current user: public

Query: d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}, from SCOP175

Results of FFAS03 search in SCOP175
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .
1 -89.800d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}  ali model 3D-neighbors  100  1PPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGVDPNIRTGVRTITTGSPITYSTYGKFLADGGCSGGAYDIIICDECHSTDATSILGIGTVLDQAETAGARLVVLATATP 136
2 -45.000d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]}  ali model 3D-neighbors follow..  19  4..DIFRKKRLTIMDLHPGAGKTKRYLPAIVREGLRTLILAPTRVVAAEMEEALRGLPIRYQTPAIRAEH-TGREIVDLMCHATFTMRSPIRVPNYNLIIMDEAHFTDPASIAARG-YISTRVEMGEAAGIFMTATP 141
5 -22.800d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  24  89...........CIVLPTGSGKTHVAMAAINELSTPTLIVVPTLALAEQWKERLGIFGEEYVGEFSGRIKEL--KPLTVSTYDSAYVNAEKLGNRFMLLIFDEVHHLPAES------YVQIAQMSIAPFRLGLTATF 205
6 -21.400d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  20  23.......ETNCLIVLPTGLGKTL-AEYRLTKYGGKVLMLAPTKPLVLQHAESFRRLFNLPPEKIVALTKAWARAKVIVATPQTILLAGRISLEDVSLIVFDEAHRAVGNYAYV-FIAREYKRQAKNPLVIGLTASP 166
7 -19.900d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  19  57......RKESFAATAPTGVGKTS-MSLFLALKGKRCYVIFPTSLLVIQAAETIRK-YAEKAGVGTENLIGYRNFKIVITTTQ-FLSKHYRELGHFDFIFVDDVDAKNVDKLLHLLGFHYDLKTEARGCLMVSTAT. 213
8 -17.400d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  23  39......SGKNLLLAMPTAAGKTLLAEMAMVRKGGKSLYVVPLRALAGEKYESFKKKIGLRIGISTGDYEHLGDCDIIVTTSEKLIRNRASWIKAVSCLVVDEIHLLDSEK-TLEILVTKMRRMNKALRVIGLSAT. 181
9 -15.600d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  16  108...........LLQGDVGSGKTVVAQLAIYEAGFQTAFMVPTSILAIQHYRRTVEKFNIHVALLIGATTPLRNGQIDVVIGTHALIQEDVHFKNLGLVIIDEQHR------FGVKQREALMNKGKMVDTLVMSATP 241
10 -13.500d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]}  ali model 3D-neighbors follow..  17  36.PLFLNDEYNIVAQARTGSGKTASFAIPLIENGIEAIILTPTRELAIQVADEIES-LKGNKNLKIPQIKALKNANIVVGTPGRIINRGTLNLKNVKYFILDEADEMNMGFIKDVEKILNACNKDKRILLFSATMPR 188
11 -13.500d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  19  50.....GVFRAAMLYGPPGIGKTTAAHLVAQELGYDILEQNASDVRSKTLLNAGVKNALDNMSVVGYFKHNEEAQNLN---------------GKHFVIIMDEVDGMSGGDRGGVGQLAQFCRKTSTPLILICN... 162
12 -13.100d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  14  158..AVALTRRISVISGGPGTGKTTTVAKLLAGERCRIRLAAPTGKAAARLTESLGKPLTDEQKKRIPEDASTLHRLLGAQPGSQRLRHHAGNPLHLDVLVVDEASMIDLP---MMSRLIDALPDHARVIFL...... 294
13 -13.000d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  16  80...........LVCGDVGFGKTMRAAFLAVDNHKQVAVLVPTTLLAQQHYDNFRDRFANWP-VRIEMISRFRSAKIDILIGTHKLLQSDVKFKDLGLLIVDEEHR------FGVRHKERIKAMRANVDILTLTATP 213
15 -12.800d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]}  ali model 3D-neighbors follow..  18  53..PAILEHRDIMACAQTGSGKTAAFQRYSKTAYPKCLILAPTRELAIQISQKFSLNTPLRSCVVYGGADT-MGCHLLVATPGRFIEKNKISLEFCKYIVLDEA---DRMLDMGFEPQIRKIPSGINRQTLMFSAT. 216
16 -12.400d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]}  ali model 3D-neighbors follow..  14  33.PGALRGESMV--QSQTGTGKTHAYLLPIMEK--QAVITAPTRELATQIYHETLKCLIGGTDKQKALEKLNVQPHIVIGTPGRIIREQALDVHTAHILVVDEADLM-----LDMGFITDVARMPKDLQMLVFSAT. 187
17 -12.200d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  14  35..PIALSGRDILARAKNGTGKSGAYLIPLLER--QAMVIVPTRELALQVSQICIQVSKHMGGAKV--MRLDDTVHVVIATPGRILKKGVAKVDHVQMIVLDEADKLSQDFVQIMEDIILTLPKNRQILLYSAT... 186
18 -11.900d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]}  ali model 3D-neighbors follow..  15  1......ERGIIIVFTGNGKGKTTGTAARAVGHGKNVGVVQFIKGTWPNGERNLLEPHGVEMATGFTWETQNREADTAACMAVWQHGKRMLADPLLDMVVLDELTYMVAYDYLPLEEVISALNARPGHQTVIITG.. 134
19 -11.900d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  17  46......EGHDVLAQAQSGTGKTGTFSIAALQR--QALMLAPTRELALQIQKALAFHMDIKVHACIGGTSGLRDAQIVVGTPGRVIQRRRFRTDKIKMFILDEADEM-----LSSGFKEQIYQLPPTTQVVLLSAT. 191
20 -11.800d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  2........RHVFLTGPPGVGKTTLIHKASERIGFDVVTLSGTRGPLSRVGLEPPPGKRCRVGQYVVDLTSFEQLALPVLRNAD-----CSSGPGQRVCVIDEIGKMELFSQLFIQAVRQTLSTPGTIILGTIPV.. 145
21 -11.600d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]}  ali model 3D-neighbors follow..  12  3..........IIITGEPGVGKTTLVKKIVERLGKRAIGFWTEEVRDPETKKRTGSSKFFTSKKLVGSYGVNVQYFEELAIPILERAYREAKKDRRKVIIIDEIGKMELFSKKFRDLVRQIMHDPNVNVVATIPIR. 140
22 -11.600d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]}  ali model 3D-neighbors follow..  16  35...........CLADDMGLGKTLQTIAVFSDAKKESLVICPLSVLKEEELSKFAPHLRFAVFHEDRSKIKLEDYDIILTTYAVLLRDTRLKEVEWKYIVIDEAQNIKNPQTKIFKAVKELKSKY----RIALTGTP 162
23 -11.600d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]}  ali model 3D-neighbors follow..  10  1.......NKVVVVTGVPGVGSTTLAMDNLRKEGVNYKMVSFGSVMFEVAKEE---------NLVSDRDQMRKMDPETQKRIQKMAGRKIAEMAKESPVAVDTHSTVSTPKGYLPGLPSWVLNELNPDLIIVVETTG 123
24 -11.100d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}  ali model 3D-neighbors follow..  18  2.........LIAIEGVDGAGKRTLLSGAFRAAGRSVATLAPQSVAADIAAEALHGEHGDLA------SSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDR.................................. 95
25 -11.100d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]}  ali model 3D-neighbors follow..  17  1......AMRQCAIYGKGGIGKSTNLVAALAEMGKKVMIVDPKADSTRLILMEMAAEAGTVEDLELEDVLKAGYGGVKCVESGNFLEEEGAYEDDLDFVFYD------LGDVVCGGFAMPIRENKAQEIYIVCSG.. 153
26 -11.000d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]}  ali model 3D-neighbors follow..  16  83...........IMADEMGLGKTLQCITLIWT---KVIVVSPSSLVPVAIDGGSKDEIDSKLVNFISQQGMRIPTPILIISYETFRLHAEVLHKKVGLVICDEGHRLKNSDNQTYLALNSMNAQRR----VLISGTP 230
27 -10.800d1yj5a2 c.37.1.1 (A:351-522) 5` polynucleotide kinase-3` phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  14  4PESSSPNPEVVVAVGFPGAGKSTFIQEHLVSAGYVHVNRD-------TLGSWQRCVSSCQAALRQGKRVVIDNTNPDVPSRARYIQCAKDAGVPCRCFNFC................................... 100
28 -10.700d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]}  ali model 3D-neighbors follow..  12  3........KIILTIGCPGSGKST-WAREFIAKNPGFYNINRDDYRQSIMAHEERDEYKYTKKKEGIVTGMQFDTAKSILYGGDSVKG----------VIISDTNLNPERR----LAWETFAKEYGWKVEHKVFDVP 115
29 -10.400d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  17  39......SGRDCLVVMPTGGGKSLQIPA-LLLNGLTV-VVSPLISLMKD-AACLNSTQTREQQLEVMTGCRTGQIRLLYIAPERLMLDNFLEH-NPVLLAVDEAHCISQ-----YAALGQLRQRFPTLPFMALTAT. 183
30 -10.200d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]}  ali model 3D-neighbors follow..  13  8........KTVAILGGESSGKSV-LVNKLAAVFNTTSAWEYGREFVFEKLGGDEQAM----------------SDYPQMALGHQRYIDYAVRHSHKIAFIDT.................................. 86
31 -10.100d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]}  ali model 3D-neighbors follow..  14  3........WIEFITGPMFAGKTAELIRRLHRADVKYLVFKP------KIDTRSIRNIQSRTGTSLPSVEVESAPEILNYIMSNSFND------ETKVIGIDEVQFFD............................. 92
32 -9.930d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  11  1.....RRGALIVLEGVDRAGKSTQLVEALCAAGHRAELLR--------------FPERSTEIGKLLSSYLQKKSDVEDHSVHLLFSANREKLSQGVTLVVDR-----AFSGVAFTGAKENFSLDWCKQPDVGLPKP 124
33 -9.900d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  12  36..........LLLYGPNGTGKKTRCMALLES-DVRQFVTASNRKLELNVVSS-PYHLEITPSDMGNNDRIVIQELLKEVAQMEQVDFQDSK-HRYKCVIINEANSLTKDAQAALRRTMEKYSKNIRLIMVCDSMS. 172
34 -9.880d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]}  ali model 3D-neighbors follow..  17  5........NILLLSGHPGSGKSTIAEALANLPGVPKVHFHSDDLWGYIKHGRIDPWLPQSHQQNRMIMQIAADVAGRYAKEGY--------------VILDGV................................. 86
36 -9.460d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]}  ali model 3D-neighbors follow..  15  2........KIGIVTGIPGVGKSTKVKEILDNQGINNKIIN----YGDFMLATALKLGYAKDRDEMRKLSVEKQKKLQIDAAKGIAEE--ARAGGEGYLFIDTHAVIRTPSGYLPGLPSYVITEINPSVIFLLEADP 126
37 -9.410d2axpa1 c.37.1.1 (A:2-165) Hypothetical protein YorR {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  20  1........TLIILEGPDCCFKSTVAAKLSKELKYPII................................................................................................... 29
38 -9.290d1ecfa1 c.61.1.1 (A:250-492) Glutamine PRPP amidotransferase, C-terminal domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  19  13PDSFIDKISVYSARVNMGTKLGEKIAREWEDLDIDVVIPIPSCDIALEIARILGKPYGFVKNRYVGRTFIMPGQQLRRKSVRRKLNANRAEFRDKNVLLVDDSIVRGTTS----EQIIEMAREAGAKKVYLASAAP 148
39 -9.020d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]}  ali model 3D-neighbors follow..  20  35.........MVYLNGDLGAGKTTLTRGMLQGIGHQGNVKSPTYTLVEEY....................................................................................... 74

FFAS is supported by the NIH grant R01-GM087218-01
6 5 8 1 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Doukhanina EV, Chen S, van der Zalm E, Godzik A, Reed J, Dickman MB. Identification and functional characterization of the BAG protein family inArabidopsis thaliana. Biol Chem. 2006 Jul 7;281(27):18793-801. Epub 2006 Apr 24.