current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: gi|16763406|ref|NP_459021.1| hypothetical protein (STM0016) [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2] (Range: 1-177), from S.typhimurium

Results of FFAS03 search in NEW_HUMAN_DOMAINS
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .
# Score Template Links and tools%idFirst MNPIIDGIIALEGGYVFNPKDKGGATHWGITEATARAHGYAGDMRDLTHAEAYAILEEDYWIKPGFDVISTLSWPVSFELCDAAVNIGAYHPSAWLQRWLNVFNHEGKRYPDIHVDGNIGPRTLAALEHYLAWRGQEGEAVLVKALNCSQGTYYLNVAEKNHNNEQFIYGWIKNRVTLast
1 -6.360sp|P42695|CNDD3_HUMAN Condensin-2 complex subunit D3 OS=Homo sapiens GN=NCAPD3 PE=1 SV=2 (Range: 1-147)  ali follow..  10  15..........................................CPLDLRLEWVDTVWELDF-------ETEPLDPSIEAEIIETGLAAFTKLYESLLPFATGEHGSMESIWTFFIENNVSHSTLVALFYHFVQIVHKKNVSVQYREYGLHAAGLYFLLLEGSVANQVFHPVMFDKCIQ 145
2 -5.870sp|Q8N6G2|CM026_HUMAN Uncharacterized protein C13orf26 OS=Homo sapiens GN=C13orf26 PE=2 SV=1 (Range: 105-289)  ali follow..  11  28........................................MKEVNKALSNQFISLTKRDFVDRSKAQKIKKSSHLLLPQPPDTEFRRNYQIPAKIPELQDFSFKYGCYSSLPVASQGLVPSVLHSYLRNQEHTKKQTDFLMLLNSFTSSQVKEYLQSLSYKDRQ............. 168
3 -5.410sp|Q658Y4|F91A1_HUMAN Protein FAM91A1 OS=Homo sapiens GN=FAM91A1 PE=1 SV=3 (Range: 1-299)  ali follow..  13  98YTGIMEDIMNSEKSYDSLPNFTAADC-LGIGRRSSKKFFRRKTARDLLPIKPVEIAIEAWWVVQAGYITEDDIKICTLPAVDKIIDSGPQLSGSLDYNVVHSLYNKGFIYLDVPISD--SCIAVPPLEGFVMNRVQGDYFETLTNVAELANVLEIDLSLVKNAVSMYCRGFAHKK.. 298
4 -5.310sp|Q8TF40|FNIP1_HUMAN Folliculin-interacting protein 1 OS=Homo sapiens GN=FNIP1 PE=1 SV=3 (Range: 331-473)  ali follow..  3............................GVIFSLSKDEDENNKFNEFFFSHFPLF-----------SHMNKLKSAIEQAMKMSRRSADASQRSLAYNRIVDALNEFRTTICNLYTMPRIGEPVWLTMMSGTPEKNHLCYKEFTFLMENASKNQF--LPALITAVLTNHLAWVPTVMP 142
5 -5.140sp|Q6ZS81|WDFY4_HUMAN WD repeat- and FYVE domain-containing protein 4 OS=Homo sapiens GN=WDFY4 PE=1 SV=3 (Range: 1961-2094)  ali follow..  10  1....................................................................ISCFTQKLVEKLYSGMFSADPRHILLFILEHIMVVIETASSQRDTVLSTLYSSLNKVILYCLSKPQQSLSECLGLLSILGFLQEHWDVVFATYNSNISFLL........ 101
6 -5.000sp|Q9P2J5|SYLC_HUMAN Leucyl-tRNA synthetase, cytoplasmic OS=Homo sapiens GN=LARS PE=1 SV=2 (Range: 1058-1176)  ali follow..  16  11...................................................................SVSLVNPQPSNGHFSTKIEIRQGDNCDSIIRRLMKMNRGIKDLSKVKLDPLLGPRRVPVLGKEYTEKTPISEHAVFN................................. 91
7 -4.910sp|O43823|AKAP8_HUMAN A-kinase anchor protein 8 OS=Homo sapiens GN=AKAP8 PE=1 SV=1 (Range: 1-100)  ali follow..  10  9............GAWSAGPANTQGAYGTGVASQGYENYNYYGAQNTSVTTGATYSYGPASWEAAKANDGGLAAGAPAMHMASYGPEPCTDNSDSLIAKI.............................................................................. 96
8 -4.890tr|Q5JUQ2|Q5JUQ2_HUMAN Family with sequence similarity 78, member A OS=Homo sapiens GN=FAM78A PE=2 SV=1 (Range: 107-226)  ali follow..  14  8...........QEGKIQAISDSDGVNYYGNTTETCTIVGPTKRDSKFIISMNDNFYPSVTWAVPNVAKLTNIYRDQSFTTWLVATNTSTNDMI-----ILQTLHWRMQLSIEVNPNRPLGQRA...................................................... 120
9 -4.550sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=1 (Range: 138-387)  ali follow..  11  8VENIELKIQDVHLRFEDGVTNPSHPFAFGICIKNVSMQNAVNEVQKLMRKKQLDVAEFSIYWDVDCTLLGDLPQMELQEAMARSMESEPVFASALLKRNCSKKPLRSRHSPRIDCD-----IQLETIPLKLSQLQYRQIMEFLKELERKERQVKFRRWKPKVAISKNCREWWYFALN 187
10 -4.440sp|Q9HCU5|PREB_HUMAN Prolactin regulatory element-binding protein OS=Homo sapiens GN=PREB PE=1 SV=2 (Range: 1-91)  ali follow..  18  25.....TGLLIAAGG--------GGAAKTGI----------KNGVHFLQLELINGRLSASLLHSHDTETRATMNLALAGDILAAGQDA.......................................................................................... 88

FFAS is supported by the NIH grant R01-GM087218-01
1 1 0 2 4 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Nika K, Tautz L, Saito K, Cerignoli F, Friedberg I, Godzik A, Mustelin T. Identification and characterization of DUSP27, a novel dual-specific protein phosphatase. FEBS Lett. 2007 May 29;581(13):2527-33. Epub 2007 Apr 30.