current user: public




Query: d2f9wa2 c.55.1.13 (A:1-114) Type III pantothenate kinase, CoaX {Pseudomonas aeruginosa [TaxId: 287]}, from SCOP206

Results of FFAS03 search in COG0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110
# Score Template Links and tools%idFirst MILELDCGNSLIKWRVIEGAARSVAGGLAESDDALVEQLTSQQALPVRACRLVSVRSEQETSQLVARLEQLFPVSALVASSGKQLAGVRNGYLDYQRLGLDRWLALVAAHHLAKLast
1 -32.400[K] COG1521 Putative transcriptional regulator, homolog of Bvg accessory factor  ali follow..  17  1MILVIDVGNTNCTVGVYKEQKLLRHWRMTTDRHRTSDELGNLTPSDIQGIIISSVV-PPIMHAMETMCVRYFNIRPLIVGPGIKT-GLNLKVDNPREIGSDRIVNAVAASEEY. 121
2 -8.290[T] KOG4219 G protein-coupled receptor  ali follow..  11  42IVVTSVVGNVVVMWIILAHKRM----------------------RTVTNYFLVNLAFAEASMAAFNTVVNFYGLFYCKFHNFFPIAAVFASIYSMTAVAFDRYMAII....... 135
3 -7.980[C] COG2441 Predicted butyrate kinase  ali follow..  2ISAGIDPGTGSYDVVAIEDGKVVFRKNIPTEEVRASPDVIVEVIEESGAEVAAGLSGYGLPVKRFSELDEVDLLLMTLNFDSERAIGLRNIIKAVKERNVNLYT.......... 105
4 -7.180[S] COG4065 Uncharacterized protein conserved in archaea  ali follow..  13  25IVASVEVGNTTTKCILTATNMDTGRTHIINKIVRMTRDVRPPKSGEVRTLTGVELTRESVAELVKGTLTESLEKASLDIKTDVRSTGVVAGFDSPEEVG............... 130
5 -6.100[KG] COG1548 Predicted transcriptional regulator/sugar kinase  ali follow..  43.SLGIDIGGANLKVASKDGWEIIY--EAERLEGKLREIAEKYSTAKAGVVMTAELADKSRAEGVEFIAKACKKAFEDVRFLDVE-GNLKSDIDNPENFAASNWVASCR...... 153
6 -6.060[S] COG3744 Uncharacterized protein conserved in bacteria  ali follow..  14  1MKLLLDT----WLWWFTEPEKLNEDAIIIDETNEIWLSVASIWEMSIKTSIGKLPLPENIDDYILSRMVKLAEFLDIKTRHALQVATLPLHHRDP-----DRIIIAQAQTE... 108
7 -5.960[KG] COG1940 Transcriptional regulator/sugar kinase  ali follow..  47VRIGIDLGGTKTEVIALGDAGEQLYRH-RDDYRQTIETIATLVDMAEQATGQRGTVGMGIPGSISPYTGVVKNANSTWLNGQPFDKDLSARLQREVRLANDANCLAVS...... 158
8 -5.930[S] COG4020 Uncharacterized protein conserved in archaea  ali follow..  11  2TFIGVDHGTTAMRFALIEDEKVLTFELGRAEAAAMSEKEILAAIEREFGIRIGDIDLVALTYSMGDGFSAIKDVR------KLEGRGLQSIEGAGKKTGGGTRV.......... 99
9 -5.600[S] COG4457 Uncharacterized protein conserved in bacteria, putative virulence factor  ali follow..  17  247VDLILDVGNSHTCGILVEDHADESYGLNQTYELQLRDLSKPHYLYN-SRVEFAQAKFGQQSFSVESGREDAF---PSITRVGHEACRMSTGISSPRRYLWDEW........... 366
10 -5.360[I] COG1924 Activator of 2-hydroxyglutaryl-CoA dehydratase (HSP70-class ATPase domain)  ali follow..  10  320AFLGIDAGSTTTKVVLIDDEGNILYDHYGSNNGEPLESVINILKDVYAKL--VYIAKSTVTGYGEHLIKAGLHVDYGEVETMAHYKAADYFNPGVDFIGQD............. 425

FFAS is supported by the NIH grant R01-GM087218-01
8 5 9 5 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ma H, Xiong H, Liu T, Zhang L, Godzik A., Zhang Z. Aggregate formation and synaptic abnormality induced by DSCR1. J Neurochem. 2004 Mar;88(6):1485-96.