a1 a.138.1.3 (A:2-102) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella frigidimarina [TaxId: 56812]}  ali model 3D-neighbors follow..  25  12...........GSCQSCHAKPIKVTHENAQCKSCHGEYAELANDK--LGDINCTSCHKGHEEPKFYCNECH........ 82
6 -10.900d1y0pa1 a.138.1.3 (A:1-102) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella frigidimarina [TaxId: 56812]}  ali model 3D-neighbors follow..  25  12...........QECDSCHTPDGELSNDNTQCVSCHGTLAEVAETSHFPGEVACTSCHSAHEKSMVYCDSCH........ 86
7 -9.580d1gyoa_ a.138.1.1 (A:) Cytochrome c3 {Desulfovibrio gigas, di-tetraheme cytochrome c3 [TaxId: 879]}  ali model 3D-neighbors follow..  18  29......AKHRNVSCVSCHHM-FDGCGDFQKCADCHIDRDDRSYERGFESEISCRGCHKAMKAKNEQLQGCH........ 104
8 -9.400d2cy3a_ a.138.1.1 (A:) Cytochrome c3 {Desulfovibrio desulfuricans, different strains [TaxId: 876]}  ali model 3D-neighbors follow..  28  42...........VECVQCHHEADGGAVKKCTTSGCHDSLEFRDKAN--AFHTQCIDCHKALKKDKKPCGKCH........ 115
9 -9.320d2bq4a_ a.138.1.0 (A:) automated matches {Desulfovibrio africanus [TaxId: 873]}  ali model 3D-neighbors follow..  18  38...........AACQKCHHKWDGKSEIGGATEGCHADTTSFKAT---KSPMSCQGCHKEMKTAKKTCAQCH........ 113
10 -8.980d1aqea_ a.138.1.1 (A:) Cytochrome c3 {Desulfovibrio desulfuricans, different strains [TaxId: 876]}  ali model 3D-neighbors follow..  18  35...........IACQQCHHTPDTYTIESCMTEGCHDNIKERTEISSVDSEKSCVGCHRELKRQGPSCNSCH........ 108

FFAS is supported by the NIH grant R01-GM087218-01
8 5 6 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Slabinski L, Jaroszewski L, Rychlewski L, Wilson IA, Lesley SA, Godzik A. XtalPred: a web server for prediction of protein crystallizability. Bioinformatics. 2007 Dec 15;23(24):3403-5. Epub 2007 Oct 5.