current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: gi|15922992|ref|NP_370526.1| DNA polymerase III subunit beta (SAV0002) [Staphylococcus aureus subsp. aureus Mu50], from S.aureus

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .
# E-value Template Links and tools%idFirst MMEFTIKRDYFITQLNDTLKAISPRTTLPILTGIKIDAKEHEVILTGSDSEISIEITIPKTVDGEDIVNISETGSVVLPGRFFVDIIKKLPGKDVKLSTNEQFQTLITSGHSEFNLSGLDPDQYPLLPQVSRDDAIQLSVKVLKNVIAQTNFAVSTSETRPVLTGVNWLIQENELICTATDSHRLAVRKLQLEDVSENKNVIIPGKALAELNKIMSDNEEDIDIFFASNQVLFKVGNVNFISRLLEGHYPDTTRLFPENYEIKLSIDNGEFYHAIDRASLLAREGGNNVIKLSTGDDVVELSSTSPEIGTVKEEVDANDVEGGSLKISFNSKYMMDALKAIDNDEVEVEFFGTMKPFILKPKGDDSVTQLILPIRTYLast
1 0.000e+00gi|504120434|ref|WP_014354420.1| DNA polymerase III subunit beta [Acetobacterium woodii]  clstr ali  35  1.MKFNCSKESLMAALTIAQKAVSSKTTLTILEGILFSAADNKLLLRSTDLEIGVEVTIPAE--------VEKEGEIVLTASIIGELIRKMSGSDIFFESNENHQIKIECLLSNFTLKGLSSEEFPAFPEIIDDHIFSIDAGVLKELIKGTLFSVATNENIPVLTGVKIELHADDINLIALDGYRLALKSGKIKNNTEDLSVIIPSKSLSEINKVLSNYSGDVTVKFSKNQIFFEMDNTQFTSRLLEGDFINYKQIIPVEKATQVKINRRLLLESSERAALLAREGKNNLIKMDFNQDQLILTSN-ADIGDVFEVIPIEN-SGESLKIAFNSKFLIEALRVIEGDELMIDMTTSVGPGVLLPIEGNNFIYLILPVR.. 365
2 0.000e+00gi|551037519|ref|WP_022781259.1| DNA polymerase III subunit beta [Lachnospiraceae bacterium NK4A136]  clstr ali  34  1.MKIVCSKSELVNGVNIVSKAVPANTTMSILECILIDASKGEIKFTSNDTEIGIETVVDGT--------IEEKGTIAIDAKMLLEVVRKLPDADITIATDDNFSTNITCGKLKFNIMGKDGKDFTTLPTVNKKDAVIISQLTFKDIIRQTIFSIGVNESNKVMSGIHLVIKEDELKMTSLDGHRVSIRKVKLKDKYEAKEIIIPGKTLSEVSKILSGGDDDISIYIEDNYVLFEFGKSIVVSRLIEGKYFAVDKMMSYDYETKVTISKKALYDCIDRSMLFSKEGNKKPIVVNIHDNVLEILVNSP-LGSMDEELEMTK-QGKDITIGFNPKFVIDALKVIDDETVDLYFVNAKAPCYIKD-ENDNYIYFVLPV... 363
3 0.000e+00gi|446503278|ref|WP_000581132.1| DNA polymerase III subunit beta [Streptococcus agalactiae]  clstr ali  38  1MIHFSINKNFFLHALTVTKRAISHKNAIPILSTVKIEVTRDAIILTGSNGQISIENTIPASNENAGLL-VTNPGSILLEAGFFINIISSLPDVTLEFTEIEQHQIVLTSGKSEITLKGKDVDQYPRLQEMTTDTPLTLETKLLKSIINETAFAASQQESRPILTGVHLVISQNKFKAVATDSHRMSQRTFQLEKSANNFDLVVPSKSLREFSAVFTDDIETVEVFFSDSQMLFRSENISFYTRLLEGNYPDTDRLLTNQFETEIIFNTNALRHAMERAYLISNATQNGTVRLEIQNETVSAHVNSPEVGKVNEELDTVSLKGDSLNISFNPTYLIESLKAVKSETVTIRFISPVRPFTLTPGEDEDFIQLITPVRT. 377
4 0.000e+00gi|655969733|ref|WP_029012325.1| DNA polymerase III subunit beta [Niveispirillum irakense]  clstr ali  29  1.MKITIERAALLRSLGHVQSVVERRNTIPVLSNVLLRAENGELSLTATDMDLEIVESVPA--------DIARPGSATAPAHTLYDIARKLPDGQVELDAT-GDVLTLRSGRSNFKLGTLPVDDFPQMTQGDLPHRFSLTAAALKGLIDKTKFAISTEETRYYLNGIYVHATKPKLRAVATDGHRLARVEVTLPEGAEAVGVIIPRKTVLEVRKLLDEAADSIEVQLSETKVRFTFDSITLTSKLIDGTFPDYERVIPAGNDKTLEVDAKLFAAAVDRVATISTEKSR-AVKLALAQGVLTLSANSPDAGSAMEEIEVAYEQG-GLEIGFNSRYLLDITSQIESGTAKFQMADSGSPTIVRDAADNSALYVLMPMR.. 371
5 0.000e+00gi|1002494938|gb|KXT76112.1| DNA polymerase III beta subunit [Streptococcus sp. DD12]  clstr ali  38  1MIQFSINKAFFLQALNTTKRAISTKNAIPILSTIKLEVKQDSLTLTGSNGQISIENTL-LTSQEDAGLLVEQSGSILLEANFFINVVSSLPDVTLNFTEIEQEQVVLTSGKSEITLKGKDADQYPRLQEMATTQPLILETRLLKDVITETAFAASTQESRPILTGVHFVLSDKTFKAVATDSHRLSQRQLELDDISDNFDVVIPSRSLREFAAVFTEQIEHVEVFLSTSQILFRSENISFYSRLLEGNYPDTDRLLSNAFETEVVFKTQTLLHAMQRAQLVSNASQNGTVKLEIVSGQVSAHVNSPEVGKVNEDIDTQSLTGADLTISFNPSYLIDALKALKAEEVSIKFLSALRPFTLVPAGEEDFIQLITPVRT. 377
6 0.000e+00gi|500777774|ref|WP_011994918.1| DNA polymerase III subunit beta [Parvibaculum lavamentivorans]  clstr ali  27  1.MKITIERGALLKSLNHVQSVVERRNTIPILSNVLIKAEDGQLSLTATDLDIEVVEAIDA--------DVAQPGATTASAHTLYDIVRKLPEGQVELSTGDEGRLQLTAGRSRFALQSLPQEDFPVMAAGSLPHRFELPAEAMRRLIDKTRFAISMEETRYYLNGIYFHAVDGSLRAVATDGHRLAQVDHDLPEGAAGMGVIVPRKTVLELQKLLEGNSGALSVGVSETKIRFEFGGIVLTSKLIDGTFPDYGRVIPVGNDKMLQVDGKRFAEAVDRVSTISTEKSR-AVKLNIEEGKLTLSVTNPDSGSATEELSV-SYSSPAIEIGFNARYLLDITGQLDGAEASFAFADSGSPTLVRDSEDSMAVYVLMPMR.. 371
7 0.000e+00gi|78101467|pdb|2AWA|A Chain A, Crystal Structure Of Dna Polymerase Iii, Beta Chain (Ec 2.7.7.7) (Np_344555.1) From Streptococcus Pneumoniae Tigr4 At  clstr ali model  40  16...FSINKNLFLQALNTTKRAISSKNAIPILSTVKIDVTNEGITLIGSNGQISIENFISQKNEDAGLL-ITSLGSILLEASFFINVVSSLPDVTLDFKEIEQNQIVLTSGKSEITLKGKDSEQYPRIQEISASTPLILETKLLKKIINETAFAASTQESRPILTGVHFVLSQKELKTVATDSHRLSQKKLTLEKNSDDFDVVIPSRSLREFSAVFTDDIETVEIFFANNQILFRSENISFYTRLLEGNYPDTDRLIPTDFNTTITFNVVNLRQSXERARLLSSATQNGTVKLEIKDGVVSAHVHSPEVGKVNEEIDTDQVTGEDLTISFNPTYLIDSLKALNSEKVTISFISAVRPFTLVPADDEDFXQLITPVRT. 389
8 0.000e+00gi|737656476|ref|WP_035626274.1| DNA polymerase III subunit beta [Lachnospiraceae bacterium C6A11]  clstr ali  32  1.MRIKCKKSDLSAGISTVSKAVSNKTTMPILQCILVEAAGGRIKLIANDLELGIETYIEGT--------ILEEGKIALEAKFFSDIVRKLPDSEIDIETNSDYKTTVYCEKTKAVVPCRSGEDFSYLPTIEKEKSITISQMTLRDVIRQTIFSISDNENTRLMTGEYFKVENNTLTVVSLDGHRISMRNIALKGDNPDVKVVIPGKSLQEVSKIISGEDDEITIFFSDNHVLFEFGDTRVVSRLIEGEYFKISQMLSIDHKIVVKADKKELMAIIDRASIFIQETDKKPIVVSVKDNNMYLRVDT-NIGSLNEELEISK-EGDEIIIGFNPKFLMDALRVIDDDNVSIYMYDSKSPCIIKDAE-ETYIYIILPI... 364
9 0.000e+00gi|523985302|emb|CCX72251.1| dNA polymerase III subunit beta [Firmicutes bacterium CAG:555]  clstr ali  32  1.MKLTCEKYLLQSAVAVSTRAAASKSPIPTLEGILLEAGED-LRVTGYDLKKGIYTNIEAE--------VSEPGSVVLDAKLFGEMVRKMPDGIVSIVTDSQNMTTVKCGKSEFSFMGMDSGEYPELPSVDGLKTYTINQGVLKSMINQSIFAVSDNDARPVYTGSMFEVENGILTLVSVDGYRLALRREAIEGPAEHNEFIVPGAALSDLERIAPDSEETVRISVGGNHVSFTVGKTVIVSRRLEGDFLNYKKALPEVFKLQIKVNRSEILRATDRVVLIVDEKTKNPVRMTFNEGFIDFRCTTP-IGKAEDVCFCEG-NGEGMEIGFNGKYLMDALKAAPADELIVCLNTSSSPCVILPADGDKFKFMILPIR.. 365
10 0.000e+00gi|551043488|ref|WP_022787058.1| DNA polymerase III subunit beta [Clostridiales bacterium NK3B98]  clstr ali  31  1.MKFSCEKALLQSAISFSSHAVAVKSSIPALEGLLVEARESEIRITGYDLKTGIRTVIPAS--------VQETGVMVLSTRLFGEIVRRMPDDMVTISTN-RFTVNLQCGMSDFNIQGIDPGEYPELPAVEYMNTFRIKQSDLKDMIDRTSFAISQSDARPVHTGALFEIEDNRLTMVAVDGYRLALRREEVSTGAEHFLFVVPGAALREVQRMCADGEQDMEVVQGERHVMFKNGDVTLITRRLEGEFLNYKKAVPSTASIRVTADTRQLTESIERCSLLISEQQKAPLRCTFEEGFVDIKTATP-LGTASDRCPIVG-SGGGLEIGFNNKYMLDALKAVPTSSVYLSMNTAVSPCVITGGGEDAFTYMVLPVR.. 373
11 0.000e+00gi|652440007|ref|WP_026835045.1| DNA polymerase III subunit beta [Eubacterium xylanophilum]  clstr ali  31  1.MKFTCNKNDINNSLDIVLKAVPSKTTMPVLECVVIETLDDSIKLTTNDMSLGIEARFEAS--------IEEKGIILVNAKMLFDIIRKLPNESLSFEADENNNILIFCGKSKFNIMGMDHEEFPLLPTIDKSNKITISQFTLREMIKQTIFSISNNESNKIYTGELFEISGDNIKITSLDLHRASIRNNSLKESFDDIKSVIPGKTLNEVVKILNGGDDEVEIYFTNNHVLFEIPNIIIISRLIEGNFYNVNQMINNDYEIKVKVSKRELLESIDRATLLLRESENKPVIMNIVGNEIKMEMNT-KIGSMDENIVIEK-EGKDLRIGFDPKFFIDALKVIDDEYVDLYFCNAKSPCFIK--DENSYIYMILPVK.. 363
12 0.000e+00gi|524469276|emb|CDC09929.1| dNA polymerase III subunit beta [Clostridium sp. CAG:413]  clstr ali  32  1.MKVICNSIELSEACQNVQRAASTKTAIPAIEGILMVAENNILTLTGYDLEMGITTSIPA--------RIEEEGQLVLNAHMFSETLRKLPGSTVSIDSDSRQIASISSGEFESTLIGISAEEYPELPSVSGGYTVTLNQGILKDMVRKTIFSVAIKDSKIVHTGIKFEIEKNHIRLIAVDGVRLAIRNENIEYDGEELSFVVPAKTLSEVVKLMDDDDADIVISVGKRHIVFEIGSYNIISRLLDGEFLNYKAAIPPSTKTVVSVDTKSFLESIDRTSLIITDKIKSPVKCVFADGMIKISSMTS-LGSANDKLSA-DIEGESCTIGFNNKYMIEALRVCDTDEIKIKLNGAIAPILLVPAEGDSFIFLILPVR.. 364
13 0.000e+00 [EC:2.7.7.7][KEGG:K02338] DNA polymerase III subunit beta;|[COG0592] DNA polymerase sliding clamp subunit (PCNA homolog)  ali  39  1MIKFSINKSFFLQALNATKRAISTKNAIPVLSTIKIEVQNSNITLTGSNGQISIENTIPTSNENAGLL-ITSTGAVLLEANFFINIVSSLPDVTLDFEEIEHHQIVLTSGKSEITLKGKDVDLYPRLQEMATENPLVLETKLLKSIIAETAFAASLQESRPILTGVHMVLSDHKFKAVATDSHRMSQRKLTLENTSNDFNVVIPSKSLREFAAVFTDDIETVEVFFSDSQMLFRSDYISFYTRLLEGNYPDTDRLLTNAFETEVTFNTNALRSAMERAHLISNATQNGTVKLEIANNSVSAHVNSPEVGKVNEELDTIDQSGNDLTISFNPTYLIEALKALKSETVVIRFISPVRPFTLMPGDDENFIQLITPVRT. 377
14 0.000e+00gi|938274976|gb|KPQ09974.1| DNA polymerase III beta subunit DnaN [Rhizobiales bacterium HL-109]  clstr ali  26  1.MKVTVERAALLKALGHVHRVVERRNTIPILSNVLLRADDGGLRLKATDLDMEVTETIVAE--------ITQPGATTVPAHVIYDIVRKLPDGQISLEVSDSTQMVLRSSRSRFTLQALPETDFPDIAAGEMGHAFAVPPGDFKRLIEKTQFAISTEETRYYLNGIYLHAIDGVLRAVATDGHRLARVEVPAPEGTTGMGVIVPRKAVAEILKLLEDSGDAIQVELSAAKIRLNFGGVVLTSKLIDGTFPDYQRVIPAGNDKTLIVDRDEFARSVDRVSTISSERGR-AVKLSLADGRLTLTVNNPDSGSATEEIEV-EYEAAALDIGFNARYLLDIMGQLGGDTAILKLADPGSPTLIQDREGAVALYVLMPMR.. 371
15 0.000e+00gi|809266011|emb|CEJ15598.1| DNA polymerase III subunit beta [bacterium YEK0313]  clstr ali  26  1.MKVTVERAQLLKSLGHVHRVVERRNTIPVLSNVLMRAEGQQLRLKATDLDIEVVESLPAE--------VGQSGGTTVPAHMIYDIVRKLPDGQVVIEVGDKGTLAVRAGRSRFTLQTIPESDFPDIAAGEMSHSFALPAKDLKRLIDKTQFAISTEETRYYLNGIYLHTVDKAIRAVATDGHRLAQVEFEAPQGSAGMGVIVPRKTVAEVQRLADDPDVAVSVELSTAKIRFRFGETVLTSKLIDGTFPDYARVIPLGNDKTLTVDKSEFSAAVDRVSTVSSERGR-AVKLSAGDGKLTLSVTNPDSGSATEELEV-SYEADAIDIGFNSRYLLDITSQVDGDTIELKLADPGSPTLIQDPTGPDALYVLMPMR.. 371
16 0.000e+00gi|518233621|ref|WP_019403829.1| MULTISPECIES: DNA polymerase III subunit beta [Chelatococcus]  clstr ali  29  1.MKVTVERAALLKSLGHVHRVVERRNTIPILSNVLLRAESGMLHLKATDLDLEVTEALAA--------DVEMAGATTVPAHVLYDIVRKLPDGQVSLETGDTSQMLIRSGRSRFTLQALPESDFPDIAAGEMPHRFTLPAGELKRLIDKTQFAISTEETRYYLNGIYLHIESNVLRAVATDGHRLARVETAAPEGSAGMGVIVPRKAVAEVQKLLEDAEAQASVELSPSKIRLSIGSVVLTSKLIDGTFPDYQRVIPAGNDKQLVVERVSFAAAVDRVSTISSERGR-AVKLALADGRLTLSVTNPDSGSATEEIEV-DYEADALDIGFNARYLLDITAQLDGDTALFKLADPGSPTLIQDREGASALYVLMPMR.. 371
17 0.000e+00gi|517182257|ref|WP_018371075.1| DNA polymerase III subunit beta [Streptococcus massiliensis]  clstr ali  39  1MLNFSINKNFFLHALTITKRAISHKNAIPILSTVKIEVSQEGMTLIGSNGQISIENFISVKDENAGLL-VNEIGGILLEATFFINVVSSLPDVTLDFKEIEQKQVVLVSGKSEITLKGKDIDQYPRIQEVAPTTPLTLPTSLLKEVINQTAFAASTQESRPILTGVHFVLTDNQLKAVATDSHRMSQKKLSLEQNGDNFDVVIPSRSLREFTAVFTDDIESVDIFFANNQLLFKSENISFYTRLLEGNYPDTDRLIPRDFSSVVTFDTDNLRHSMERARLLSNATQNGTVKLEIAKGIVSAHVNSPEVGRVNEEIDTETISGNDLTISFNPTYLIEALKAIDSEKVTISFISAVRPFTLVPSEDENFIQLITPVRT. 377
18 0.000e+00gi|516919526|ref|WP_018165995.1| DNA polymerase III subunit beta [Streptococcus minor]  clstr ali  40  1MIHFSINKAVFIQALNTTKRAISHKNAIPVLSTIKIEVNNEGIGLTGSNGQISIEHFISVQDDNAGLL-ISSTGSILLEASFFINVVSSLPDIVLDLKEIEQKQVLLTSGKSEITLKGKEAELYPRLQEVVKTKPLLLETKLLKDIINETAFAASTQESRPILTGVHFVLTDNQLKTVATDSHRMSQRKIQLAKDGDNFDVVIPSRSLREFAAVFSDEIETVEVFFSNNQMLFRSQHISFYTRLLEGTYPDTDRLIPTAFNTTVTFDTANLRHAMERARLLSNATQNGTVKLEIQKGIVSAHVHSPEVGKVNEELDILAVDGEDLIISFNPTYLIDALKAVGNEQVKISFISPIRPFTLVPAEGEDFIQLITPVRT. 377
19 0.000e+00gi|321142799|gb|EFX38259.1| DNA polymerase III, beta subunit [Streptococcus parasanguinis ATCC 903]  clstr ali  39  3MINFSINKTLFLQALNTTKRAISSKNAIPILSTIKIDVTPEGVALSGSNGQISIENFISIKDENAGLL-VTSPGSILLEATFFINVVSSLPDVTLDFKEIEQKQVLLTSGKSEITLKGKDADQYPRIQEIAASNPLVLETKLLKQLINETAFAASVQESRPILTGVHFVLSDNKLKTVATDSHRMSQKVITLEKNGDNFDVVIPSRSLREFTSVFSDDIETVEVFFANNQILFRSEHISFYTRLLEGNYPDTDRLIPTEFNTEATFNVANLRFAMERARLLSNATQNGTVKLEFKNGVVSSHVHSPEVGRVNEEIDTSAVSGEDLSISFNPTYLIEALKAIDSEQVVIRFISSVRPFTLVPEGNEQFIQLITPVRT. 379
20 0.000e+00gi|489193668|ref|WP_003103000.1| DNA polymerase III subunit beta [Streptococcus parauberis]  clstr ali  40  1MIQFSINRSLFIQALNATKRAISSKNAIPILSTIKIEVNQENITLTGSNGQISIENTIPVSNENAGLL-ISSTGSILLEANFFINIISSLPDVSLDFKEIEQHQVVLTSGKSEITLKGKDVEQYPRLQEVSTDNPLVLETKLLKSIISETAFAASLQESRPILTGVHITLSNNKFKAVATDSHRMSQRLLSLEKSANNFDVVIPSKSLREFSSVFGDDIETVEIFFSPSQILFRSEHISFYTRLLEGNYPDTDRLLMNQFETEVVFNTQSLRHAMERAHLISNATQNGTVKLEIAANEVTAHVNSPEVGKVNEELDTVEKSGNDLTISFNPTYLIESLKALKSDTVRIRFISPVRPFTLTPDDNEGFIQLITPVRT. 377
21 0.000e+00gi|517184747|ref|WP_018373565.1| DNA polymerase III subunit beta [Streptococcus merionis]  clstr ali  41  1MIHFSINKTYFLQTLNTTKRAISHKNAIPILSTVKIDVTQEGITLTGSNGQISIENFITSKEENAGLL-ITDTGSILLEATFFINVVSSLPDVTLDFKEIEKNQIVLTSGKSEITLKGKDSEQYPRLQDMQTENPLILETKVLKDVINETAFAASLQESRPILTGVHLVLSDNQLKTVATDSHRLSQRKLSLEKKSDNFDVVIPSRSLREFSAVFTDDIETIEIFFSNNQILFRSENISFYTRLLEGNYPDTDRLIPIDFNTVIIFDRDRLRSAMERARILSNATQNGTVKLEVASGLVSAHVNSPEVGQVHEELEVVNLSGEDLTISFNPTYLIDALKAMDSEQVTVSFISAVRPFTLVPSEDEEFIQLITPVRT. 377
22 0.000e+00gi|493769156|ref|WP_006717704.1| DNA polymerase III subunit beta [Desulfitobacterium metallireducens]  clstr ali  34  1.MKIYCSKDALLTGVNTVQKAVSNKNTLPVLQGILIKAENNALVFEATDMEIGIRCVVEA--------QIEEEGMIVLPARLFSEIVRKLPTATIEIE-QRNDAVNIHYYESDILLKGFDPEEFPLLPDLYDAVSFNLPISLFKTMIRQTVYACAIEENRPVFTGILLQIEESNIRLIGTDTHRLAYRISEIENP-EDLKFVIPAKTLSEIYRLLKDDDEVLTIRFNQSQVSFQFGSVHLLSRLIDGQFPNYKQVVPKSCQSKIFLSTKEFSDAVERASLLARDSSHNIIRLSVEKERLWLD-QASEIGKISEQLDIQ-MEGTEVKVAFNAKFLLDVLKVIDCEKIIFELSGPYGPGVIRPVDDPNYLNLVLPVRT. 366
23 0.000e+00JGI.Meta 7011075582 C2758683__gene_211364 DNA polymerase III, beta subunit [Human Stool microbiome from visit number 2 of subject 764447348]  ali  30  14..KFSCDKQILTENISVVLKAVSPKSNYPLLEGIYMKVTPNNVKMLGNDFEIAIESNFEAQT--------EEDGEIVLNARMLFEIVRKLPDGIITISSDENLKTTIFSEKAKYEIFGLNASEYPAIDSFDSEQKFSISKLQLKSIIRQTAFSIGTNENKITFTGAYFEVNGDVLKVVALDGYRMAYRKENISNTLLNSNFIIPGKTLNELSKILNDKEEEVEICFSDKKATIKIDNYVVYSRLIEGEFFNYEHIIPTVSDLTVTTDTKDIINAIERTSLLITTDSKSPVKMDITENNIYMSCIS-RIGKAEDSFFC-ETEGNNLEIGFNHKYLLDALKACECEKIKMQFTTSLSPLVIVPIEGDSFLYLVLPVR.. 376
24 0.000e+00 GL0064425 [Complete] locus=scaffold35603_7:972:2168:+  ali  28  30.MKFECEKTLLANAIDGVSRAITNRAAIPVLEGIYLKAEGFTLTLTGYDMEMGITTTIE--------CNVLVPGETVLDAKLLGSMVSRMPAGDICIELTDEGQAKISGGVAEFEIPALNASDYPSLPVTGADNTMTVKCGMLREMIEKTIYAVSQDDKKPAHTGELFVIEPGSLTIVALDGYRLAIIQRAVE-CTRDIRIIIPAKTLQELLKIMGGADDDVKIDANRRYVVFTSNGYTIMSRLIEGDFLNYESVIPKDKKTRVVVDCKTFIDTIERASLIITERLKNPLRINFGEERVTVRCQTP-LGKVVDEFSPVEMTGDPVEIGFNNRYLLDALRYSKCERMVLEINGPLSPVKLLPEDGKDFIYLVLPVR.. 393
25 0.000e+00gi|517075710|ref|WP_018264528.1| DNA polymerase III subunit beta [Methylosinus sp. LW4]  clstr ali  29  1.MKVTIERAALLRALGHVHRVVERRTTIPILANVLIDASAGTLLLKATDLDLEITEKVPA--------DVGQPSATTLPAHTLYDIVRKLPEGQVSIESGEQGQLTLRSGRSRFNLQSLPESDFPDVTSGEFTHSFSLAPGDLKKLILKTQFAISSEETRYYLNGIFLEVEGHQLRAVATDGHRLARVELPAPAGAAGMGVILPRKAVAEVLRLVEDADGAVAIELSTNKMRFSFGETVLTTKLIDGTFPDYGRVIPANNDKRLTVERGVFREAVDRVSTISSERGR-AVKLALSEGKLVLSVTNPDQGSAVEEIEA-DYDGPPIDIGFNSRYLLDIADQLDSDTALFRLADPGSPTLIQDRDGASALYVLMPMR.. 371
26 0.000e+00 GL0101915 [Complete] locus=scaffold71792_1:944:2056:-  ali  29  1.MKFTCEKALLVSALSVASRTVAQKSTIPCLEGVLLRA-GVALQLTGYNLETGITVHVGA--------QIQEAGSCVMPARLFFDIVRKLPDEMVSITVDHKQQVSIRAGAAFFQITAMDSEDYPELPDVNGKSGVTMPQSALKAMISGTIFSVSENQARPIQTGCLMEVTEDSVTMVAVDSFRLARRTWHTENAANTLKFVVPAAGLKEIERILEDSDEPVTFTLGDKHILFSIGDALLVSRVLEGEFIDWRRVVPTNCGTVLTANVAELTSSIERVSLIISEKVKSPVRCVFGDNMADFTANT--IGSAHDTCSIAG-NGGELEIGFNSRYLLDALRVIPSEEVTLELQNGLSPIVFTPCDKKDFAYMVLPVR.. 365
27 0.000e+00gi|780920554|gb|KJS87804.1| DNA polymerase III subunit beta [Peptococcaceae bacterium BICA1-8]  clstr ali  35  1.MKIIASKENLLDGINAVQKAVSNKNTIPILSGIFLKAVDNNLLFAATDLEIGIECKVPV--------QVIEEGEIVLPARHFSELVRKLPNTKIIINYLSDIIVSIQYDDAEVNLKGWPGDEFPLIPELEGNFSIEVETNILKNMIKQTIFATATDDNRPIFTGVLFELENNELHMVATDTHRLALRSGILKNNNKSISIIIPGKTLGEVNRIIKEEDEALIIKGNMNQISFETQDTKIISRIIEGKFPNYKQVIPQEYKSLLKVKTKAFQETIERANLFSSEKDTSIIKLVMGDGFLEITSKS-EMGKVEEKIPSYS-EGENIEISFNAKYLLDALKIIDTEDLNINLSGPLSPGIIKSGNHNNFIYLILPLRT. 368
28 0.000e+00 [EC:2.7.7.7][KEGG:K02338] DNA polymerase III subunit beta;|[COG0592] DNA polymerase sliding clamp subunit (PCNA homolog)  ali  30  1MLKFSCEKALLQNAAATASRAVSAKSSIPA-LEGLLLEGGERLTLSGYNTQTGIRTCIEA--------DVNETGRIVLNARLFGDIIRRMPDDMIVLSVDEKLMVHLSCGDASFDILGLSADDYPELPSVERQCGVALQQKTLKAMIGQTAFAVSTNESRPVHTGSLFEIDDSGLTMVSVDGFRLALRHEPLENDGGAFSFVAPGSALKEVENICGDTDDMIHITCGNRHLMFEAGETQLICRRLEGDFLDYKNAIPKNNPILVDVENSALLQSLDRVSVVISEKLKSPVRCVFDKDRIYLSARTSN-GEAKDICSASG-DGNELEIGFNNRYLMEALRYAPADTVRMALNTNISPCVITPTDGDSFLYMVLPVR.. 366
29 0.000e+00 [EC:2.7.7.7][KEGG:K02338] DNA polymerase III subunit beta;|[COG0592] DNA polymerase sliding clamp subunit (PCNA homolog)  ali  34  1.MKFNCEKEKLLIGLNSVSRTSVGRTTTPILEGILLNVKKNSVILTTNDLDIGMEYTLNGIET-------IEEGKVVIDCRMFGDIIRKLPNEQITFYVNDKNLLVIECEGSIYKLATMNADEFPTLPNIDVEKNITISQGALKEMIKKTIFAVSVEENRPIFTGCLIEVVNEELNVVAVDGFRLALRKARMASGVNSFSAIVPGKYLNEIVKNLQDIDEVIEIGTSKNQALFELKDCKIVTRLLEGDFLNYNSVIPNEKKTRIKVSKQALQSAIERAAIFSSEKKKYPIKIFVSLGSAIISCTS-QIGDAKEEVLV-ETTGEELEIGFNPKYLVDALKAIEDDEVYLDFGSNISPCVIRPVIGDKFTYMVLPVR.. 369
30 0.000e+00 [EC:2.7.7.7][KEGG:K02338] DNA polymerase III subunit beta;|[COG0592] DNA polymerase sliding clamp subunit (PCNA homolog)  ali  39  1MIHFSINKNLFLQALNTTKRAISSKNAIPILSTIKIDVTNEGITLIGSNGQISIENFISQKNEDAGLL-ITSLGSILLEASFFINVVSSLPDVTLDLKEIEQKQIVLTSGKSEITLKGKDSEQYPRIQEISASTPLVLETKLLKKIVNETAFAASTQESRPILTGVHFVLSQKELKTVATDSHRLSQKKLTLEKNGDDFDVVIPSRSLREFSAVFTDDIETVEIFFANNQILFRSENISFYTRLLEGNYPDTDRLIPTDFNTTITFDVVNLRQSMERARLLSSATQNGTVKLEIKGGVVSAHVHSPEVGKVNEEIDTEQVTGDDLTISFNPTYLIDSLKALNSEKVTISFISAVRPFTLVPADDEDFMQLITPVRT. 377
31 0.000e+00gi|754707437|ref|WP_042082694.1| DNA polymerase III subunit beta [alpha proteobacterium Q-1]  clstr ali  31  1.MKFTIERNALLKALSHVQSVVEKRNTIPILSNVQIEAVSGRLGLTATDLDLAIIEHTDA--------DISEEGATTVPAHTLHDIVKKLPDGQVGVALDDR-KLVLKAGRSRFTLSCLPKEDFPVMSAGDLPHRFKLPARDMKRLIDKTRFAISTEETRYYLNGIYLHVAEGRLRAVATDGHRLAQVDAALPDGAAGMGIIIPRKTVLEIQKLIDEYDGDLGIDLSDTKIRFHYGHAEITSKLIDGTFPDYSRVIPEGNDRVLTIGCEDFAEAVDRVSTISSDKSRS-VKLALDGDKITLSVTSPENGTATEEL-AASYSADSMEIGFNSRYLLDILDQVDGDQVEARLADAASPTVLRDSSDETALYVLMPMR.. 369
32 0.000e+00JGI.Meta 7003036414 SRS042131_WUGC_scaffold_7620__gene_12146 DNA polymerase III, beta subunit [Human Tongue dorsum microbiome from visit num  ali  38  11MINFSINKAYFLQALNTTKRAISSKNAIPILSTIKIDVTSEGITLIGSNGQISIEYFISVKDENAGLL-VTTPGAILLEATFFINVVSSLPDVVLDVKEIEQKQIVLVSGKSEITLKGKDAEQYPRIQEISASNPLTLPIQTLKKIISETAFAASTQESRPILTGVHFVLSDKELKTVATDSHRMSQKNITLEKNGDNFDVVIPSRSLRELTSVFSDEIEQVEVFFANNQILFRSDNISFYTRLLEGNYPDTDRLIPTEFSSEVTFKVAHLRQAMERARLLSNATQNGTVKLEIASGIVSAHVNSPEVGRVNEEIDTEAVSGDDLNISFNPTYLIDALKAIESEKVVIRFISAVRPFTLVPAEEERFIQLITPVRT. 387
33 0.000e+00 GL0068846 [Complete] locus=scaffold119843_1:2228:3340:+  ali  30  1.MKISCEKYILQSACTIASRATASKSPIPALEGLLLQAGID-LRVTGYDLKKGIYTNIAA--------DIAEQGSIVVGARFFGEMIRRLPDGIVTISSDANNNVNVKCGKSEFNFMGISADDYPEMPAVDSLNNISLPQKILKSMINQTIFAVSDSDVRPIYTGTLFEVEDDTLTLVSVDGYRLAKRCEKLESAKENCSFVVPGSALADIERICADSDDAVSISVGSKHISFTIDETVVITRRLEGEFLNYRKSIPDNFRIEIEVERSEMMSTIDRVALIVSEKNSSPIRMIFGDGSIDCTCATP-IGKAEDVCTCEG-SGDGLEIGFNDRYLMDAFKASGTDKLKICLNTASSPCIVKAADGENFTYMILPVRLH 367
34 0.000e+00 GL0448186 unmapped_[Complete]_[mRNA]_locus=scaffold352669_2:1564:2673:-  ali  32  1.MKLNCRRDELLNAINITSKAVSGKTTMPILECLLLTADTNSFKLTANDMELAIES-------ANIESEIEETGSIALDARFFSDIIRKINGDIVYITADENNSVTIKCGRSEFKMPGQNGEDFPPIPTVEKNVRFVVGQNDLRNLIRQTIFSISMDESKPVLTGELIEINDNKIDFVSVDGYRISYKQAELILASGSRKAIVPGKSLNEISKILSDEEEKAIIYFTDNHIMVDINGNIVVSRLIQGEFIKYQQSFTNDYKTSAKINRVEMLDCLERASLISRDSRKIPVKMEINSKNIIITAN-AETSTAYEEVFA-EVDGDKLSIAFNPKYLIDALKVIDDEYIYMLLNTPLSPCVFKSADGDNYKYLILPLR.. 368
35 0.000e+00gi|505138666|ref|WP_015325768.1| DNA polymerase III subunit beta [Halobacteroides halobius]  clstr ali  32  1.MKVEVNQKEFYQAIQTVKKAVSTKTTLPILSGILLRTQGNTLKLVGTDLEIGIECFVDAT--------VTTEGDIVLPAKYLASIIRELPNEKVILATEPSNNTSIKCDNSQFNIHGSAADEFPLLPEIESNTKFSISQQKLKKIINQIEFAVSEDENKPFLTGGLLILNDQKVELVATDTYRLAYREDEISQETSATKAIIPNKTLTELSKLLDKSADEVEIVITENQILFTFAGISIVSRLIEGQFPNYQQVIPNQTKTQVEVDKNTLLQATKRAALLAK-KESNIIKINFESNRLIITSNAPEIGQAYEEVPV-SLTGPESEIAFNASYLMDCLKEIDKEKVIIELSGALAPGVIKTNSEQKYIYVIMPVRS. 367
36 0.000e+00 GL0009369 [Lack 5`-end] locus=scaffold8970_2:3:1151:+  ali  30  16..KISCLRTDLANAVSNVSRAVSSKAAIPALEGVLIKAYDNSLNISGYNLEIGITTDIDVT--------IQEEGEIVVSAKLFLDIVRKLPEEIVMIETDERMVTYITCGNVDYQIVGMSSIEYPDLPTFEQTDMITVNAKTLREMIRQTVYAVSDNNAKPIYTGSLFEIEDGLFRIVAIDGYRMAIRSENVDSESKN-KFVVPGKTQLEVLKLLGDDEQNVDIIIGQRHITFKVDNYRVISRLIEGNFIDYKTTIPTDVKTEVIINTRVIINSVERMSLLNNDRIQSPVRCNFDNDEIKLSCASA-VGRANDSISV-SIMGEKVEIGFNNKYLLDALKNCDTDEIRLALSGPIKPMVIKPVKGDSFLSIVVPMR.. 377
37 0.000e+00gi|82944577|dbj|BAE49441.1| DNA polymerase sliding clamp subunit [Magnetospirillum magneticum AMB-1]  clstr ali  29  8.MKLTIERAALLKSLAHVQSVVERRTTIPILSNVKLEGRGGLLSLNATDMDLDIIEAVPA--------DVVRPGATTAPAHTFYEIVRKLPDGQVEIEHDESGQLTLRSGRSKFSLACLPVEDFPVLSGGELPFTFSLSAAELKTLIDRTRFAISTEETRYYLNGIYLHAAADVLRAVATDGHRLARVEITLPSGAAGMGIIVPRKTVAEIRKLIDETDGEITVSLSETKLKFAFGDAVLTSKLIDGTFPDYERVIPADNDKVLVVDCKSFAQAVDRVSAISTEKSR-AIKLALEKGSATLSASSAENGSAVEEIEA-DYTSTPLEIGFNSRYLMDILAQVEGDTARFAMADAASPTVVREMTDGGAIYVLMPMR.. 378
38 0.000e+00gi|1002492794|gb|KXT74231.1| DNA polymerase III beta subunit [Streptococcus sp. DD10]  clstr ali  39  1MIHFSINTNLFLQALNTTKRAISSKNAIPILSTIKIDVTNEGITLIGSNGQISIENFISIENENAGLL-IHSLGSILLEANFFINIVSSLPEVTLDFKEIEQYQIVLTSGKSEITLKGKNVEQYPRIQEVPATNPLHLETKVLKTLINETAFAASTQESRPILTGVHFVLTEHELKTVATDSHRMSQKKIQLKKAGDNFDVVIPSRSLREFSAVFTEDIESVEIFFANNQILFRSENISFYTRLLEGNYPDTDRLIPREFHTEVIFNVSKLRQAMERARLLSNATQNGTVKLEITTGIVSAHVHSPEVGRVNEEIDTEQVNGEDLSISFNPTYLIDALKALSSEKVAISFISPVRPFTLVPSENEDFIQLITPVRT. 377
39 0.000e+00gi|518804385|ref|WP_019960339.1| DNA polymerase III subunit beta [Woodsholea maritima]  clstr ali  29  1.MKLTIERAALLKALGHVQAVVERRNTIPILSNVLIEASGDQARFTATDLDMEI--------VEATGARVDREGMVTAPAHTLYEIARKLPDGDVTLEASDDPRMSLSAGRSRFNLPALPPSDFPVMPSEDLAVTFQAPADQMARLIDKTRFAVSTEETRYYLNGIHIHVADRVLRAVATDGHRLALAEMQLPSGAEAMAIIVPRKAVNEIRRLLEDANDDVTVSVSEGKIRFGFGAAVLTSKLIDGSFPDYERVIPRGNDKLMRVDRAPFAQAVDRVATISQEKSRS-IKLSMSQGQVVLTVNNPESGQASEELSA-DYSSDEMHIGFNARYLLDVAAQIGGDEVVFEFNDSASPTRVTDSGDPDAEYVLMPLR.. 371
40 0.000e+00gi|653090258|ref|WP_027340495.1| DNA polymerase III subunit beta [Halonatronum saccharophilum]  clstr ali  33  1.MKVEVNQKDFYQAINIVRKAVSTKTTLPILSGILLKTEGQRLRLVGTDLEMGIEAFVEAE--------IIEEGEVVLPAIYFANIIKELPNEKVDLESKDNNTAFIKCGYSKFNINGSPADEFPSLPKVKSGKSFKIKEGRLKEIFGQVEFAISKDESKPFLNGGLLLFEEDKIKLVATDTYRLAYREDSIEELDIEGDAIVPSNTISEIAKLLNDSEDLVEVVLTENQILFNFAGITMVSRLIEGQFPNYKQVIPKNSKTKVEVDRMELLRATKRAALLAR-QDADIIKINLKEDRLVITANAPEVGQAYEEVSISLL-GQETEIAFNANYLVDCLKAMKDETVNVELSGSLAPGVIK-RDSDDYVYVIMPVRS. 365
41 0.000e+00gi|953949284|dbj|BAT57757.1| DNA polymerase III subunit beta [Variibacter gotjawalensis]  clstr ali  29  1.MKVTVERAELLKSLGHVHRVVERRNTIPILANVLLRAANGKLNLKATDLDLEIIEPIGA--------DIGAPGATTVPAHMFYEIVRKLPDGQVQLESLDRSSLAIKAGRSRFTLQTLPESDFPDLAAADMTHKFSVGAADLKRMIDKTQFAISTEETRYYLNGMYLHVTDKTLRAVATDGHRLAQFDLPAPSGAAGMGVIVPRKTVGELQRLIEGGDTEIGIELSSAKIRFTLGDVILTSKLIDGTFPDYTRVIPQGNDKQLKVDKPDFEAAVDRVSTVSSERGR-AVKLSISGSRLLLSVTNPDSGSATEEIEV-DYDGDPLDIGFNSRYLLDIASQIDSEQAIFKLADPGSPTLIQDGTGGHAVYVLMPMR.. 368
42 0.000e+00gi|503143704|ref|WP_013378365.1| DNA polymerase III subunit beta [Eubacterium limosum]  clstr ali  34  1.MKFSCSRDALINALSIAQKGVSNKTTLPVLEGILFQVYNNQLVLTSTDLEIGVQTSIPA--------NVDMDGEIILSSNLITEVIRKLSGEEVFFQKDDSNQVKIECLLSNFTIKGFPTDEFPEFPEVIEEHSFVIEAGVLKEMIRGTIFSVAVSENIPVLTGLKMEIENDAISLIALDGYRLSLKRGKLKEADGSISVIIPGKSMNELNKLLSGYNENVIVKFSKTQIFFEMGNTQFTSRLLEGEFINYKHIIPTEKATQVKVSRKLLLESSERAALLAREGKNNLIKMDFNIDQLILTSN-AEIGDVFEVIPIEN-QGDPIKIAFNSKFFIDALKVIDRDEMSIELTTSVGPAVIVPADGDEFIYLILPVR.. 366
43 0.000e+00gi|655496947|ref|WP_028878289.1| DNA polymerase III subunit beta [Terasakiella pusilla]  clstr ali  29  1.MKITIERASLMKSLAHVQSVVERRTTIPILSNVKLDAHGGRLSLNATDMDLDIVETVE--------CEVITEGATTAPAHMLYDIVRKLPDGQVELDNGANELLTLRAGRSKFTLACLPTMDFPVMSGGELDHNFALPAGELKGIIDRTRFAISTEETRYYLNGIYMHAGENNLRSVATDGHRLASVEVPLPDGSADMGVIVPRKTVGELRKLIDETNDDVSVSLSETKIRFAFGEVVLTSKLIDGTFPDYERVIPTGNDKMMELDCKTFAAAVDRVSAISTEKSR-AIKLAIAPGALVLSASSPDAGSATEEIEV-SYSAENIEIGFNSKYLLDIAQQVEGETAQFMLSDGGSPTIVRDASDASALYVLMPMR.. 371
44 0.000e+00gi|500161605|ref|WP_011836275.1| DNA polymerase III subunit beta [Streptococcus sanguinis]  clstr ali  40  1MIHFSINKNLFLQALNTTKRAISHKNAIPILSTVKIDVTKEGITLIGSNGQVSIENFIS-TQNENAGLLVNSTGSILLEATFFINVVSSLPDIILDFKEIEQKQIVLTSGKSEITLKGKDADQYPRIQEISASNPLVLETKILKDVINETAFAASVQESRPILTGVHFVLTDNRLKTVATDSHRMSQKKITLEKNGDNFDVVIPSRSLREFTAVFTDEIETVEVFFANNQILFRSENISFYTRLLEGNYPDTDRLIPTEFTSVLTFNTSDLRAAMERARLLSNATQNGTVKLEITGGVVSAHVNSPEVGRVNEEIDTESVTGEDLTISFNPTYLIDALKAIDSEKVTISFISSVRPFTLVPSEDENFIQLITPVRT. 377
45 0.000e+00gi|503042025|ref|WP_013277001.1| DNA polymerase III subunit beta [Acetohalobium arabaticum]  clstr ali  35  1.MQIKIDRKNFYDGIQTVRKAISSKSTLPILSGILIETQEKKLKLVGTDLELGIECRVDA--------NIIKDGAIVLPANHLANIVRELPNKELELELKKDNKIEISCGLSQFKIHGSPADEYPLLPEVGSGIEYTLSQEKFQAMINRIKFATSDDESRPFLTGGLLSIDNENLKMVATDSYRLAYTQLELDKDLKNEKIIIPSKTLNELSKLLN-SEDEIRFLITDNQILFEFSEITIISRLIEGQFPNYKQVIPDNHKTEIKLKKKELLNATKRSALVAR-NNSNIIKTKFQNDKLMIESNAPEVGQAYEELSTSQH-GDDTEIAFNANYLIDVLKVIDNEEILIELSGELSPGVIKEVDNDNYIHVIMPVRS. 364
46 0.000e+00gi|651395693|ref|WP_026507400.1| DNA polymerase III subunit beta [Butyrivibrio sp. MC2013]  clstr ali  35  1.MKFVCSKSNLVSGLQIAQKAVPAKTSLSILQCILVDTTEGVIKFIANDMELGIETRVEGT--------IIERGYTALDARIFFDIIRKLPDSDVTIESTNSIKITISCEKSKFTILGRSGDDFTYLPVIEKIDGISISQYTLKNIIAQTIFSVSEKDTNKLMGGELFEIDGNILKMVSLDGHRISIRKVELSNGYPYKKVIIPAKALGEVMKILSDSESMVSVYFTDKHVLFEFDNTVVVSRLLEGQYFNIDQMMMSDYETKISINRREFLDCIDRATLFVKEGDKRPVIISIEDDYLEMKINSA-VGAMDEKVEITK-QGKDVKIGFNPKFLIDALRVIEDEEVDIYLVNPKAPCFIRDA-DSSYNYLILPI... 366
47 0.000e+00JGI.Meta 7011049485 C2714737__gene_185267 DNA polymerase III, beta subunit [Human Stool microbiome from visit number 2 of subject 764447348]  ali  33  1.........................TTMPILECILIDATTDVIKLTANDMELGIETTIDGI--------IDSRGIIALNAKIFSEIVRKLPDNDVVIETESDNQAIITCEKAKFNIAAQSGDDFSYLPAIEREDFITISEFTLKEVVRQTIFSIADNDTNKMMTGELFEIDNDVLRVVSLDGHRISIRKIELKDAYQPRKVIVPGKTLQEISKIIGEADDEVEISFTKNHIVFEFDRTLVVSRLIEGEYFRIDQMLSSDYETRVHVNKKELLDCIDRATLLIKEGDKKPIIIDIKNESMELKIKS-QIGSMDELIFCTK-DGKDLMIGFNPKFLIDALRVIEDEEVDLYFMNAKAPCFIKD-ENQSYIYLILPV... 339
48 0.000e+00gi|519031539|ref|WP_020187414.1| DNA polymerase III subunit beta [Methylopila sp. 73B]  clstr ali  27  1.MRATLERAALLKALAHVHRVVERRNTIPILANVLLRAGADGLRLQATDLDLEVVETVAAE--------VAQPGATTVPAHTFYDIVRKLPDGQVSLEMGERGTLVIRAGRSRFTLQTLPDSDFPDLAAGELPTGFTIGAADLKRLIDKTQFAISNEETRYYLNGIYLHAVDSALRAVATDGHRLARVEMPAPAGAVGMGVIVPRKTVSEIQRLVEDPEGEVKVELSPTKIRVSFGQVVLTSKLIDGTFPDYGRVIPAGNDKRLTVDRLEFKSAVDRVSTISSERGR-AVKLSLTDRKLVLTVTNPDSGNATEEIEV-DYEAEPLDIGFNSRYLLDIADQLEGDTALIRLADPGSPTLVQDRDDAPALYVLMPMR.. 371
49 0.000e+00gi|456351579|dbj|BAM86024.1| DNA polymerase III, beta-subunit [Bradyrhizobium oligotrophicum S58]  clstr ali  28  53.MKVTVERAQLLKSLGHVHRVVERRNTIPILGNVLVRAENARLSLRATDLDLEVTETLAAETATA--------GSTTVPAHMFYDIVRKLPDGQIVLESDERAVLAIRAGRSKFTLQTLPESDFPDLAAGEMTHAFGVPAKDIKSLIDRTQFAISTEETRYYLNGIYLHAGGNTLRAVATDGHRLAQVDLPQPAGAAEMGVIVPRKTVGEVQRLIEDNDSEIRIELSQGKIRFTLGQVVLTSKLIDGTFPDYGRVIPQNNDKELVVDKADFAAAVDRVSTISSERGR-AVKLALAPGKLVLSVTNPDSGSATEELEV-EYAADALDIGFNSRYLLDIAAQIEGEVAVLRLADPGSPTLIQDRDNRNALYVLMPMR.. 423
50 0.000e+00JGI.Meta 7068489806 SRS050029_WUGC_scaffold_8929__gene_11446 DNA polymerase III, beta subunit [Human Buccal mucosa microbiome from visit num  ali  39  1MIHFSINKNLFLQSLNITKRAISSKNAIPVLSTIKIDVTNEGITLIGSNGQISIENFIS-QKDENAGLLINSLGSILLEASFFINVVSSLPDVTLDFKEIEQHQIVLTSGKSEITLKGKDSEQYPRIQEIAASNPLVLETKLLKKIINETAFAASVQESRPILTGVHFVLSNKELKTVATDSHRLSQKKLTLEKNSDNFDVVIPSRSLREFSAVFTDDIETVEIFFANNQILFRSENISFYTRLLEGNYPDTDRLIPTDFNTTVTFDVVNLRQSMERARLLSSATQNGTVKLEIKQGVVTAHVNSPEVGKVNEEIDTIAVSGEDLTISFNPTYLIEALKALNSEKVTISFISAVRPFTLVPADDEDFMQLITPVRT. 377
51 0.000e+00gi|984926461|ref|WP_060776637.1| DNA polymerase III subunit beta [Aerococcus christensenii]  clstr ali  42  1.MKFTIKKSIFADCLANVQRAISFRTTIPILTGIKLQTNEKGLILTGSDSTLSIENLIE-EKEESNHLSISEPGSVILPSRFLGDIIRKLPEDKITVAVQDNFQTIITSGESVFTLNGTSGKNYPQLPEINSAATFNLPGHLMRQAINYTIISVSSQETRPIFTGIHFELGDNQLKAISTDSHRLSQRIIPITKDKEKVELNIPGRALSELSRLVND-NENISMMVTNNQVLFKMNNTSLYSRLLEGTYPDTTRLLTKDQKTSIKVNAAELGAAVERALILSHQGKNNMVKLSMDNSGVILSGHSSEIGYVKEKINALGFEGENMSISFNPDYLREALKTFGGQDVIIRFTSPSHPFILLPSEDSNMIQLITPIRT. 381
52 0.000e+00JGI.Meta 7015863131 SRS014979_WUGC_scaffold_411__gene_307 DNA polymerase III, beta subunit [Human Stool microbiome from visit number 1 of su  ali  29  1.MNILCDKQALIDAVGNVQRAVSGKSTLPALEGILLRAAGSSLFLAGFDLDLGITTTIEAE--------VREPGEIVLTARLFGEIVRRMPGESVMLVTDEKLNATIRSDVTEFTIMGISASEYPEIPAVEDGVLFQLPQNTLKSMIRQTLFAVAPTDPRPIHTGTKFEIETDCLKLISVDGSRLAIRQEAIQSDTSA-SFVVPGKTLQEILKLLQDEETPVTLSVGRRHIVLDISGYAVISRLLEGEFLAYQKAIPQQVGTTIRVNSRALMDAVERVSLVINDRLKSPLICEFTDGHIQVSCTTP-LGSASDRIPA-SIEGNGEEMGFNSRFLLDALKNSETDEVRIELGGPLSPMKVLPSEGDSFLFLVLPVR.. 364
53 0.000e+00gi|503552754|ref|WP_013786830.1| DNA polymerase III subunit beta [Thermoanaerobacterium xylanolyticum]  clstr ali  32  1.MKFSCDKISLLNAVNKVIKGVTPRTTLPILQGILLKSENNKIVMYTTDMEIGIQCSIEA--------FIIEDGSIVVSSKVFSDLVRKLPDDTVFFESDESNMVYIKCGLTEFSISGNSSDEFPDIPDVIKDVTFSLNQKILKEMIKMTSFSVAQDMARPILTGILMEVSKNTINMVALDGYRMSIKKYPLSKNLDDFSVVIPGTTANELLRVMEDSDDEVSISFTGNQILFEFNDTKVISKLLDGNYMNYKTVIPKDFKSVVIIDKDDLIGAIDRASLLAS-NKSNLIKFTFNERELVISSNS-EKGKMSERLNI-EIEGNLIEIAFNSRYLLEALRVIDSKKIKISMINSINPMIITPIEDDDYLYMVLPVK.. 367
54 0.000e+00gi|1002496787|gb|KXT77776.1| DNA polymerase III beta subunit [Streptococcus sp. DD13]  clstr ali  41  1MIQFSINKNVFLQALNTTKRAISGKNAIPVLSTVKIEVSQEGITLTGSNGQISIEYYIS-TKDTNAGLLITSPGSILLEASFFINVISSLPDIVVEIKEIDHQQIVMTSGKSEITLKGKEAEQYPRLQEVATSNPLILETKILKEMINETAFAASTQESRPLLTGVHLVLDHHELTTVATDSHRLSQRKLTLEKSGDNFDVVIPSKSLREFTSVFSDDIETVEVFFSSNQLLFRSDYISFYTRLLEGNYPDTNRLIPKEFNTTVVCDVTYLRQAMERARLLSNATQNGTVKLEITDQVVSAHVHSPEVGQVNEELDTYLVEGEDLTISFNPTYLIEALKAIDSEQIKISFISPVRPFTLVPNGAEDFIQLITPVRT. 377
55 0.000e+00JGI.Meta 7020991674 SRS023604_Baylor_scaffold_6520__gene_11528 hypothetical protein [Human Posterior fornix microbiome from visit number 2 o  ali  33  1.MKLEFNKDTLMNALAIVSRAIPTRTTNPILECILFDASRDQIKLTANDTELGIETTVEGT--------IVEPGMVALNARLIIEIIRKLEGGEVMIQSGENFLTTISCDRAQFNISGRDGEEFSYLPDIEKNNYICLSQFSLKEAVRTTIFAAALNDTNKMMGGEYIEVNGNSVKFVALDGHRIAIRTIEMKETYGNAKVIVPGKAMSEISKIMADDNEEVLIYFSENHILFEFDDTLVISRLIEGEYFRIEHMLSKDYEIKLRVNRIKFLNSIDRATVLIKESDHKPIIFEIENQGIRLKVKSS-TGDMGENLSCEK-SGNDLTIAFNPKFFLDALKAIEDETVDLYMTNAKAPCYIRD-EQERYIYLILPV... 365
56 0.000e+00gi|518373350|ref|WP_019543557.1| DNA polymerase III subunit beta [Selenomonas bovis]  clstr ali  32  1.MKFTCQKQELTGALSIVSKALSSKPQMPILSGIYLRAESGQLELEATDFELGIIIAIDAE--------ITQPGQMTLPGRYFQEVIRKLPGDTVSIDEDEAKSVRIQSAAANYTLRTMNASEYPVIHRLEGDLHFTIKDNVLRSLVKKTVFACSNDESRPIFTGVYMDIDQNTVTMAATNTHRLAVKKETFDAPIGAMKLIIPAKVLNELLHILSEIPSDVEVTCSLNQVSFAFENIYMTSRLIEGAFPNYRNVIPQNLTVKVEAATSEISAAMDRVSLISRANDYNVVKLDFHDEQLHISSSNPDIGQAEETLPVA-IEGDAIQIAFNATYLVDVLKALDGESCVISLHQPLSPITITEPDDPDFIYVVTPVRT. 368
57 0.000e+00JGI.Meta 7072916233 SRS022713_LANL_scaffold_18043__gene_46020 hypothetical protein [Human Stool microbiome from visit number 1 of subject 37  ali  29  1.MKFSCEKALLQSAIAVTSRAVAQKSSIPALEGLLLHA-DSRLTISGYNLQTGIRTKVSA--------DVTEPGEIVLNARLFGDIIRRMPDDVVVFTADDKQLVHLSCGDADFDILGLSAADYPELPMVEDDFSVSIQQKLLRAMIEETAFAVSTNESRPIHTGALFEITDQGLTMVAVDGFRLAIRRXPLEKDGGAFSFVAPGSALGEVKNICSDVEDLAAVTLGKSHILFEVGDTELICRRLEGEFLDYKNAIPRKNPISVIADTKALIESIDRVSVVISEKQKSPVRCLFDHDKVLLSAKTGN-GEAKDICRLSG-DGGGLEIGFNNRYLMEALRYAPADTVKIELNTGVSPAIIVPTEGENFLYMVLPVR.. 371
58 0.000e+00gi|1002734550|gb|AMN38467.1| DNA polymerase III subunit beta [Rhodoplanes sp. Z2-YC6860]  clstr ali  29  1.MKVTVERAELLKSLGHVHRVVERRNTIPILANVLVRAEKSALSLKATDLDLEVIESIAA--------DVAPAGSTTVPAHMFYDIVRKLPEGQVVLESTDRAVLAIRAGRSRFTLQTLPESDFPDLAAGDMTHKFTLPAADLKRLIDKTQFAISTEETRYYLNGIYLHVAGSTLRAVATDGHRLAQTDLELPAGASGMGVIVPRKTVTEVQRLIEDNNAEVSIELSSAKIRFSIGNVVLTSKLIDGTFPDYQRVIPSGNDKELVIDKKDFQAAVDRVSTVSSERGR-AVKLSLSGGKLILSVTNPDSGSATEEIEA-EYDADPLDIGFNSRYLLDIASQLDGEVAVLKLADPGSPTLIQDKDAKGALYVLMPMR.. 371
59 0.000e+00gi|914827245|ref|WP_050739309.1| DNA polymerase III subunit beta [Acetobacterium bakii]  clstr ali  35  1.MKFNCSKESLMGALNIAQKAVSSKTTLPILEGILFSVENNNLLLRSTDLEIGIEINIPAT--------VEQEGKIVLSSTITGELIRKMSGSEVFFESDNHNQMKISCLLSNFTLKGLATDEFPAFPEIIEDHIFSLESSVLRELIRGTLFSVATNENIPVLTGVKIELEGNKINLIALDGYRLALRSGNIKENEDDLSVIIPSKSLSEINKVLANYTGEVVVKFSKNQIFFEMDNTQFTSRLLEGDFINYKQIIPVEKTTQVRINRRLLLESSERAALLAREGKNNLIKMDFNQDQLILTSN-ADIGDVYEVIPIVN-TGESLKIAFNSKFLIDALRVIDGEEFIMDMTTSVGPGVLLPVEGTDFVYLILPVR.. 365
60 0.000e+00gi|524124811|emb|CCY99157.1| dNA polymerase III subunit beta [Clostridium sp. CAG:793]  clstr ali  31  1.MKIICDKEKLLKAINSVTKAVAVRTTMPILEGILIQTNENDIKLTCYDLELGIEYII-------KDCTVAEQGATVVNAIMFSEIIRKLPDTEIKIEINDKNLLVIECEGSLYKLATMNPEEFPELPEINIENSIEIEQNTLKDMIRKTIFAISTEENRPIFTGCLFEIKNNKLNVVAVDGFRLAWKNKFLQTKTNDFTAVIPGRTLTEINKILLDSFDLVKIGIAKNQALFEIENCKIVTRLLDGEFLNYSSVIPEKWETRVRVNRTAIANCFERISLISSSEKKYPVKVTVEVGKITISCTN-QTGDAKEELYVN-TEGKNLEAGFNPKYFLDVFRNIDDEEVYIDFGSNISPCIVRSIEEEDYKYMILPIR.. 370
61 0.000e+00gi|647623859|ref|WP_025897414.1| DNA polymerase III subunit beta [Sneathiella glossodoripedis]  clstr ali  33  1.MKLTIERSTLLSALNHVQSVVERRNTIPILSNILLSAENGSLGLIATDLDLAINEKVPAE--------IQSPGAITAPAHLLYDIVRKLPDGQVELDYQSDSRITVRAGRSQFALSCLPKDDFPIMETGELPFNFSFPSAELKRLIDKTRFAISTEETRYYLNGVYIHAADNELRAVATDGHRLARVETPLPANAENIGVIIPRKAVNELRKLIDDTEGDINISLSDNRICFTFDGTILTSKLIDGTFPDYERVIPTGNNKVLELDGKSFAQAVDRVSTVSTEKSR-AIKLSLTDDTVTLSATGTDSGSATEELAASYSSG-DLEIGFNSKYLLDITGQIEGTNAHFVLADAQSPTIVKDGTDDGALYVLMPMR.. 371
62 0.000e+00gi|524551585|emb|CDC78203.1| dNA polymerase III subunit beta [Clostridium sp. CAG:964]  clstr ali  32  1.MKFSCSQKDFSSAVTNVQRAVSAKTSTPALEGILIKASDSCVELCGYDLEIGITTFIS--------CNVAKKGEIVVSAKLLGDIVRRLPENTVDIETDDKMIIYIKSGQAQYQLVGISSEEYPELPKVEKMDEIKIKSGLLKNMIKQTIFAISDNFSKPIYTGSLFDIENNILKIISVDGYRMAIRQEAIECGTTN-KFVIPGKTLSEILKLTCDDENNIEIIIGQRHAIFKIENYSIISRLIEGNFIDYKTTIPPENKTEIIINTRGLIAAVERMSLLTSEKIQSPIRCMVEDTQVKLFCSTS-IGRANDAISA-DVKGENVEIGLNSKYLLDALKNSETDEIKLQLNGSLTPMKIIPVQGDAFLYLVVPMR.. 363
63 0.000e+00gi|780026607|ref|WP_045442079.1| DNA polymerase III subunit beta [Tepidicaulis marinus]  clstr ali  26  1.MKITIERGALLKSLNHVQSVVERRNTIPILSNVLIRADQGQLSLTATDLDIEVVESIDA--------DVAQAGGTTASAHTLYDIVRKLPDGQVELVYGDDGRLTLQAGHSRFALQCLPQEDFPAMSAGELPHRFDLPAAALARLMDKTRFAISTEETRYYLNGIYLHVEGDELRAVATDGHRLAQADYPLPDGAAGMGIIVPRKTVQELQKLAEGQDGLIHVSVSDTKIRFEFAGVVLTSKLIDGTFPDYERVIPKDNDKMLEVEGKRFAQAVDRVSTISTEKSR-AVKIHLEDGKLTLSVNNPDSGSAVEELAV-DYSADPIEIGFNARYLLDIASQLDGERALFAMADSGSPTLIRDSEDASAIYVLMPMR.. 370
64 0.000e+00gi|491040558|ref|WP_004902227.1| DNA polymerase III subunit beta [Leuconostoc citreum]  clstr ali  42  1.MQFSINRQAFIKSLNDVARAISSRTTIPILTNIKIVLSEDELILTGSNSDISIETRIE-QSDTTAQLVIKEKGGITLPATFFANIVKNLPADDLMLAV-DGLRANITSGASAFTINGQDVRNYPQLPEMDDVQSLSVSAAQLIDIISQTKISASTQESRPILTGIHLALNGNDVKAVTTDSHRLSQRIVTLTEAHVSADVIIPAKSFNELQSLLEGQD-RVDIKLSANQAVFDLGHTTFYSRLLEGNYPETDRLIPTESTTELTMDAGALLGAINRASLLSHESRNNVVQLTLKAGVATLTGTSQEVGQVQEELVTKSVAGEDLEISFNPDYVRDALRVFSGKPVDVKFTSNLRPFTLTPAGDNKQLQLITPVRTF 377
65 0.000e+00gi|524372165|emb|CDB23591.1| dNA polymerase III subunit beta [Clostridium sp. CAG:557]  clstr ali  32  1.MKISCLRQTLVDAVLNVQKAVSAKSCLTALEGVLIKTKENAISLCGYDLELGITTEIPAT--------IDEPGEIVINAKLLADIIRKAPAETVSINVDEKLIATITSSPAEFSLVGISPEDYPEMPKLSGEENMSIDCNTLKGMIRQTLFATSETDVKPINTGTLFEVGENELKLVSVDGYRLALRKEPVQGN-KKLKFVVPGKTLNEILKLLPDSEDTIEISIGKKHIIFYIENYCVISRLLEGEFLNYNAAIPATHATEILVNTKNMIESIDRVSLVVTDRLKSPIRCLFADNYAKISCITT-IGKANDELMVN-MQGDSLEIGFNNKYLIDALKNTECDEVKIQLNGPLNPMKIVPINGDSFVFLVLPVR.. 364
66 0.000e+00gi|524322520|emb|CDA80745.1| dNA polymerase III subunit beta [Clostridium sp. CAG:594]  clstr ali  40  1.MKFSIKKEVLLHSLNSVSKALSSKNLIPVLSGIKFNLTNEGLFLSASDNDISIESFIDKSKLE----EINEVGTTVIQGKYILEIIRKLEGRIVNIELLDNIKVLISCGNSEFNLNSMDAAEFPNLNMEEKKEPIIIRKTEFKNLINKTSFAISSQETRPILTGINFKINEDKLECISTDSYRLAKKYVTLSNSSEDINIVIPGKNLIELTKILEETDDDIEMHVFSNKVLFKFDNTLFQTRVLSGTFPDVNRLIPASFELEVKANANEFYNVIDRAALLTSEKDKNIVKFECDGNEVIVSSNSPEIGRVEEKMDVEKNNDTNIKIAFSSRFMMDALRTVESKDVVLCFNNDVQPIIIKDSKDDTLLQLILPIKTY 373
67 0.000e+00gi|764621010|ref|WP_044433367.1| DNA polymerase III subunit beta [Skermanella aerolata]  clstr ali  29  1.MKITIERAALLRSLGHVQSVVERRNTIPILSNVMLRAENGELALTATDMDLEIVETVPAE--------VTQAGSTTAPAHTLYDIVRKLPDGQVELSSGDNGLLTLRSGRSNFKLGCLPTEDFPQMSGGELAHQFSLSAADLRMLVDRTRFAISTEETRYYLNGIYLHATRSVLRAVATDGHRLARVEIPLPEGAGNIGVIVPRKTVMEIRKLIDEAGDRISVALSETKVRFGFDTVMVTSKLIDGTFPDYERVIPTGNDKVLEVDSKVFASAVDRVATISTEKSR-AVKLSIDRGNLVLSATSPEAGSATEELEV-SYDSSPLEIGFNSRYLLDITQQIEGDGARFTMADAASPTIVRDVADPSALYVLMPMR.. 375
68 0.000e+00 [EC:2.7.7.7][KEGG:K02338] DNA polymerase III subunit beta;|[COG0592] DNA polymerase sliding clamp subunit (PCNA homolog)  ali  28  100.MKFECEKTLLANAIDGVSRAITNRAAIPVLEGIYLKAEGFTLTLTGYDMEMGITTTIE--------CNVLVPGETVLDAKLLGSMVSRMPAGDICIELTDEGQAKISGGVAEFEIPALNASDYPSLPVTGADNTMTVKCGMLREMIEKTIYAVSQDDKKPAHTGELFVIEPGSLTIVALDGYRLAIIQRAVE-CTRDIRIIIPAKTLQELLKIMGGADDDVKIDANRRYVVFTSNGYTIMSRLIEGDFLNYESVIPKDKKTRVVVDCKTFIDTIERASLIITERLKNPLRINFGEERVTVRCQTP-LGKVVDEFSPVEMTGDPVEIGFNNRYLLDALRYSKCERMVLEINGPLSPVKLLPEDGKDFIYLVLPVR.. 463
69 0.000e+00gi|749565073|ref|WP_040195465.1| DNA polymerase III subunit beta [Candidatus Soleaferrea massiliensis]  clstr ali  29  1.MKITVERDTLLEAVSNVSRAVSAKSNISALEGILMKARDGSLFLCAYDLELGISTSISAA--------VEIPGELVLNAKLFSEMIRRMPSQKILIESDEKLLTKVQCGVIQFDILGIPATEFPELPNVNDSEQVEIPQNVLKSMIDQTLFAISSDESKPVHTGSLFEIREGSLRIVSVDGFRLAIRTEPI-GCEKELRFIVPGKTLSDVSKLLADEEEPAQINLSRKHVVMGIGGYHVTSRLLEGDFLDYQKAIPTDQVLDVTVNTRRFIECVERMSLLINDRLKSPLTLQFDEDRIKLNCSTS-IGKSCDELEC-KAAGEKLKMGFNNKYLLDALKASGCDEVRLKINGALAPLRILPPQGENFLFLILPVR.. 363
70 0.000e+00gi|260207934|emb|CBA60043.1| DNA polymerase III, beta chain [Peptoclostridium difficile CD196]  clstr ali  36  36..KIICNQKILANRIGIAQKAINGKTTIELLKGILISTEEGQLKLTGYDAEIGIETYVQAE--------IIEKGDVVVDARLFGDIIRKLPDSFVEIETDSENNIYINCVNSRFKIKGYAAKEFPKLPELNEEDLYSIPQEILKNMIKQTVFAISQDQTKPVLMGELLEIVDRNLNLVAIDGYRLAVKSCSVDSLTENIKVIIPGKTLIDVNSLLS-GEDNVKVGFNEKNAIFIINDTKIITRLLEGDFIDYKKLLPREHNSRVKLNTKELLNSIERASLLSQSEKNNLIKLSIRDKVMAITSNT-EKGNVYEEVEI-DLDGDYLDIAFNSRYFIEGLKNIDNEEIFIEFTTNVNPCIIKPTDDVNYIYLLLPVR.. 397
71 0.000e+00gi|503884396|ref|WP_014118390.1| DNA polymerase III subunit beta [Oscillibacter valericigenes]  clstr ali  28  1.MKFSCKKALLQSAVNIASRAVAQKSSIPGLDGLLLQ-TGDGLTVSGYNLQTGIRTNVSA--------DVAESGKLVLNAKLFGDIIHRMSDDLVTLSASKERPVHLSCGDANFEIPGIPADDYPQLPEAEDSFRVSIRQRALRSMIDQTAFAISTNESRPVHTGAMFEVSEKGLTMVAVDGFRMAIRKEALENEGGEVSFVTPGAALNEVEKICKETDDLAEITLGKRHILFEAGDTQLICRRLEGEFLDYKRAIPWKNSIAVTVERKSLIESIDRVSVVISEKLKSPVRCLFDHDRVTLSAKTGN-GEAKDVCRVSG-DGGGLEIGFNNRYLMEALRYAPADTVRIELNTAISPAIITPVEGEKFLYMVLPVR.. 365
72 0.000e+00gi|806645589|gb|KKC28451.1| DNA polymerase III subunit beta [Caldanaerobacter subterraneus subsp. pacificus DSM 12653]  clstr ali  37  16.MKFVCDKNSLLEGVNIAIRGVSSRTTLPILQGIKITARGNVIKLSGTDLEIGIECQIPA--------VIEEEGETVVPARIFSDLVKKLPEGEVEVKSDSQNTVNVVSGDINFSIAGSNPEEFPEIPEVSREKSFKLPQSILKDLIKKTVFCVSEEQTRPILTGVLFEVFPNELKAVALDGFRMAIYSYKFDEEAEKYSLVIPGDTLDEISRILEDEETEVIIYHTSNQVLFQIDNTKVISRLLEGSFINYNAVLPKDFKTEITINKDVFMESLERASLIA-ESKNNLVKFEIGDSFIVISSSSEKG-SMSEKLEV-EVKGMLLEIAFNSRYLLDALKAIDEEEVNLYFINSINPLIIKPVGEKEYLYMILPVK.. 383
73 0.000e+00gi|501763505|ref|WP_012634457.1| DNA polymerase III subunit beta [[Clostridium] cellulolyticum]  clstr ali  34  1.MKVICSKENLLNGINIVQKAVSTKTTLPILEGILLNA-DDKFKLTGNDLEIGIECYVEA--------DIRSTGCIVINSKIFGDIVRRLPDSEVLIEVTGNNLVIVECENSHFEIKGINPSGYPSLPVVEKENILELTQSDLKDMIRQTVFAVGSDENRPVLTGSLIEVKDKELVIVSIDGFRLALRRKNLENDINDFSVIVPGKTLNEISKILQPTDEEVSVYSSNNQVVFDAKSWRIVSRLIEGKFLNYNSLLNKDFETKVIINIKEFQSSLERASLISMNDKNSPVKLFIGNDKIIITSN-ADLGNVREEVKA-EIEGNALEIGYNPAFLIDALKAIDEERASIYFITTNAPCTMRPESNNAFAYLVQAVR.. 365
74 0.000e+00 [EC:2.7.7.7][KEGG:K02338] DNA polymerase III subunit beta;|[COG0592] DNA polymerase sliding clamp subunit (PCNA homolog)  ali  33  103...............................ECILIDATTNEIKFTANDMELGIETIVEGE--------IIEKGKVAIDAKIFSEIVRKLPDNEICIETDSNYTSLITCEKSKFNIAGKSGDDFSYLPIIEKDKFITLSQFTLRETINQTLFSIAMNDNNKMMTGELFEVANGILKVVGLDGHRIAIRNIELTSHADDVKVVVPGKTLSEISKILSNAEDAVTIYFTNNHILFEFDNTTVVSRLIEGEYFRINQMLSSDYETKVTINKKEFLDSIDRATLLIKESEKKPIILSITDGSLEVHVNSS-MGSLNEDIDINK-DGKDIMIGFNPKFLIDALKVIDDEQIYIYLVNPKAPCFIKDKE-ESYIYLILPV... 435
75 0.000e+00gi|652569295|ref|WP_026962699.1| DNA polymerase III subunit beta [Alicyclobacillus herbarius]  clstr ali  35  1.MKLTIPQPDLVQMVNTVSKAVAVRTPRQVLTGILLEASANRLTATAYDLELGIQNWMTSEETE---IRVEEPGAIVLPARYFLDAIRKLPAQPVTLETTSNYLTAIRSGQVEFHLHGIDAAEFPRLPAFLGAASITVSSDMLAALIRSTVFATANTEVRPTLTGIHVQSSGDTLTFTATDGLRLATRSVTRQVSQDEWDAVLPGKSLVELLKILPDEQLPVTIQFTTSHCLFAQASTLFYTRLIDGAYPDTSRIIPTTHRTQVIVDTESLTHAIDRAALIAPARENHMVRLYIAEDSLTVASSSPEVGNVSEKLDIVDKQGDDLTIAFNARYVLDALKVCDTPEVQIQFNGPQQPFVIRRLGYDDGLQLISPVLT. 373
76 0.000e+00JGI.Meta 7047316227 C2653527__gene_157050 DNA polymerase III, beta subunit [Human Tongue dorsum microbiome from visit number 2 of subject 76  ali  31  8.MKIIFEKDKMIKALNSVTKAVATKTTMPILEGILIQTNNDDIKLTCYDKELGIEYII-------KENNVLEQGSIVVNAIMFSEIIRKLPDTNITISINDNNLLVIECEGSVYKLATMNPDDFPQLPEINVENSIELEQNTIKDMIRKTIFAISTEENRPVFTGCLFEVKNNKLNVVAVDGFRLAWKSKVLNTKTNDFEAVIPGRTLQEINKILADSFDLIKLGISKNQALFEIENCKIVTRLLDGEFLKYSEVIPKKWETRVRVNKNLISNCFERISLISSSSKRYPVKLNVEVGKIKISCTN-QTGDAKEEI-FTTTEGQDLEAGFNPKFFLDVFRNIDDEEVYINFGTSISPSVIKSIEDDDYQYMILPVR.. 377
77 0.000e+00gi|524500952|emb|CDC37582.1| dNA polymerase III subunit beta [Clostridium sp. CAG:352]  clstr ali  33  1.MKIVCNCQSLTEAITNVQRAVSTKSNNPALEGILFKANANSLTLCGYDLELGITTTLPAE--------VLSEGSVVLSAKLISDIVRRLPAETVSIDTNEKLMTTIISGAVDFKIIGMSADEYPDIPSVKGDSSIIIKGEILSSMISQTLFAIADSDIKPVQKGSLFEIESNIIKIISVDGYRLAMRTENL-ICGEKKSFIIPGKSLAEVVKLIKDGEKDVEIVVGDKHIIFKIDNYSVISRLIEGEFMNYSAAIPSSHKTEIKVNTRKFISSLDRMSLLLSERIKTPVRCNIENGVVKLSCSTV-LGQAYDEFDI-EMSGDSVEIGFNVRYMLDALRNTDTDEVKICLSGPTSPMVILPSDGDSFLFLVLPVR.. 363
78 0.000e+00JGI.Meta 7000811341 C1516081__gene_141415 DNA polymerase III, beta subunit [Human Stool microbiome from visit number 1 of subject 737052003]  ali  31  1.MKFSCDKAVLSAAISNVSRAVTTRTALQALEGILIRAEGDTLTLTGYDLELGITTVIPAE--------VSEEGSIILGARLFGEMIRKLEGGEVFVASDDKLLTEIRGGGAEFTILGMDAADYPELPGLGDAESLTLPQHALKSMIEQTQFAISQNDTKPVHTGSLFDVMPDSVTVVSVDGYRMAVRRELCDTGLE-TRFVVPGKTLAEIAKLLSDEEKTASIQVSRQYILTTIGSYSLVSRLLDGEFLDYQAAIPQGYTTQVTVSTRELIAAVDRASLIISDRLRSPLRLRFEEDSLRITCTTS-LGKAYDEVPCH-IEGNALEMGFNNKYVLDALRAADCDEICLQISGPLSPMKLVPP............... 357
79 0.000e+00gi|941295169|ref|WP_055108922.1| DNA polymerase III subunit beta [Paenibacillus sp. AT5]  clstr ali  40  1.MKLTIQKHALSEAIQHVSKAVNSKVAIPILTGVKLDVTNQGVTLTASDVETTIQAIIPVE-----PVAIEQSGSVVLPAKFFVEIIKKLPKETVSIEVQEGFNTLIQSGRTKINMVGMDPEEFPAMPADNDELKLTLSGAEIKELIKEVAFSVSTNEQSPLLTGVLWELDNGRLKLTATDRHRLASAEVDADEESDFRNVVIAAKTLAELSKNVQDKED-VRISVGSGNVLFKTDQVKFYTRMLNGSYPDTSKIIPTIFKSELTVNVKEFADAVDRAYLLAREEKTNIVRLEVEDGEIRIESTSSGVGKVIEQLEAEMFAGEPIRIAFNSKYMLDVLKIIDSERLRIGFTGAMSPIIIRPVDGNENLYLILPYRT. 372
80 0.000e+00 GL0001088 [Complete] locus=scaffold10023_2:1141:2286:+  ali  30  13IMKIICEKDPLVEAVSNVARAACAKSPVPALEGILLKAQDGQLQLTGYDLELGIVTTIEAKT--------EQPGQLILSARLLLDIIRRIPAQTVSILSDERDLATIRGGASEFTIPGLNAEEYPELPNFEQQSDLVLKQGVLKSMIDQTLFDIATTDSKPVHTGSLFDVKDSCVTLVSADGYRLALRREPIVSDL-TTRFIVPGKTLAEISKLLKEEDEEAYLALSQKPIVFRIGGYYVVSRLLEGEFLDYNAAIPKVSKTTVKINTRSLTDAVERTSLLISDRLRSPIRLSAMDQKVQLNCSTS-MGKAHDEVDC-EMSGEAVSMGFNNKYLMDALKASDCDMVKLEINGALSPMRILPLEGESFLFLVLPVR.. 376
81 0.000e+00gi|654639074|ref|WP_028100266.1| DNA polymerase III subunit beta [Dongia sp. URHE0060]  clstr ali  30  1.MKLTIERTALLHSLGHVQSVVERRNTIPILSNVLLEAKGDRLGLTATDMELAIVEQVAVDAG--------QAGAVTVPAHTLYDIVRKLPEGQVQLELSDGQQTTIKAGRSRFTLQALPKEDFPATGSGDLPHQFPLSAEDLKGLIDRTRFAISTEETRYYLNGIYLHAKQKALRAVATDGHRLARVEMPLPEGAENIGVIIPRKAVNELRKLIEDTTGSIAVSLSDSRIRFAFDDVVLTSKLIDGSFPDYHRVIPTNNDKMLEVDRKTFRDAVDRVSTISSEKSR-AVKLSLKSGLLTLSATSAEQGSATEELEV-KYDGAPIDIGFNSRYLLDIADEIEGEGMQILLADSVAPTLMRDMADAQALYVLMPMR.. 371
82 0.000e+00gi|493647693|ref|WP_006599285.1| DNA polymerase III subunit beta [Pseudoramibacter alactolyticus]  clstr ali  35  1.MKFDCSKTDLISALSLVSRGVSNKTTMPILEGILFEVYDHRLFLTSTNLEISIQTSIPA--------HVEQDGELILQSNFIFELVRKLSGEDVFFEQMAQHQLKMTCECSTFTIKGMASDEFPEFPKVIDDYSFTVDAAALKAMIHGTIFAVAIKENIPVLTGLKLEIEQDQLTMIALDGYRLALRRGALSTPNEAVSIIVPGKSMMELDKLLSGVSGDVQVNLSKAQIFFTMGDTQFTSRLLEGEFINYKHIIPKDKNTEVVIDKKLLLDSTERAALLAREGKNNLIKMAFGIDELTLSSN-AEIGDVHEVIPIQK-TGDDLKIAFNSKFIIDALRAIDQEQITINMTNPVGPAVILP-EDNRYVYLILPVR.. 364
83 0.000e+00gi|636489729|dbj|GAJ97183.1| LOW QUALITY PROTEIN: DNA polymerase III beta subunit [Geomicrobium sp. JCM 19055]  clstr ali  42  1.MHISIETDKFVTAVQYVSKAVSSRTTIPILTGIKIVATQEGVTLTGSDSDISIETFIPLGNEEREFMTVFEEGQLVLQERYFTDIVKKMPGETLTIQRDGQMAATIESDTVVFNLNGYDPDDYPKLPELPEEDQLILPQHLLKDMIRQTVFAVSNQETRPVLTGVNFDVEHLKLTATATDSHRLALRSASFDGDEEFTNIIIPGKSLVELSRILKDDETPVTIVITSTQVLFKMENLLFFSRLLDGKFPLTNNMIPTNGKTTMELSTKKIARSCDVA--FTGSKKNNVIHMKASGGQVEITSVSAEAGKVQEQLHANHFEGEELRIAFNGKYLR-CVKSIDSETISIMFTGSMSPFVVRPTDHDQMTHLFSPVRT. 379
84 0.000e+00 [EC:2.7.7.7][KEGG:K02338] DNA polymerase III subunit beta;|[COG0592] DNA polymerase sliding clamp subunit (PCNA homolog)  ali  27  117..NIICDKTLLSAAIDGVSKAVTLRSTIPVLEGILLKAEGFQLTLTGYDLEMGIVTTIEA--------NVKEPGEIVLNAKLLSSMISRMPAGQITIQSADNGKTTIQSGVAQFEIQSMSATDFPELPNTGAEETLTIKTGVLRDMIDRTLYAVSQDEKKPAHTGELFEIEPDKMTIVALDGYRLAIVERPV-TAVKDIRIIVPSKTMTEVSHLLPDDEEPVHICANRRYVVFMTAGYTIMSRLIEGEFLNYHNVIPAGSRTRVTIDTKEFIETIERASLIITERLKNPLRITFTEGKVVVRCQT-NLGRVVDEFNA-ECEGDEVEIGFNNRYLLDALRNARTEKVRMEISGPLSPVKVLPVEGNDFLYLVLPVR.. 479
85 0.000e+00 GL0074568 [Complete] locus=scaffold13622_4:1176:2291:+  ali  28  1MIKFSCEKVFLQNAIAVTSRAVAQKSSIPALEGLLIHA-DQQLTISGYNMQTGIRTNVFA--------NVVEGGDIVLNARLFGDIIRRMPDDMITFTADEKMMVHVSCGDADFDILGLSAADYPDLPEVEDEYAVSMQQKVLRSMIEEVAFAVSTNESRPVHTGALFEIADMSLSMVAVDGFRLAFRREKLEKEGGAFSFVCPGSALSEVKSICGDTEDLVTVTLGKRHILFEIGDTQLICRRLEGEFLDYKNAIPRKNPIQIVAETKALIESIDRVSVVISDKLKSPVRCLFDHDKVMLSAKTGN-GEAKDVCRVSG-DGDKLEIGFNNRYLMEALRYAPADKVKIELNTGVSPAIIVPVEGENFLYMVLPVR.. 366
86 0.000e+00gi|763066270|ref|WP_043948012.1| DNA polymerase III subunit beta [Candidatus Phaeomarinobacter ectocarpi]  clstr ali  27  1.MKITIERGALLKALNHVQSVVERRNTIPILANVLLSADDGQLSLTATDLDIEIVEGVSA--------DVASGGGTTAPAHTMYDIVRKLPDGQVEVNHDETGKVTVVAGRSRFALQSLPREDFPAAAAGDMPYSFEISTKDLFRLIEKTRFAISTEETRYYLNGIYLHTVEGKLRAVATDGHRLARVDMPMPSGADGMGIIVPRKTVTELLKLLETGDDTVKIAVSETKIRFDLGGVTLTSKLIDGTFPDYGRVIPSENDKSMEVDGKLFASAVDRVSTISTERSR-AVKLDLDDGKVTLAVNNPDSGSATEELGV-DYKGDALEIGFNARYLLDITQQLDGPTAHFELSDAGSPTVVRDTDDPEALYVLMPMR.. 367
87 0.000e+00gi|493463579|ref|WP_006418786.1| DNA polymerase III subunit beta [Eremococcus coleocola]  clstr ali  39  1.MKFTINRQKFTDVLNNVSRAIPGKTTIPILTGIKIEVNPDGVTLIGSDADISIESFLS-NQDESLQLNIKEQGSIVVGARLFNDIIRKLPTNEILLESDSNYLLTITSGPAVFTLNGQDGAAYPHLPEIDFENTVSLPTLAFKEMINHTIFSASNQESRPILTGLNLSIHPDYISGVATDSHRLSRREIPVELNTDLLNVTIPKKTVTELVRIVED-DQKLQMLVNEQQVIFILENLTIYSRLLEGNYPDTDRLIPSNHQTQLVVNANDFLAAIERASLMSHQSKNNIVQLSIKDQAVELSVSGNERGRASEDIQLKAVSGQDLLISFNPDYMRDALKSFNGIDIKIDFQTAVRPMLLSALDGSDLLQLLTPIRTH 382
88 0.000e+00gi|950134446|ref|WP_057189363.1| DNA polymerase III subunit beta [Bosea sp. Root483D1]  clstr ali  29  1.MKVTVERSTLLKSLGHVHRVVERRNTIPILSNLLLRGSEDGLKLKATDLDIEVVETVPA--------DVVEPGATTVPAHTLYDIVRKLPDGQVSLETTETGQMVLRSGRSRFTLQTLPESDFPDITAGEMAHRFVLPAGELKRLIDKTQFAISTEETRYYLNGIYLHAIDPVLRAVATDGHRLARVDTAAPQGSLGMGVIVPRKAVAEIQKLLEDGESEVQVELSATKIRVATAEVVLTSKLIDGTFPDYQRVIPSGNDKLLTVDRSDFAASVDRVSTISSERGR-AVKLSMADGRMTLSVTNPDSGSATEEIEV-DYDAGPLDIGFNARYLMDIAAQLDGDTALLKLADPGSPTVIQDREGASALYVLMPMR.. 371
89 0.000e+00gi|524303387|emb|CDA61223.1| dNA polymerase III subunit beta [Clostridium sp. CAG:169]  clstr ali  31  1.MKIICQKDLLVEAVSNVSRAVCAKSPIPALEGILLKAEEGTLELTGYDLELGIVTTIESKT--------EQVGELVLSARLLLDIIRRIPGETVSILSDERFLATIRGGASEFTIPGLSAEEYPELPNVQQQSDLVLKQGVLKSMIDQTLFAIATTDSKPVHTGSLFDIKDSCVTLVSVDGYRLALRREPIVSDL-TTQFIVPGKTLSEISKLLKEEEEEVYLVVSSKHIVFRIGGYYVVSRLLEGDFLDYNAAIPKLSKTTVKVNTRSLTDAVERTSLLISDRLRSPIRLAVTEQTVQLNCSTT-MGKAHDEVEC-EMTGEPVSMGFNNKYLLDALKASDCDMIKMEINGALSPMRVMPLEGESFLFLVLPVR.. 363
90 0.000e+00 GL0011273 [Complete] locus=scaffold4043_2:4607:5644:-  ali  34  1...........................MPILECILIDASTNQIKFTTNDMELGIETIVDGT--------IAEKGMVALDAKIFYEIIRRLPDNDVTIHTDENYVATITCEKAKFTIPGKTGEDFAYLPVIERDESLTLSQFTLKEMIRQTLFSIAVNENNRLMTGELFEIKNNCLKIVSLDGHRISIRRMPLKREYSDKKIVVPGKTLSEISKILSEVDDQVSIYFTKNHILFEFDQTMVVSRLIEGEYFRIDQMLSSDYDTKLSVNKKEFLNCIDRATLLVREGDKKPIVIDIRDNKMELKIDSS-MGSMNEEIDIEK-EGKDILIGFNPKFLIDALKVIDDENIHMYLMNPKAPCFIRD-DEETYTYLILPV... 337
91 0.000e+00gi|739071921|ref|WP_036943258.1| DNA polymerase III subunit beta [Pseudobacteroides cellulosolvens]  clstr ali  32  1.MKVICSKEKLLEGINIVQKAVSTKSTMQILEGILLKAGNN-FKLTGNDLEIGIECTIEA--------DIRREGSIVINSKMLGDIVRKLPESEILIEVKDNGKVIIECENSHFEIKGIPSEGYPELQMIENENMFVSTQNILRDMIRQTIFAVGFDDNRPVLKGILIESNGKELDFVAIDGFRMAQRRRVSEEEFSLIKVIVPGKTMNEIVKILQPEDEEMKIISSKNHVLFDLNNVKILSRIIEGEYLDYKSIIPSDYDTEVIVEKKEFLSSLERASLISNEEKKYPLKFDIEDEKIILSS-STELGTVREEIRV-EMTGRKMEIGFNPRYFIEALKAIDEERIKIVFTSEIGPSTIFPISGEEFAYMVLPVR.. 363
92 0.000e+00gi|490990985|ref|WP_004852718.1| DNA polymerase III subunit beta [Coprococcus eutactus]  clstr ali  34  1.MKISIRKANLLQGITTVSKAVSNKTTHPILSCILVEASGGIIKLTANDMEIGIESYVDGT--------VIEDGKVALEAKLFSDFIRKLPDSEISIESDKENKTLIKCERLEFNLPGKSGNDFSNLPVVSKDKYITISQFALRDVINQTIFSISDNENNKLMTGELFEVSNNRLSVVSLDGHRISIRYIDLKGDNSDIKVVVPGKSLSDISKIMNGGDDPVNIYFNENNILFEFDNTKVVSRLIEGEYFRISHMLSVDYQIKMKINKREFLDSLDRATLLIKESDKKPIRLSIGDRNLGLKISSL-IGSLNDEIDIEK-EGNNLVIGFNPKLIIDALRVIDDENVTIYFNNTKSPCVIKDDAG-SYIYLILPM... 363
93 0.000e+00gi|524607600|emb|CDD28614.1| dNA polymerase III subunit beta [Clostridium sp. CAG:452]  clstr ali  32  1.MKIICEKEKLQKGLSAVVRGVPTRTTMPILEGILIQTNNNELKLTTYDLELGIEYIID--------CEVKEEGNTVVNAMMFSEIIRKLPDTEISIEVNENKLLVIECEGSLYKLSTMEPEEFPELPKIEVENSIQTDQTVLKNMIRKTIFAVSIEENRPIFTGCLFEVVNNSLNVVAVDGFRMAWFKQDLENATSDFKAVIPGKTLNEVNKIILDSFDSIKIGVSKNQAIFEMENCKIVTRLLDGEFLNYASVIPNNWETRIRVNKNILQNCFERISLISSSEKKYPVKIKIEVGKVTISCTN-QTGDAKEEI-YTETEGKDLEIGVNPKYFLDALKVIEDEEIFISFGTSISPCVIKPIDETNYTYMILPIR.. 370
94 0.000e+00gi|697205110|ref|WP_033170572.1| DNA polymerase III subunit beta [Selenomonas sp. ND2010]  clstr ali  32  1.MKLTCAKNELVSALQIVSKAVATKPQTPILSGIYLKAEAGILELQATNYEIGMVCRIPAE--------IEEPGQIAISGRYFQEVIRKLPGDSVSLSFNEEKIVHIQSNQANFTLLSMNASEFPTIKPMEGNLQFKIKDNVLRSLVKKTVFACSNDESRPVFTGCYLEVADTKVTMAATNTHRLAVKYETFDESIGNIKIIIPSRILQELLHMTSEIPTDVTVTCTYNQISFAFENLYMTSRLIEGAFPDYRRVIPPEFATVVILDAHEFSSAVDRVSLISRAGDYNIIKLEFANNQVHITSNNPDIGNAEESV-AASIEGPELTIAFNAQYIMDVMKNIDSDTCQIKLNQPLSPAAVRESDDEEFIYIVTPVRT. 368
95 0.000e+00gi|550980319|ref|WP_022728427.1| DNA polymerase III subunit beta [Fodinicurvata sediminis]  clstr ali  30  1.MKLTIERAALLRSLAHVQSVVERRNTIPILSNVLMEAQEGRLGLTATDMDLTIVEHTAAS--------IEEAGATTVSAHTLYDIVRKLPDGEVELSVGDGGQLRLRAGRSNFTLSTLPREDFPAVGPTDLPNVFTLQGGEAKSLIDRTRFAISTEETRYYLNGIYVHAASSVLRAVATDGHRLARFEMPLPEGASGMGVIVPRKTVNELRKLIDEVDDGIEVALSDTRVRFTFGNTTLTSKLIDGTFPDYERVIPSGNDKTMSVDCKVFASAVDRVSTISTEKSR-AVKMSLGDGSLTLSATSPEAGSAEEEV-VIQYDGPPIEIGFNSKYLLDIAHQIEGEGAEFMLADSSSPTIVRDVADTSALYVLMPMR.. 371
96 0.000e+00gi|652476169|ref|WP_026870857.1| DNA polymerase III subunit beta [Inquilinus limosus]  clstr ali  27  1.MKLIIERAALLKGLSHVQSVVERRNTIPILSNILLRADGGTLRLTATDMDLEIVESVPAE--------IQAPGGTTAPAHTLYDIVRKLPDGQVEIETNDGGSLTLRAGRSNFRLGCLPVEDFPSMAGGDLSHRFTIAAGDLRVMIDRTKFAISTEETRYYLNGIYLHAATAVLRAVATDGHRLARVEMPLPDGADGIGVIVPRKTVMELRKLLDETGETVEVQLSETKTRFTLDGVVLTSKLIDGTFPEYERVIPSGNDKILEVDAKEFAKAVDRVSTISTEKSR-AVKLTLENGSLTLSANSAEQGSATEEIEV-SYDAPRLEIGFNSRYLLDITQQIEGDGARFAMADAGSPTIVRDTADSSALYVLMPMR.. 376
97 0.000e+00 [EC:2.7.7.7][KEGG:K02338] DNA polymerase III subunit beta;|[COG0592] DNA polymerase sliding clamp subunit (PCNA homolog)  ali  34  1.MKITCSKNQFLYGVNTVSKAVSNKTTMDILQCILIEAYDDCIKLTANDTELGIETVIEGT--------IIEPGKIALEAKIFSEIIKKIPDNDVCIETDESGKTNIECEQIQCSIMGRKGDDFSHLPEIEKENKITLSQFDLKEVIRQTIFSVSDNENNKLMTGELLSIENNKMTVTSLDGHRISVRNIELQESYPKMEVIVPGKTLSEVSKILPEAKDTINLYLTDKHILFEFGETKVVSRLLEGKFYNIGQMLSNDYETKLTINKMELLRCLDRSTLFVKESDKKPIILKIENEQMNLMI-SSQIGSMKDQIVISK-EGKDLVIGFNPKFLVDALRVIDEEEVTIYLINSIAPCIIRD-EKSSYLYLILPI... 363
98 0.000e+00gi|657611024|ref|WP_029422163.1| DNA polymerase III subunit beta [Alicyclobacillus macrosporangiidus]  clstr ali  37  1.MKFTIAQPALLNVLQTASKAVAVRTTKQVLTGILLQAEAGRLIATAYDLELGIRVEVPA--DDVNLLSVQEPGAIVLSARYLADVVRKLPNREVSVGVGSNYMTEIRCGQVEFHLHGIDAAEFPLLPVFQSSQSLQVTSDHVRELVRATAFASATSEVRPILTGVHVELGTGRLQFTATDGLRLATRWISAEAGDSAWNVIIPSKSLVELAKILPDDNVPVQLYVSDSHSLFVVGTTHFYTRLIEGTYPDTTRIIPSTHRTEVAIDAGLMADAVDRAALIARDRENHMVRFEISGTSIQVSSSSSEIGNVSERIEANRMEGDDLSIAFNARYVLDALRALSADEVVLQFNGPNQPFTIRESGAENGLQLISPI... 372
99 0.000e+00gi|493752629|ref|WP_006701540.1| DNA polymerase III subunit beta [Facklamia ignava]  clstr ali  42  1.MKFTIKRTAFMNQLNNVSRAISSKSTIPILLGIKMTATEEGITLVGSDTELSIEGFLP-IKDESLGLSIESTGSVVVTSRYFLEVIRKLPADTVTVEVNDQAIVNIQSGQSHFTLNGIDGNQYPLLPEIISEESIQLPTELFKELIAQTIISTSNQETRPILTGVNITLKGKQLTGVATDSHRLSQRTIEIDQELEIESMTIPKKTLNELSRIVED-EDHIKLIISDEQLIFALKNLTIYSRILEGNYPDTDRLIPTEHATRIVVNADTFYHAIDRASIMSNQGKNNVVRLEIEDQRVELSVYGSQLGSSNEAIETQTVTGESLQISFNPDYMKDALKTFNGTDIQMDFQSNVRPILLTAVEDENLIQLLTPIRTH 380
100 0.000e+00gi|524031439|emb|CCY14519.1| dNA polymerase III subunit beta [Eubacterium sp. CAG:146]  clstr ali  33  1.MKITCPKNQFLYGVNTVSKAVSNKTTMEILQCILIEAFDDCIKLTANDTELGIETVIQGT--------ILEPGKIALEAKIFSEIIKKIPDNDVYIETDEAGKTNIECEQIQCSIMGRKGDDFSHLPEIEKENKITLSQFDLKEVIRQTIFSVSDNENNKLMTGELLSIENNKLTVTSLDGHRISVRNIELQESYSKMEVIVPGKTLSEVSKILPEAKDTVNLYLTDKHILFEFGDTKVVSRLLEGKFYNIGQMLSNDYETKLTINKMELLRCLDRSTLFVKESDKKPIILKIENEQMNLMI-SSQIGSMKDQISISK-EGKDIVIGFNPKFLVDALRVIDEEEVTIYLMNSIAPCIIRD-ETSSYLYLILPI... 363
101 0.000e+00gi|503061603|ref|WP_013296579.1| DNA polymerase III subunit beta [Thermoanaerobacterium thermosaccharolyticum]  clstr ali  34  1.MKFSCDKISLLNAVNKVIKGVTPRTTLPILQGILLTAKDNKLVMYSTDMEIGIECKVDAE--------IVEEGSIVVSSKVFSDLVRKLPENTIYFTTDQDYIVNIKCGLSEFTISGNSSEEFPEIPEVLKEITFSINQNVLKEMIKMTSFCVAQDMTRPILTGILMEISKNTINMVALDGYRMAIKKYISEDEFDDFSVVIPGTTANELVRIMEDNDDNVYVSFTGNQILFEINDTKVISKLLDGNYMNYKAVIPKDFKSIVIIEKDDLIGAIDRASLLAS-NKSNLIKFTFNERELIISSNS-EKGKMSERVNI-DIEGNLIEIAFNSRYLLEALRVIDSEKIKMNMINSINPMIITPVEDDDYLYMVLPVK.. 367
102 0.000e+00gi|496231528|ref|WP_008945563.1| DNA polymerase III subunit beta [Oceanibaculum indicum]  clstr ali  30  1.MKLIIDRAALLKPLAHVQSVVEKRNTIPILSNVLLRADSDRLALTATDMDIDVVEEVGAE--------VSQPGATTVAAHTLYDIVRKLPDGQIELTEDEGNRLTVRAGRSTFSLATLPTEEFPALSDGDLPHNFMLQAGELKAMIDRTRFAISTEETRYYLNGIYLHAASNNLRAVATDGHRLARVEMPLPDGAAGMGVIVPRKAVGELRKLLEDSEGDIRVALSETKLRFQFGDVTLTTKLIDGTFPDYERVIPTGNDKTLQVGRKEFAEAVDRVATISTEKSR-AVKLSLQDGMLVLSATSPENGTAIEELEVAYGAG-PIEIGFNSRYLLDITTQIEGDEAQFSLADAASPTIVRDQADESALYVLMPMR.. 371
103 0.000e+00gi|524819932|emb|CDF12990.1| dNA polymerase III subunit beta [Eubacterium sp. CAG:581]  clstr ali  32  1.MKFTCSRTDLSNAVTCVQRAVATKASTPSLEGILIKAYDSNLNLSGYDLEIGITTDLEV--------QIDTEGEIVVSAKLFGDIIRKLPEEVVTIETDERMVTYITSGNASYQIVGLSAAEYPDLPKFEETDKIVINGGILKDMIRQTIYAVSDNTSKPIYTGSLFEIKDKIMTIVAIDGYRMAIRKEQIDSDSEN-SFVIPKKTQSEVLKLITDEEENVEIVIGQRHTLFKVGSFYVISRLIEGQFIDYNSTIPTGTATEAVVNTREISSAVERMSLLASEKIPSPVKCEFSSDEIKLTCKTS-MGKANDSIRTT-ISGDDVEIGFNNRYLLDAIKNCETDEIRLILNGGLSPMIIKPVKSDDFLYLVVPMR.. 363
104 0.000e+00gi|671530529|ref|WP_031514346.1| DNA polymerase III subunit beta [Desulfotomaculum alkaliphilum]  clstr ali  32  1.MRINTTKENLLNGVQMVQRAVSTKNPMPILTGILLESKDNKLKLTATDLEIGIECNVEVTT--------IEEGSIIVPAKYITEIVRKLPDVPIDLTGDENNTITIQYNSSQVNLHGFNADEYPAFPVVEGNLSFAIPTNTFKETLRQVLYATNTDESRPVFTGVLFEIKDGLLTLVATDTHRLALKKVAIDEEPAELETIIPGRTLGEISRIISDDEDVIKITLGSNQALFTIKNTVIVSRLIEGQFPNYQGVIPKNHKSKVRIKVKELLDSTERAALLTKTGRE-TIRLDIKKDLLMLSANT-DVGFIQENLNCY-LEGEEVSISFNARYLTDVLRTVGEEEIILELSGPLSPGVIRPPRGDNYLSLILPVRT. 367
105 0.000e+00gi|494495737|ref|WP_007285204.1| DNA polymerase III subunit beta [Intestinibacter bartlettii]  clstr ali  35  1.MKIICNQKLLANKIGIVQKAINSKTTLDLLKGVLIVTKQDEIILKGYDLEIGIESHVPAE--------VIQEGSIVINSKLFGDIIRKLPDSFVEIETDEDNNVYINCLNSKFKIKGDSAKEYPQIPDVNEDKLYSIPQDVLKSMIKQTVFATSQDQTKPILMGELLEIENGNINLVAIDGYRFAVRSCQVDNEDLKAKIIIPGKTLIDVNSLLS-SEEEVKVGFNEKNAIFIINDTKIVTRLLEGEFIDYKKLCPREYNSKIKLKTKDLLNSIERASLLSQSEQNNLIKLSIRDSMMAITSNN-EKGNVYEEVS-LSLEGDYLDIAFNSRYLLEGLKNIDCEEIYIEFTTNVNPCIIKPADGTKYTYLLLPVR.. 366
106 0.000e+00JGI.Meta 7066252560 SRS056519_LANL_scaffold_35950__gene_78154 DNA polymerase III, beta subunit [Human Stool microbiome from visit number 2 o  ali  34  1...........................MPALEGVLFVAKDNAVSLTCSDLALSIECSLPA--------NIQEEGALVLPGRMFAELIRKMPPDTVSIST-EGLKVTIECGQAKYNLQGMDAREYPEMPPMTGARPLELKQSALKNMIQRTAFAVAMDETKPILTGELLEIESDRVTLVALDGYRLALCKEPLLQATTPVNFVVPGRSLSEIAKLFEDSDAPASISIGDTQAMVEMGHTKIITRLLEGEYINYRQILPGDHQTRVRIQAQQFLDSVERASLVARDSRNNLIRLQLDEDTMTITAN-GEMGNAVEKLPIY-LEGKPLTIAFNAKYLLDVLRVIKDEEILLDFISGLSPCVVKPLEGDQYLYLVLPVR.. 338
107 0.000e+00gi|524145725|emb|CCZ18033.1| dNA polymerase III subunit beta [Clostridium sp. CAG:780]  clstr ali  34  1.MKLICEKDKILKALNSVTKAVAVRTTMPILEGILIQTNDNEIKLTTYDLEIGIEYII-------NDCKVEEQGATVVNAIMFTEIIRRLPDTDIKITLNDKNLLVIECEGSLYKLATMNPDEFPELPKINVENSIEIEQNTLKDMIRKTIFAVSTEENRPIFTGCLFEIANNKLNVVAVDGFRLAWKSKFLQNKVNNFSAVIPGRTLNEINKILLDSFDMIKIGVAKNQVLFEMENCKIVTRLLDGEFLNYSSVIPENWETRIRVKRSILQDCFERISLISSSEKKYPVRVAVDIGKLTISCTN-QTGDAKEEIYLT-TEGKNLEAGFNPKYFLDALRNIDDDEIFVNFGTSISPCIIRPVEEEDYTYMILPIK.. 370
108 0.000e+00gi|545616672|ref|WP_021740637.1| DNA polymerase III subunit beta [Eubacterium ramulus]  clstr ali  33  1.MKIICKKTDLAKAVQTVAKAVPAKATTSILECLLLRAEKEEITLTGNNLELGIETVMPG--------NIEEEGSIAIQAKVFGEIVRKLPEGDVVLETGEKDQATVRCKKTKYNLSVKSAEEYTCIPDMERKNHVTISEFDLKEAIRQTIFSVADTSSKKAMTGELWEINGKELKIVALDGHRISLRKIKLKKEYEPRKVIVPGKTLAEIIKIIGDPEKEIAVYFTENHIQFEIENTRAISRLIEGEYLKVEQLLSKDYGTKIKVQKKELQECIDRASLLLKDDAKKPIILNIEENILSLEAAS-NMGSMNESMFVVK-EGEKLRIGFNPKFLLEMLRVIDDEEVFMYFTSAKTPCTVRD-EKDSYVYLVLPV... 363
109 0.000e+00gi|488973051|ref|WP_002883965.1| MULTISPECIES: DNA polymerase III subunit beta [Streptococcus]  clstr ali  39  1MIQFAINKAYFLQALHTTRRAISSKNAIPILSTIKIEVTSDGIYLTGSNGQISIENSISVSEENAGLL-ITQPGSILLEANFFINVVSSLPDVTLTFEEIEQYQVLLKSGKSEITLKGKDVEQYPRIQEVDSLTPLLMDTKVLKSIIAETSFAASTQESRPILTGVHFVLSNHKLKAVATDSHRMSQRQLVLEHSADNFDVVIPSRSLKELSAVFSDDIENLEVFFSANQILFRSETISFYTRLLEGNYPDTNRLLSDSFETEVVFETASLRSAMERSYLISNASQSGTVKLEIINGSVSAHVNSPEVGKVNEDIDVQDVSGSDLVISFNPTYLIDALKALKSETVRVRFISPVRPFTLTPADDENFIQLITPVRT. 377
110 0.000e+00 GL0053734 [Complete] locus=scaffold2963_1:2954:4066:-  ali  29  1.MKFSCEKALLQSAIAVTSRAVAQKSSIPALEGLLLHA-DSRLTISGYNLQTGIRTKVSA--------DVTEPGEIVLNARLFGDIIRRMPDDVVVFTADDKQLVHLSCGDADFDILGLSAADYPELPMVEDDFFVSIQQKLLRAMIEETAFAVSTNESRPIHTGALFEITDQGLTMVAVDGFRLAIRREPLEKDGGAFSFVAPGSALGEVKNICSDVEDLAAVTLGKSHILFEVGDTELICRRLEGEFLDYKNAIPRKNPISVIADTKALIESIDRVSVVISEKQKSPVRCLFDHDKVLLSAKTGN-GEAKDICRLSG-DGGGLEIGFNNRYLMEALRYAPADTVKIELNTGVSPAIIVPTEGENFLYMVLPVR.. 365
111 0.000e+00 GL0023173 [Complete] locus=scaffold94357_1:2169:3260:-  ali  35  2.......KGKLMQGISNVSKAVSTKTTHPILSCIFIEAENGNIKLTANDMEIGIESYVEGT--------VIEEGKVAIEAKLLSDIVRKLPDSEIHMETNEDFKTTIKCEKSLFTIAGKSGEDFSSLPVVEKSKFITISQFTLREIINQTIFSISDSEYNNVMTGELFEVSNNRLRVVAIDGHRIAIRNVELKNESEDVKVIVPGKALSYISKIVSGGDDDVNIYFADNNILFEFDRTKVVSRLVEGEFFRIDNMLNVDYQIKFTINKREFLDCLDRSSLLIKESDKKPIKLTIEDNMLYLKIDSL-IGSMNEEIEIHK-EGNNIIIGFNPKFLMDAIRAIEDDDITIYMNNTKSPCVIKD-EEESYIYLILPM... 358
112 0.000e+00gi|654658408|ref|WP_028119329.1| DNA polymerase III subunit beta [Facklamia sourekii]  clstr ali  40  1.MKFTIKRQPFNNQVANILRAIPSKSTIPVLTGIKLAANQNELVMIGSDSEISIEAFLPV-ADPEYQLDIQTTGQVVVAARLFSEIIRKLPEDTVTIEVDDQLQVSINSGKANFTLNGMAGDSYPQLPIIQGDNQLELPTNQFKAMINQTIFSASNQESRPILTGLHLTSHANHLEGVATDSHRLSKREIPLPENFQAFSLTIPKKTVTELSRIVED-DQDLQMIISDKQVIFTIENLTIYSRLLEGNYPDTDRLIPSDYSSQIIVNSSEFLAAIERASLISHQGKNNVVQLNIEADQVTLSVRGNERGQAIEVIPSQSVTGEAIRISFNPDYMKEALAAFDGVDVKIELQSPVRPIIIRALEENELVQLLTPIRTH 382
113 0.000e+00 GL0194025 unmapped_[Complete]_[mRNA]_locus=scaffold134460_2:1722:2831:-  ali  30  2..KFSCSRPELYEIVSNVSRAVSGKTSLAVLEGILIRAKSGVLSFLGYDLDLGISAQMDA--------QVEEEGEIVLSAKLFVDMMRRMNGDTVTIHTDEKYLTEIKSGATEFTILGIPSDEFPEIPVVQEEQSISLPQHLLKSMIDQTLFAISTNDSKPVHTGSLFQLEDGELRVVSVDGFRLALRREKV-SAEGSAQFIIPGKTLSEMNKLLSDEDEETRLYLSRKHVVVQIGQYKVISRLLEGEFLDYKAAIPAGSNSTVTVDVRPLIDSIERTSLLISDRLKSPLRIHFEENQIKMSCSTA-IGKAYDQLECL-LEGDEVEIGFNNRYMLEALRATGCDKVNLLISGPLAPMKMVPLEGDNFLFLILPVR.. 364
114 0.000e+00gi|948255307|ref|WP_056912873.1| DNA polymerase III subunit beta [Pseudolabrys sp. Root1462]  clstr ali  29  1.MKVTVERAELLKSLSHVYRVVERRNTIPILSNVLIRADKGKLSMKATDLDLEVTDSIAAEVAPG--------GATTVPAHMFYDIVRKLPDGQIVIESGDRAVLSIRAGRSRFTLQTLPESDFPDLAAGEMSHSFSLPAGDLKRLIDKTQFAISTEETRYYLNGIYLHAAGKMLRAVATDGHRLAQVELPLPEGAVGMGIIIPRKTVAEVQRLIESGEGEVAVELSAGKIRFSIGNVVLISKLIDGTFPDYGRVIPANNDKSLVVDKKDFEAAVDRVSTVSSERGR-AVKLSITGGRLVLSVTNPDSGSATEELEV-DYESDALDIGFNSRYLLDIAAQIEGEVAVLKLADPGSPTLIQDKDAKGALYVLMPMR.. 367
115 0.000e+00gi|972257339|ref|WP_058963432.1| DNA polymerase III subunit beta [Ruminococcaceae bacterium AM2]  clstr ali  29  1.MNIVCDKALLSSAIDGVSKAVTLRSSIPALEGILLKAEGFQLTLTGYDLEMGITTTIEA--------NVRQAGEIVLSAKLLGDMVRRLPSGEVSIYTNESGNATIKGGVAEFDILAMSASDYPDLPTPGADHTLTIKAGMLRGMIEKTLYAVSQDDKKPAHTGELFAIEEDKLTVVALDGYRLAIVERPV-QAEKHIRIIIPAKTLTEVNKLLGDDEDDVRISANRRFVVFNSGNYTILSRLIEGEFLNYANVIPNGCKTRVVLETRDFIDTIERASLIITERLKNPLRILFDSGKVTVRCQT-NLGKVVDEFSAQ-VEGDPVEIGFNNRYLLDALRNARCEKVVLELSGPLSPVKILPEEGEDFIYLVLPVR.. 364
116 0.000e+00 GL0066080 [Complete] locus=scaffold15343_1:49:1155:-  ali  34  1.MKFVCGTAELSEACLNVQRAVSTKTSIPAVEGILIKAVSGQLILTGYDLELGINTAIKAT--------VEEEGSIIINARILCDILRKLPGDSVRFEADARSLANIVSGNAKYSLIGMSADEYPELPSVSGGYPIVINQGVLKDMVRQTIFAVAVNDSKVVHTGVKFDISGNELKLIAIDGFRLAVRKENIDYSGDDISFIVPAKTLSEIMKLMNDDDSTISLGVGKRHIVFEIGSYSVVSRLLEGEFLNYESAIPPKCTTRVKVNTRDMINSIDRASLIISEKYKSPIKCVFADNMIRLSSVTS-LGTASDSV-AAEIDGDDVEIGFNNKYLTDALRVADTDEVRFKLNGPISPIIILPPDGDSFLFLVLPVR.. 364
117 0.000e+00gi|657939950|ref|WP_029641047.1| DNA polymerase III subunit beta [alpha proteobacterium Mf 1.05b.01]  clstr ali  28  1.MKITIERGALLKSLNHVQSVVERRNTIPILSNVLMRAGQGQLSLTATDLDI--------EVVEATTADIGQEGGTTASAHTLYDIVRKLPDGQVEITDGEDGKLTLQAGRSRFALQALPQEDFPAMSAGDLPHRFEMPAEALGRLIDKTRFAISTEETRYYLNGIYLHMVEDMLRAVATDGHRLAQADFPLPDGAAGMGVIVPRKTVLELQKLVEEEEGIVRIGVSDTKIRFEFGGVVLTSKLIDGTFPDYTRVIPEGNDKDMEVDGKKFAEAVDRVSTISTERSR-AVKLNMEEGRLILTVTNPDSGSATEELGVA-YSSDALEIGFNARYLLDIAGQLDGDKAVFSLADSGSPTVIRDVDDESALYVLMPMR.. 369
118 0.000e+00gi|499862726|ref|WP_011543460.1| DNA polymerase III subunit beta [Lactobacillus delbrueckii]  clstr ali  40  1.MKFTVQRNLFINDLNSVLKAVSSRAQIPILSGIKLELTEAELIMTGSNADISIELSQPVSDD----LRVESTGSIVVTAHLFSEIVRKLPGREFTFEVKEGNQIQITSDKADYVINGLDASAYPRLPEI-AGTSFSLPSKTLRELITQTVFAVSTEESRPTLTGVNFSFKNGQIKAVATDSHRLSQRIVDIAGPSEDLSLIIPGKNLQELAQIIGDADQDIKVYLGDSQIRFEFENLSFYTRLLEGVYPDVDRLLPTESTTSVQFTVSDFMQTLSRASLLTHANRTNAVQMTLNDQTVLVSGNSPEVGKIEEEVGFSSLTGRDLTISFNPDYMAAALRASVTDSVIINFTESLRPFTVVPNDQSEFVQLITPIRTF 375
119 0.000e+00gi|497243219|ref|WP_009557436.1| DNA polymerase III subunit beta [Lactobacillus equicursoris]  clstr ali  40  1.MKFTVNRSYFINNLNSVLKATSSRSTIPILEGIKMVLTDEGLVMTGSNTDISIELLVKASDD----LQIASTGEIVVRAHLFSDIVRKLPGKDFTFDVQEGNQIKITSEHAEYMINGLDPSAYPRLPEISDDQSFAISAKTLRELITQTVFAVATDNSRPTLTGVSFTFSQKQIKAVATDSHRLSQRVVGVDNPSEDLSLIIPGKNLQELAQLIADADEDLKVFLGDSQVRFDFDNLSFYTRLLEGAYPNVDRLLPATSSTSVQFHVSDLLSALSRASLVTHVNRTNAVQMEIENNRVNLTGNSPDLGKVEETVENLGIEGKSLTISFNPDYMSAALRASVTDIVVINFTEALRPFTVVPNDNEDFIQLITPIRTF 376
120 0.000e+00 GL0058291 [Complete] locus=scaffold3383_4:1704:2810:+  ali  31  1.MKFTCEKYLLQSACTIASRAAAGKSPIPALEGLLIKA-DDKITITGYDLKKGIYTGIEA--------DIAERGSIVVGARLFGEMIRRMPDGIVSVTVDEKDNVNIKCGKSEYNIIGISPDDYPEMPKFDAVNNISLPQNILKSMINQTIFAVSTDDIRPIYTGTLFEIEGDELTLVSVDGYRLAKRTEKLESSKENCSFVVPGSTLSDVEKICADEDAPVSISVGEKHISFAIGDTVVVSRRLEGEFLNYRRSIPESFKYELKVDRGELMSVIDRVSLIVSEKNTSPVRITFNDGSIDCVCVTP-IGRADDVCTCDG-NGEGLMVGFNDRYLKDALKAAGKDELFVCVNTASSPCVIKAADGENFTYMVLPVRLH 367
121 0.000e+00gi|1015557953|gb|KYZ75710.1| DNA polymerase III subunit beta [Anaerosporomusa subterraneum]  clstr ali  31  1.MKFYCSKAMLQHAVQAVQKAIATKTPLPILTGIYLSAANNRLELQTTDYDMAISCSIEA--------NIEQPGKAVVSGRFFQELVRRLPGETVEISSNEDSTLRISCNSSNFNLLCFPYEEFPVIEKIQSTNQLTLKDNVLRDIIKKTVFACATDESRPIFTGGLFEAENDSIKMVGTNTHRLALKQDIIAPVELPAKMIIPAKLLNELARSLSDVPVDVNIYWEKGHVAFEFDDIYLKSRLIEGSFPDYNRVIPAKFDTVVFFDTHAFLDAAERVSLMAKDGDYNIIKFRFEQDMITLSSNNPDVGKASETVAAT-MQGPGLEIAFNAKYVTDILKNLGSDKATLSLNNPLSPACIRPADSEKYTYVITPVRT. 369
122 0.000e+00gi|502513109|ref|WP_012809466.1| DNA polymerase III subunit beta [Alicyclobacillus acidocaldarius]  clstr ali  36  1.MEFSLQKQALSNALQIVSKAVAVRTPKQVLMGILIEVHEDEIVATAYDLELAIQTRVPV--GEETGLRVHQTGAIVLPARYFGDIVRKLPDTEIHMRVDANYMTEISAQSVEFHLHGIDAEEFPELPNFMGYESMQIPASTLGRLIESTVFAAATSEVRPVLTGVSITSDPTHLTFIATDGLRLAQHRVP-QADLPERQVVIPAKSLSELSKILPEDETSVEMVLTPSHGLFVIGPTRFYTRLLEGTYPDTSRLIPRSARTQVVLDGDAFLHAIDRAALIARDKDNHMVRLEVTGDTLTVTSHSPEVGNVSETLHALRKEGEDLQIAFNGRYVIEAVRALDAAEIAIRFNGANQAFVIERSGDPSMLQLISPI... 370
123 0.000e+00 GL0039303 unmapped_[Complete]_[mRNA]_locus=scaffold62107_2:1630:2757:-  ali  31  9.MKLTFLKSDLLNAINITLKAVPSKTTMPILECLLIEA-DDEIKITANDMELAIETKVKG--------NILEKGSAAIDAKLFSEIIRKLPDSEIVIDEK-NENITISCEKANFNISGRRSDDFVHMPAIETEEHICVSQFTLKEIIRQTIFSIAPNENNKLMTGELFEVKDDNLKVVSLDGHRISIRNVQLKEHYENRKVVVPGKTLMEISRILPDADKDVMIFFSKNHILFQFDQTLVLSRLIEGEYFKIDQMISSDFETKITVNKRELLDSIERSVLLVRESDKKPIIINIKDSNMELSLNSM-IGSMREDILVRH-TGKDIMIGFNPRFMIDALRVIDDEEISVYMVNSKAPCFIRDDEG-KYIYLILPV... 369
124 0.000e+00gi|651374875|ref|WP_026487101.1| DNA polymerase III subunit beta [Caldanaerobius polysaccharolyticus]  clstr ali  34  1.MHIVCERNKLSTAVNNAQRAVSDRSTLPVLEGILLKTEGSTLTLTGNNTELAIKCSLEAE--------IKEEGCIVVPSKIFGDIVRKLPDNRVTISNGESNIVTLESGYSKFEIMGLDPSEFPEIQKITSDEFLLVEAKKFNNMIKKTIFAVTQDETKPVFTGELLSVNGNQIRLVALDGFRLAIRNDEIKTGPSDISAIIPGRNLSEISKILSDIDGDITVFFDDKSVQIEAERITIVSRLLNGNFINYEKIIPIEYKTRVIADTKELQDCIERASVIHRDDKSNTVRVYINDNRIKITSNS-EFGKVYEEIPAN-VEGSDIEIGFNTRYMLDILRAIDDDSIYMEFTNSVGPCIIKPISGNSYIYFILPVK.. 366
125 0.000e+00gi|551005260|ref|WP_022749936.1| DNA polymerase III subunit beta [Lachnobacterium bovis]  clstr ali  33  1.MKFICSKSNLYNGVKTVQRAVPTRTTMPILECILIDATTNEIKLTANDTELGIETIIEG--------DVQEHGIIALDSTIFSNIVSKLPDNMVTIETDENFKAHISCEKAKFDILGKSGDDFSYLPFIEKSQGITISQFSLKDVIERTSFAIANDDNNKLMTGELFKINENNLEVVALDGHRIAVRYIELKESYSPRELIVPGKTLKEIKNIIPGNNENVLIYNTNNHIVFEFEKTTVVSRLIEGDYFKIDSMLSTDYETKVQINKKELYESIDRATLLVKESDKKPIIMNITDSNMEVMINSY-IGSMDENIDIEK-DGRDIMIGFNPKFFTDALKAIDEDEINLYMINPKAPCFIKDDKG-TFIYLILPV... 363
126 0.000e+00gi|522190105|ref|WP_020698653.1| DNA polymerase III subunit beta [Reyranella massiliensis]  clstr ali  30  1.MKLTIERAALLKALAHVQSVVERRNTIPILSNVLITAQKGRLSLAATDMDLAITETVEANA--------SKTGSTTAPAHTLYEIVRKLPDGQVELETSDGGSLTIRAGRSRFTLQCLPPADFPAMTEGDLPHRFQLPATDLKGIIDRTRFAISNEETRYYLNGIYFHAATEVLRGVATDGHRLARVEVPLPKGAGEIGVIVPRKTVGEVRKLLDESDGSVDVELSDTRIRFASGNVTLVSKLIDGTFPDYERVIPAGNDKVLNVPCKEFAHAVDRVSTISTEKSR-AIKLAVAKGVVTLSATSPDAGSATEEIEV-EYQDTALEIGFNSRYLLDITEQIAGTEARFLMADAGSPTLVRDGADESALYVLMPMR.. 371
127 0.000e+00 GL0003957 [Lack 5`-end] locus=scaffold32315_2:2099:3244:-  ali  30  11.MKIKCSKVNLLNSLNIVSKAVSTKTTLPILECILIDVYADSIKLTANDLEIGIETILDGE--------VIEMGRIAIEAKLFNDIVRKLPNSEIFIETTPDYNTIIRCEKSKFVIPSKSGEDFTELPQIEKEKSIELSQFSLKEIIRQTIFSISDNENNKLMTGELFEVKDGVLQVVSLDGHRISLRNLALKGNASNVSVVVPGKTLNDLSKIITGGDDMVTVYFTDRHILFEFENTIVVSRLLEGEYFKIVQMLSMDHKIKVRVNNRELFDCIDRASILMRESDKKPIVVSIKDNRMYLKVDTM-MGSMNEEIEITK-DGEEIIIGFNPRFLTDVLKVIDDEDIFIYMRDAKSPCIIRDDAG-TYIYVVLPV... 374
128 0.000e+00gi|653035735|ref|WP_027287423.1| DNA polymerase III subunit beta [Rhodovibrio salinarum]  clstr ali  29  1.MKLTIERAALLKSLGHVQSVVERRNTIPILSNVLIEAGSGAAKLTATDMDLTIVEEV--------GCQVAEAGATTAPAHTLYDIVRKLPDGQVELDVQDQGQMSLKSGRSTFQLATLPKEDFPATQANDLPQAFSLQGKELRELIDRTRFAISTEETRYYLNGIYVHATSGELRGVATDGHRLARFEMPVPDGADGMGVIVPRKTVNELRKLIDETDGGIEVALSDTKIRFTFDSTVLTSKLIDGTFPDYERVIPSGNDKMMEVDRKAFASAVDRVSTISTEKSR-AVKLSLADNTLTLSATSPENGSATEELEI-SYQGDNIEIGFNSRYLLDIAERLGGDGAQFSLSDSASPTIVQDAGDTSALYVLMPMR.. 373
129 0.000e+00gi|780368757|ref|WP_045574319.1| DNA polymerase III subunit beta [Desulfosporosinus sp. I2]  clstr ali  33  1.MKIFCSKDALLAGVNAVQKAISNKNTLPVLQGILVTAEAQFLHFSATDLEMGIRCQIPST-------TVTEEGTMVVPAKLFSEIVRKLPDTTITLEEKDK-SITICYNESEIVLNGYDPEEFPLLPDLMEPITFTLPTIIFKNMIRQTVFSCSTEENRPVFTGTLLQIEGTNIRLVATDTHRLALSIASISNSEESFSGIIPSKTLTEIYRLLRDEDEELTISYGNNQVVFQFGSIYLISRLIEGQFPNYKQVIPQSCETKVILSVRKLLESVERALVLTRDKSANIIKINVKNNELKID-QTSELGKISEQI-VVEMEGKDVTIAFNAKFLIDALKVIDSDQILFELSGPFSPGVMRPLDNSNYIYLVLPIRT. 367
130 0.000e+00gi|518385130|ref|WP_019555337.1| DNA polymerase III subunit beta [Propionispira raffinosivorans]  clstr ali  33  1.MKFTCPKDELVQAVQIVSKAVSSKPQMPILSGIYLNATNNTLELQATDYEIGITCKIDA--------QIDEPGAIVLSGRYFQEVTRRLPGENVEIISNADQTVKISSNTAEFNLLSLPANEFPTVQQLTGNITFQIRDNIFRDLIKKTVFACSTDEARPVFTGCLLEVNNSDVVMVATNTHRLSIKREILDDFTGNIKIIIPSKILNELTKIISEIPSNVTVNCSYNQISFAFDNVYITSRLIEGQFPDYQRVIPPEFNTKIKINTHAFQSAVDRVSLISRAGDYNIIQLVFTENKVVITSNNPDIGKAEESVPV-SIEGPEIDIAFNAKYVTDILKNIESEIFYFSLNKSLTPANIKPSDDDTYNYIVTPVRT. 368
131 0.000e+00 GL0013797 [Complete] locus=scaffold5134_4:2876:3982:-  ali  29  1.MHIICPREELQKGVSIVSKAVSNKTTMPILECILIQTKEGRILMTANDMELGIETEIHGI--------IEDNGHIATDAKIFSEIVRRLPDNDISIETDGTDSVKIQCEKINFTIPGKNADEFTFLPEVERLNCVTLSQFTLKEIIRQTIFSISDNENNKMMAGELLEINGNNLRIVSLDGHRISIRKIVLKDSYDSIKVVVPGKTLNEVSKIISGTDDEVRLYFTENHVMFEFDDTIVVSRLIEGEYFRIDQMLNSDYDTKLTVNKKEMLSCIDRTTMLIKDSDKKPIIIGITDHSMEVKLNSA-YGSMKEELAIDK-RGKDILIGFNPKFLIDALRVIDDEMINIYMINPKAPCFIRNDEG-TYIYLILPV... 363
132 0.000e+00gi|545421246|ref|WP_021660072.1| DNA polymerase III subunit beta [Clostridium sp. ATCC 29733]  clstr ali  31  1.MKFICDRQSLSEAMLNIQKAVPGKSNIPALEGVLIQTGEDGITLSGYDLEFGITTQIPAE--------IEETGTIVLPARLFSDIIRKLSDDSVSVTVDANLLTTVTTKQTEFTIIGIDAAEFPAIPQIDGEKTLSIDQASLKSMIEQTLYAVAQNDQKPVHTGIKFEAEEGILTLVAVDGYRLALRREPA-QILTPCDFIVPGRTASEIAKLIKEEENQADVYLSPKHILFQVSGYSVFSRLLEGNFLDYKNSIPKSSNTVVTVATRTFIDSVERASIIINDRFKNPLKISFEDATVSVLCKTP-LGKVQDEFVANK-QGDDIEIGFNNKYLLDALKYAHCDEVKLSFTSSLTPMTVTPPEGDSFLFLVLPVR.. 363
133 0.000e+00gi|494979097|ref|WP_007705121.1| DNA polymerase III subunit beta [[Clostridium] asparagiforme]  clstr ali  33  1.MKLRFQKDALVNGINIVLKAVPSKTTMSILECILIDASGSEIKLTGNDMELGIETTVAGE--------ILEHGKIALDAKLFSEITRRVSSESSAIESDERFNTTIRCENSVFNIQGRDGEEFAYLPYIERDKYICLSQFTLKEVIQQTIFSISPNDSNKMMSGELFEVNENQLQVVSLDGHRISIRKVRLKDHYDDIKVIVPGKTLGEVSKILGDNEKEVLIYFSANHILFEFDSTIVVSRLIEGEYFRISQMLSSDYETKVSVNKKEFLDCIERATILIRENDKKPLIINITDNSMQLKLNSS-FGSMNADLLIHK-NGKDIMIGFNPKFLIDALRAIDDEEINLYMMNPKSPCFIKD-DEENYIYLILPV... 366
134 0.000e+00 GL0173686 [Complete] locus=scaffold11259_1:316:1458:-  ali  29  11MVRFSCEKALVQQAVAAVSRAVAAKSSIPALEGILLEC-GEGLRLSGYNMQTGIRTTVEAA--------VSEAGHIVLNARLFGEMIRRLPDDMVTFEADDKFNVKLNCGDASFELPGLSADDYPELPEVDDQFSVTLEQRTLKAMINQTSFAVSVNEARPIHTGALFEINDKGLTMVAVDGFRLALRREPLEHDGGAFKFVAPGAALNEVEKICADTDDMVTVTQGKRHLMFEAGATQLICRRLEGEFLDYKNAIPTTNPICIEVDNKTMIESLDRVSVVISEKLKSPVRCLFSQDRVYMSARTGN-GEARDICPVRDVQG--LEIGFNNRFFMDALRYAPADTVKMQLNTGISPCIITPLDDDNFLYMVLPVR.. 376
135 0.000e+00gi|639442444|ref|WP_024621730.1| DNA polymerase III subunit beta [[Clostridium] mangenotii]  clstr ali  36  1.MKIIISQKTLANKIGIAQKAINSKTTIELLKGILLVAKNDQLKITGYDAEIGIETYTQAE--------VQEEGEIVVDARLFGDIIRKLPDSFVELETDNENNIYINCVNSKFKIKGYPAKEFPKLPDVEDGALCDIPQELLKNMIKQTVFAISQDQTKPILMGELLEIQDGNISLVAIDGYRLAVRTSNFENPIQNVKVIIPGKTLIDVNSLLT-SEESIGLGFNEKNAVFMIKDTKIITRLLEGDFIDYKKLLPKEYNTKVKLNTRDLLDSIERASLLSQTEKNNLIKLSIRDEIMAITSNT-EKGNVYEEV-ALELDGDYLDIAFNSRYFIEGLKNIESEEIFIELTTNVNPCIIKPSNGTDYTYLLLPVR.. 363
136 0.000e+00 [EC:2.7.7.7][KEGG:K02338] DNA polymerase III subunit beta;|[COG0592] DNA polymerase sliding clamp subunit (PCNA homolog)  ali  34  13IMKISCMKNSFLQGINIVMKAVSNKTTHPILSCILIEAANGKIKLTANDMEIGIESYIKG--------NVTEEGKVALDAKLLSDIIKKFPDSEVFIDVNEDFKTTLRCEKSKFVLSGKSGDDFASLPEVAKNKCVTISQYTLREIINQTIFSISDNENNKLMTGELIEVNNNTLSIVSLDGHRISIRKVRLKGINNDVKVVVPGKSLSDISKIINGGDDEVKIYFNENNVLFCFNDTKVVSRLIEGEYFRINSMLSVDYEIKITANKRDLLNSIDRASIMIKESDKKPIKLSIEDDLLRLKIDSL-VGSNTEEVEIKK-EGANLIIGFNPKFLMDALRVIDDEEITIYMNNKKAPCLIKD-EQESYLYLILPM... 376
137 0.000e+00 GL0052833 [Complete] locus=C1467348_1:2474:3580:+  ali  34  1.MKISIRKSNLLQGINIVSKAVSNKTTHPILSCILVEAAGGVIKLTANDMEIGIESYVDGT--------VIEDGKVALEAKLFSDFIRKLPDSDITIESDKDSKTLIKCERLEFNIPGKSGEDFSNLPVVSKDKFITISQFALREVINQTIFSISDNENNKLMTGELFEVSNNKLSVVSLDGHRISIRYIELKGDNSDIKVVVPGKSLSDISKIMNGGDDPVNIYFTDNNILFEFDNTKVVSRLIEGEYFRISHMLSVDYQIKMKINKREFLDSLDRATLLIKDSDKKPIRLSIDDRTLGLKISSL-IGSLNEEIDIEK-EGNNLVIGFNPKLIIDALRVIDDENVTIYFNNTKSPCVIKD-DAETYIYLILPM... 363
138 0.000e+00JGI.Meta 7067900315 SRS064557_LANL_scaffold_36234__gene_66734 DNA polymerase III, beta subunit [Human Stool microbiome from visit number 2 o  ali  30  4FMKLTCSQSALAEAVTNVQRAVSSKTSLPVLEGILIKAKNNQITLCGYDLEIGITTVIDA--------DITDEGAIVVSAKLLGDIVRRLPDETVCLETDDRFITYINSGQAEYKIVGIAAADYPELPSFEKTDTLTIQSGLLKNMIKQTLFAVSDNISKPIYTGSLFDIEEHVIRIVSVDGYRMALRKETI-ACEQNSRFVVPGKALSEVLKLVSDEEKNTEILIGQRHAVFQIENYSIFTRLIEGNFLDYKSTIPAGNKTEACVVTRDMIGSVERMSLLTSDKIQSPIRFTVNAEEIKLSCSTA-IGKANDAIK-TPVKGEDVEIGFNNRYLLDALRNTDTDIVKLELNGPLTPMKIVPTEGDAFLFLVVPMR.. 367
139 0.000e+00gi|1016781000|emb|CZT55194.1| DNA polymerase III subunit beta [Eubacteriaceae bacterium CHKCI005]  clstr ali  29  1.MQITCQRQPLLDAATSVQRAVSTKSSIPALEGILLETREGELSLSGFDLELGIVTSIEAT--------VQEEGALVVSARLFVDIIRKMDSDNVSIQTDEKNLIIIQGGQAEFSIMGTPAAEFAELPSLKDGTEVTLPQNLLAGMLRQTLFAVAQTDNKPIYTGVLFELEQNLIRLVALDGYRLAIREEPV-TVDSNFRFVAPGKTLSEVLRLLGDDDQPVTITVGTRHIFFSINRYSVVSRLLDGEFLDYKKSVPQGGNTQVRVKTRALIDSIERASLLISDRLKSPVRCIFEEDEIRISCVTT-AGKVRDQVEA-SLEGDRVEIGFNHKYLLDALRASESDEVRVVLSGPVAPMKVLPVEGEHFLFLVLPVR.. 363
140 0.000e+00gi|1016805860|emb|CVI74064.1| DNA polymerase III subunit beta [Eubacteriaceae bacterium CHKCI004]  clstr ali  33  1.MKIICPKSQFLHGVNIVSKAVSTKTTMDILECILIEAYDGCIKLTANDTELGIETTITG--------DIVQPGKIALEAKLFSEIIKKIPDNDVILETEENGNTSIRCEQIHCNIMGKQGDDFSHLPVIEKENKITVSQYDLKEVIRQTIFSVSDNENNKLMTGELFQIEDNQLTVTSLDGHRISVRKIALQDNYPKMEVIVPGKTLSEISKILPEAKDSVNMYITDKHILFEFENTLVVSRLLEGKFYNIGQMLSTDYETKIVINKLELLRCLDRSTLFVKESDKKPIILKIEDGKMDLMI-SSQIGSMQDQIQMEK-EGKDLIIGFNPKFLVDALRVIDEEEITMYMINSIAPCIIRD-EQVSYLYLILPI... 363
141 0.000e+00gi|89332196|dbj|BAE81791.1| DNA polymerase III beta chain [Desulfitobacterium hafniense Y51]  clstr ali  35  18FMKIYCSKDSLITGVNTVQKAVSNKNTLPVLQGIMIRAEGQSLIFEATDLEIGIRCVVPA--------QVEKEGVVVLPSRLFSDLVRKLPDVLIELELQ-NDVINIHYNESDLSLRGYDPEEFPLLPDLFDAETFNLPVSIFKTMIKQTIFACSAEESRPVFTGCLLQIEDGSLRLIATDTHRLAYRIAEISNPEQKFQGIIPAKTLGEIYRLLRDEDENLFIRFNQAQIVFQFGAVHLLSRLIEGQFPNYKQVIPQSCQTKVLLSARLFQDSVERASLLARDGSTSIIKLSVDTERLSID-QTSELGKISEQMEVKK-EGNDVKIAFNSKFLLDVLKIIDSEEIVFELSGSYSPGIIRPVDDPNYLYLALPVRT. 384
142 0.000e+00gi|502839101|ref|WP_013074077.1| DNA polymerase III subunit beta [Kyrpidia tusciae]  clstr ali  35  1.MRIHVHQQSLAAALQQVQRAVSAHSTMPILGGIKLTADTDSLRLIATNQEIAVETYLAADSD---TLSIEMPGSIVLPARYFVELVRKLPDPWVHLTVQQPYSVQITSAQAAFLLHGFDPEEFPRLPQIASDQPFLIHSDNLKDAIRQTVVAIAAEETRPVLTGLCMKFDADSITFIGTDSHRLASRKLFLQGGPEGASAVVPGKSIHELARLLPEDDTPVTMTIADNTLLVSSDTTRFFTRLLEGQYPDTSKIIPTTFKTRIHIRRDPFASALERALLIAREMQNQVVRLQLQSDRIELSAHSHDVGRVSEQVPLDQFSGDALTLAFNGKYMLDAVRSFDGEQLTVDFTGTMSPMILRPTDGQEYLHLVLPVRT. 374
143 0.000e+00gi|511540389|emb|CCX39775.1| dNA polymerase III subunit beta [Firmicutes bacterium CAG:102]  clstr ali  34  1.MKLTCSKDLLLQYINIVNKAVSNRTTLPILECILLTANERGFIMTGNDLEIGIRTAIEAE--------IQKAGEVAIEARIFNEIVRRLNGESVTIATDEDYAVTIVSGSSEFKIMGQSGEDFPTLPEVEQERLYSMEQAKLRDMIRQTIFSIAQDGSKPVLTGELFELRSNSVHVVSVDGYRISFRKNSLLTGSGDTDVIVPGKTLAELNKILSEEDDTLSIYLTEKHILFDLGTAVMVSRLIEGDFIRYAQSFSEDYKTKVVINKSELIQALERASLVSRDNRKTPVRLMIRANGMDITARS-DMGTAHENVTA-EVEGDDLAIAFNPRYLIEALRSIEEETVKMIFMASLSPCTILPGEGDSFKYLILPLR.. 366
144 0.000e+00gi|654504263|ref|WP_027973625.1| DNA polymerase III subunit beta [Streptococcus porci]  clstr ali  37  1MIHFSINKTYFLQALNATKRAISSKNAIPILSSLKLEISSSTITLTGSNGQISIENTIS-SQDDNAGLLITQPGGILLEANFFINIVSSLPDVTLDFEEIEHHQVVLRSGKSEITLKGKDVDQYPRLQEVTTTNPLLFETKILKNIIAQTAFAASTQESRPILTGVHMNLKDHKFKAVATDSHRMSQRQIELEKATDDFDVVIPSRSLREFSAVFGDNVEQVEVFLSPSQVLFRSEHTSFYTRLLEGNYPDTDRLLTNTFETEVTFNTVTLRQSMERAQLISNASQSGTVKLEIEDGKVSAHVNSPEVGKVNEEIDVVSLSGSDLTISFNPTYLIDALKVLKSETVVIRFISPVRPFTLTPDEGEDFVQLITPVRT. 377
145 0.000e+00gi|652588713|ref|WP_026975636.1| DNA polymerase III subunit beta [Alicyclobacillus contaminans]  clstr ali  36  1.MKLSIRKHALLEAIQVVSKAVAVRTPKQVLTGILLTAESNRLVATAYDLELAIQTHI--EINEDTGLSVIAEGSIVLPARYFADMVRKLPEDQVTLQVDHNYMTEITSGLAQFHLHGIDAAEFPKLPEFHGAQSLNISSDLLHTLITSTSFAAANTEVRPILTGIHVVCDGRGLTFTATDGLRLATRSAAIQTQTQPWNAIIPAKSLAELAKLLPDSDESITMQITHTHSLFMIGTTNFYTRMIDGAYPDTTRIIPTSSRTELIVNTTELMNAIDRAALIARERENNMVRLQLDDTTITVSSSSPEIGNVSESLKANAKTGDDMAIAFNAKYVLDALKALRSSEVVVRFNGWNQPFTFREVGNEEFLQLISPV... 373
146 0.000e+00gi|504713940|ref|WP_014901042.1| DNA polymerase III subunit beta [Desulfosporosinus meridiei]  clstr ali  31  1.MKIFCSKDGLLSGVNAVQRAVSNKNPLPVLQGILIQAENQSLQFAATDLEMGIRCDVPA--------QIIEEGTMVVPAKLFTEVVRKLPDTTITLEERDQ-KIIISYYQSEIVLNGYDPEEFPLLPDLIEPLSFTLPTVIFKNMIRQTIFSCAAEENRPVFNGILLQIEGSNIRLVATDTHRLAYVISEITNTGDSFSGIIPSKTLSEIYRLLRDEDEVLTISHSNNQVVFQFGTIFLISRLIEGQFPNYKQVIPQACETKVYLSVREFLDAVERASLLSRDKSSNIVRINVVDNELRID-QTSELGKISEQIGI-EMDGKEVRIAFNAKFLIDALKVIDSEQILFELSGPFSPGVMRPMDNPNYIYLVLPVRT. 366
147 0.000e+00gi|504638038|ref|WP_014825140.1| DNA polymerase III subunit beta [Desulfosporosinus acidiphilus]  clstr ali  32  1.MKIFCSKDSLISGVNAVQRAVSNKNTLPVLSGILISAENQCLRFSATDLELGIQCEIPA--------QIEEEGKTVVPAKLFAEVVRKLPDTMITMK-EENQAIIIYYYQSEITLRGYDPEEYPLLPDLIDPVSYSIPTAIFKNMIRQTIFSCAVEENRPVFNGTLMQIEGSNLRLVATDTHRLAYSISEVDNPENSFNGIIPAKTLSEIYRLLKDEDESIEISFNKTQVVFRFGLIYLVSRLIDGMFPNYKQVIPQTCETKINLSVRNFLESVERASLLSHEKSANIIRIQVESTQLKID-QTTELGKISEQIEITA-QGKDVMIAFNAKFLIDALKVIDTDQIIFELSGPYSPGVMRPLDNPNYLYLVLPVR.. 365
148 0.000e+00gi|529045687|gb|EPZ46329.1| hypothetical protein N007_06610 [Alicyclobacillus acidoterrestris ATCC 49025]  clstr ali  33  1MMRFSIQKSALMQAIQIVSKAVAVRTTKQVLSGILLEVSNQEIVATAYDMELGIQTRIYASDDNQ--LTVEQAGSIVLPARYFSEVIRKLPDTVITMQVANNYMTEISTASVEFHLHGIDAEEFPKLPTFVGVQGLQIQASMLDDLIRTTAFATANTEVRPILTGINVQCNHERLTFTATDGLRMATHYVHL-TDAPVWQAVIPGKSMLELSKILPTDDSVVELYLTESHSLFVIGDTRFYTRLIDGTYPDTSRIIPTSHKTEITAAGQALLGAIDRAALIARDRDNHMVRMEIQNDTITVSSNSPEIGNVSETITVEQKTGDDLQIAFNARYVLDALRALDAAQVTARFNGTTQAFVIEKTGDQTMLQLISPV... 371
149 0.000e+00gi|652829670|ref|WP_027114676.1| DNA polymerase III subunit beta [Lachnospiraceae bacterium NK4A144]  clstr ali  33  1.MKITCSKSDLVNGVSIVSKAVPSKTTMDILQCILIIATNGIIKLAANDTELGIETQINGT--------IEDNGIIALDAKLFNDIVRRLPNGDITIATDSAYQTQITCMKAKFNLQGRSGEDFPYLPEVDRSDSIAISEFSLKEIILQTIFSISDNENNKIMTGELFEITGDKLRVVSLDGHRVSIRKIELRADYGSKKVIVPGKTLSDISKILGDVEKEVSLFFMQNHIAFEFDDTLVVSRIIEGEYFNVDQMLSDSYETKVVVNKKEFLDSIDRATLMIKEGDKKPVVISINDDVINLKIRSV-IGSMDEDIDIQK-TGEDLMIGFNPKFIIDALRAISDETITIYLENSRAPGIIRDEEG-KYVYLVLPV... 363
150 0.000e+00gi|671602269|ref|WP_031575593.1| DNA polymerase III subunit beta [Proteiniclasticum ruminis]  clstr ali  35  1.MHFRCQKKDLVEGISTVQKAILGKSPMAVLEGIYIETGANEIIMRGSDIDLSIETLVSSS--------VLEEGRLVIDSKLFGDIIRKLPDATVEIATMENNTILISCENSEFNLLYLNAEEFPTLPEIGNREKISIREDVFKNLIKATSFAVAQDESRPILMGVLFEVKNKVLNMVALDGFRLALRSEYLESN-EDLSVVIPGKTLNEVSKILGDKNELLYISFNENHILFEVQNTKVVSRLLSGSFIKYESIIPTDYKLQFKVKRALLAQSIERASLMAKEGSSKLIKLQIENDRAVITSNS-QFGKVKEDVPVH-MEGDAIEIAFNANYLLDTLKVMEEEEIVLEMTSSVSPAIIKNTVVDNCIYMVLPVR.. 363
151 0.000e+00gi|517060584|ref|WP_018249402.1| DNA polymerase III subunit beta [Orenia marismortui]  clstr ali  35  1.MRIEINQKEFYEGIQTVSKAVSSKTTLPILSGILLKTEEDKLKVVGTDLEIGIECFIEA--------HIIKGGSIVLPAKYLTSIVRELPNEKIILTTESNNTAQIKCDQAQFNIHGSPADEFPILPEIESGVRFTIKQNKFKEIIDQTKFAISKDESKPFLTGGLLIIEEGNIKLVSTDTYRLAYREDQIEKDISAEKVIIPNKTLNEIAKLLDNSEDLIEIIITENQILFKFSGVSIVSRLIEGQFPNYKQVIPNKNNTKVVVDKNELLSAAKRASLLAK-KDSNIIKINLEKDKLIITSNAPEIGQAYEEVSI-SLVGQETEIAFNAIYLMDCLKVIDSEEVVLELLGSLSPGVIKSKSEDEYIYVIMPVRS. 367
152 0.000e+00gi|502759201|ref|WP_012994185.1| DNA polymerase III subunit beta [Thermoanaerobacter italicus]  clstr ali  37  1.MKFVCDKNSLFEGVNIAIRGVSSRTTLPILQGIKISALKDQVKFSGTDLDIGIECQIPAM--------VEEEGEIVVPAKIFSELVRKLPEGDVKIESDSQNTVNVICDSINFTIAGSDAVEFPEIPQVSKENSFKLTKNILKDLIKKTVFCIAHEQTRPILTGVLFEVFPNEIKAVALDGFRMAIYTYQFEEGIEKYSIVIPGKTLEEIYKILEDEETEIDIYHTANQVLFQIENTKVISRLLEGSFINYNAVLPKDYKTEVVVKREVLTESIERASLIA-ESKNNLIKFEIGDKFITVSSNS-EKGKMVEKIEVN-VKGMFLEIAFNSRYLLDSLRAIDEEEITLYFINSINPLIIKPIGSKDYLYMILPVK.. 368
153 0.000e+00gi|503435224|ref|WP_013669885.1| DNA polymerase III subunit beta [Aerococcus urinae]  clstr ali  45  1.MKFTIKRSIFVDHLNNVQRAISSRTTIPILTGIKIAVLDSGIILTGSDSTISIEIYISKE-DESNQLSIAETGSIVLPSRFLGDIVKKLPEDQLTLEVQDNLQTVIRSGESVFNLNGTAGSEYPTLPEIDADSTYVLPGHLFKRVVNHTIISVSNQQIRPLFTGVHFILADEQLKAVSTDSHRLSQRIVPLESQGKALEINIPGQTLTELTRLVDD-NEDIEMMVTDNQVLFKIDNVYLYSRLLEGNYPDTDRLLSLDYNTKIKVDAQELVHAVERALILSHQGKNNVVKLSLSQEEAILSGHSSEIGYVKEKLSLLSFEGDDLEISFNPDYLREALRSFGGQDVVIRFVNPTHSFILTPSEDENMVQLITPIRT. 380
154 0.000e+00gi|1011036454|ref|WP_061992577.1| DNA polymerase III subunit beta [Fructobacillus ficulneus]  clstr ali  42  1.MKFSINRQAFIKALNDVSRAISSRTTIPILTNIKLDLTDEELILTGSNADISIKITLEAS-DTTNQLVIDTPGGITLPATFFINIVKHLPAETLTLSV-EGLQALITSGSASFKINGQPVSAYPKLPELSESKSLKVSAAQLVEIIAQTKISASTQESRPILTGIHLTLDGNQIKAVTTDSHRLSQRIVTLTENTEKTSVIIPAKAFNELQSLL-DGQNRVEIKLSANQAVFVFGKTTFYSRLLEGNYPETDRLIPSEATTELQIDAAALSGAIDRASLLSHESRNNVILLTINGGQAQLSGNSQEVGQVNENLTAEKVTGEDLEISFNPDYVRDALRVLQGKTVELKFTTNLRPFIIIPEGDNKQLQLVTPVRTF 377
155 0.000e+00JGI.Meta 7051258184 SRS020328_Baylor_scaffold_1935__gene_5459 DNA polymerase III, beta subunit [Human Stool microbiome from visit number 1 o  ali  29  1.MNIICDKQALIDAVGNVQRAVSGKSTLPALEGILLRAAGSSLFLAGFDLDLGITTTIDA--------DVRQPGEIVLTAKLFGEIVRKLPGDRVTLTSDERFNTTIQSDVTEFTIMGISASEYPEIPSVDDGASFTLPQNTLKSMIRQTIFAVAPNDPRPIHTGTKFEIEPDSLRLVSVDGSRLAMRCEEIKSP-ETASFVVPGKTLQEILKLLADEDKPMALSVGRRHIVLEISGYNVISRLLDGEFLAYQKAIPQQVNTTIRVKTRALMDAVERTSLVINDRLKSPLICEFKDGHILVSCTTP-LGSASDRI-AADLQGNGEEMGFNSRFLLDALKNCETDEVRIELGGPLSPMKVLPVTGESFLFLVLPVR.. 364
156 0.000e+00 [EC:2.7.7.7][KEGG:K02338] DNA polymerase III subunit beta;|[COG0592] DNA polymerase sliding clamp subunit (PCNA homolog)  ali  33  1.MKIICEREKLLKAINAVVRGVPTRTTMPILEGIYLQTNNNELKLTTYDLELGIEYIIDAE--------IEEEGNTVVNATMFSEIIRRLPDSQIKIEVNENKLLVIECEGSLYKLSTMNPDEFPELPKIDIENSLETEQVVLRNMIKKTIFAVSNEENRPIFTGCLFEINNNKLNIVAVDGFRMGWVSKVLEKNTEDFKAVIPGKTLNEVNKILTDSFDNIRIGIAKNQGIFEMENCKIVTRLLDGEFFKYESAIPANWETRIRVNKNLLQSCLERVSLISSSEKKYPVKINIDIGKITLSCTN-QTGEAKEEL-YLETEGKNLEIGVNPKYFLDALKAIEDEEVYIEFGSDISPYIIKPIEENDYIYMILPIR.. 370
157 0.000e+00gi|517488493|ref|WP_018659070.1| DNA polymerase III subunit beta [Allofustis seminis]  clstr ali  40  1.MKFSVNRLVFLDKLRTVQLAISSKTTIPILTGVKIEVSQEGIKLTGSNADISIEAFLE-TTDDAAQLVIEETGSLVLPARFFADIVNKLPDETFSFATQDSFQAIIKSATSSFKIHGIDADNYPYLPDMDEHLAFKLPVQLLKQVIQQTVHSVSPHETRPILTGVKFDIGGGKLKAVSTDSHRLSQRQVSVEIDHVEYSVVIPGTSLNELVKILDDELEEVSVIVVENQILFMTEDTYLYSRLLEGNYPKTDQLIPTETNTQITLNIAALRGAVERASLLSHAGKNNIVTLNVAEGILRLTGQSSEVGSVVEDIPYISMTGDPIEISFNPDYLKQALQTFVGNDVTIEFISSLRPFIVLPAAAANFVQLITPIRT. 379
158 0.000e+00gi|902965192|ref|WP_049684238.1| DNA polymerase III subunit beta [Thermoanaerobacter kivui]  clstr ali  37  1.MKFACDKNSLSEGVNTAIRGVSSRTTLPILQGIKLTALKDFVKLSGTDLDIGIECEIPAT--------IEQEGEVVVPAKIFSELVRKLPEGEVSIKTNSENIVDITCESINFTISGSDAVEFPEIPEVSRENSFRLTQNPLKDMIRKTIFCIAQEQTRPILTGVLFEVFQNEIKAVALDGFRMAVYSXXXXXXXXXYSIVIPGKTLEEIYRILKDEDSEIDIYHTSNQVLFQIENTKVISRLLEGNYINYNAVLPKDHKTQVRVKKEDLMESIERASLIA-ESKNNLVKFEIGDKFITVSSNS-EKGKMVEKIEVV-VKGMFLEIAFNSRYLLESLRAIDEEEIELHFINSINPLIIRPIGSKDYLYMILPVK.. 368
159 0.000e+00JGI.Meta 7056692891 SRS019161_WUGC_scaffold_50985__gene_89467 DNA polymerase III, beta subunit [Human Stool microbiome from visit number 2 o  ali  29  1.MHIICPREELQKGVSIVSKAVSNKTTMPILECILIQTKEGRILMTANDMELGIETEIHGI--------IEDNGRIAIDAKIFSEIVRRLPDNDISIETDGTDSVKIQCEKINFTIPGKNADEFTFLPEVERLNCVTLSQFTLKEIIRQTIFSISDNENNKMMAGELLEINGNNLRIVSLDGHRISIRKIVLKDSYDSIKVVVPGKTLNEVSKIISGTDDEVRLYFTENHVLFEFDDTIVVSRLIEGEYFRIDQMLNSDYDTKLTVNKKEMLSCIDRTTMLIKDSDKKPIIIGITDHSMEVKLNSA-YGSMKEELAIDK-RGKDIMIGFNPKFLIDALRVIDDEMINIYMINPKAPCFIRNDEG-TYIYLILPV... 363
160 0.000e+00 [EC:2.7.7.7][KEGG:K02338] DNA polymerase III subunit beta;|[COG0592] DNA polymerase sliding clamp subunit (PCNA homolog)  ali  33  1.MNIICDKSKLIEGINIALKAIPGKSTMAILECLVLEVKDNIIKLIANDLEIGIETIIDG--------QIIEEGSVAINAKVFFEIIRKLPSDEVTISVDDNYVMNISGGKAKFNISVKPTEEFPFLPQIVKNNSITISQFSLKEVIRQTVFSISDNENTKVMTGELFEVKGNKLKVVSLDGHRISIRNIELKNSYDEVSVIIPGKTLIEISKILNGGDDDVNIYFTDKHALFEFENTIVLSRLIEGEYYKIDKMLSSDYETKLTVNKKEMLDCIDRTTLLIKESDKKPVIIDIKDDSMGFNMNSS-IGSMNEEISAIK-EGKDILIGFNPRFLMDALCVIDEEEITIYMINPKAPCFIRDKE-ESYIYLILPV... 363
161 0.000e+00 GL0058979 [Complete] locus=scaffold2062_1:2009:3127:+  ali  29  4MLKFSCEKALLQLAVNTASRTVATKSSIPALEGLLLEGT-DVLTLSGYNMQTGIRTRLEA--------DIREGGRIVLNSRLFGDIIRKMPDDVIVFSADEKFMVTLTCGDARFEILGLSADDYPEMPEVESDYSMTVQQGILKAMINQTSFAVSTNENRPIHTGSLFEVGIDGVTVVSVDGFRLALRREKIEQEGGAFRFVCPGSALNEVEKICEDSEEAITVMLGKRHLLFETGSTQLICRKLEGDFLDYKNAIPRNNPIRLTVDSKTMLSSLDRVSVVISEKLKSPVRCIMGSGCITMSAKTGN-GEATDVCPVEG-DGQDLEIGFNNRYLMDALRFAPADQVVMELNTGISPCVMTPVDGDSFLYMVLPVR.. 369
162 0.000e+00gi|517418442|ref|WP_018590073.1| DNA polymerase III subunit beta [Terrisporobacter glycolicus]  clstr ali  37  1.MKIICNQKLLAHKISIVQKAINGKTNFDLLKGILIVAKGDQIVLTGYDLEIGIETYAQAE--------ISEEGSIVIDARLFGDIIRKLPDSFVEIETDNDNNVYINCLNSKFKIKGDSSEEYPVLPNVSKDNLYNVPQDILKNMIKQTVFAISQDQTKPVLMGELLEIVNGEVSLVAIDGYRLAVRSCSVENLNANAKVIIPGKTLNDVNSLLS-TEEQVQIGFDDKNAIFMINETKIITRLLDGEFIEYKKLLPREHNTRIKLNTRSLLNSIERASLLSQSERNNLIKLSIRDNTLAITSNT-EKGNVYEEVD-LELEGDYLDIAFNSRYLLEGLKNIESEEIFIEFTTNVNPCIIKPVDGIKYIYLLLPVR.. 363
163 0.000e+00 GL0276526 [Complete] locus=scaffold13028_2:6089:7192:-  ali  33  1.MRFICDTNELNTALSIVSRALAVRSTKPILEGILFESCDEGLRLTCTDLALGIETLLPATFSEERRA--------ALPGKLLCEIIRKLPGGPCDIAIGERMQATIRCASVRTTINGFDPVEYPELPQVEGE-RFELPQNTLKDMIGRTLFAIAQDESRPILTGCLMGINASEMRVVALDGFRLALRKENVAGPSAPVSAVVGGRVLGDIAKILADTEEPVSLCFTKSHVRMNIGQTRVVARLLEGEFIRYRQILPEEWQTRVTVERAELGSAIDRASLIAREGKSNLVCFKLDGETLEVSSNS-ETGDMEEKMQVI-TEGKDLTIAFNVRYITDVLKALSDDRIVMRFNSNVSPCVVCPVEGDSYLYLVLPVRVF 365
164 0.000e+00gi|503881908|ref|WP_014115902.1| DNA polymerase III subunit beta [Oscillibacter valericigenes]  clstr ali  30  1.MKFSCEKALLQNAVGIASRAVSQKSSIPALEGLLLRASE-TVSVSGYNMQTGIRTILSA--------DVTEPGDLVLNARLFGDIIRRMPDDVITFSSDDKLVVHLQCGDANFNIMGLSATDYPDLPEVEDEYSVSIQQKTLRSMIEETLFAVSTNESRPVHTGSLFEISEQGLTVVSVDGFRLAIRKEPLERNGGYFSFVAPGSALSEVEKICGDVEDLTSITLGKRHVLFEVGQTQLICRRLEGDFLDYKSAVPRKNPISVVADTKELIQSIDRVSVVISEKLKSPVRCIFDHDRVVLSAKTAN-GEAKDICRLAG-DGGELEIGFNNRYLMEALRYAPADTVKIELNTGVSPAVIVPTEGENFLYMVLPVR.. 365
165 0.000e+00 GL0022935 [Lack 5`-end] locus=scaffold1606_1:5186:6304:-  ali  32  6.MHIICDKSKLIEGMNIVMKAIPGKTTMMILECVVIEVKDNQIKLIANDLQLGIETLIDGE--------IKQEGSVAVGAKVFFEIIRKLPSDNVSITVDEDYHMNISCGKAKFNIMAKATDEFPYLPNIVKDKNVNISQFTLKDIIRQTVFSISDNENAKVMTGELFEIHDSELKVVSLDGHRISIRKVKLNQSYDDVSVIIPGKTLIEISKIINGGDDEVSIFFTDKHVLFEFEDTIVLSRLIEGEYYKIDKMLSTDYETKVTVNKREMLECIDRSTLLLKESDKKPVIIDVQDDYMKFAMNSA-IGSMDEDIDASK-EGKDILIGFNPRFLMDALRVIDEDEITMYMINPKAPCFIRDQE-ETYIYLILPV... 368
166 0.000e+00 GL0046969 [Complete] locus=scaffold571_1:29068:30228:-  ali  31  19.MKFTIEKRILTEAVGNLQRAVSAKTSIPALEGILIRSGEEKLILSAYDLEIGMQTELPA--------VISESGAIILTAKLFSEIVRKSPADDITIETDDRNTATITSGVSCFTIIGMNAAEFPEFPKVTDTDTLRLPAGVLKSMIRQTLFAVADSNAKPIHQGSLFKIEDRTLDVVSVDGYRLALRREAIPFD-GSLEFVVPGKTLGEVLKLLRDDDGENEICPSRRHILFKIDNYTVLSALLEGEFLDYRAALPKDKKTEAVVSTRTLIESVERVSLLITDRLKSPVRCVLGEDTIKLLCSTT-MGRANDQIEA-KISGDPLEIGFNNKYLLDALRAAECDEVRMELGGPISPMLILPKEGDAFSFLVLPVR.. 381
167 0.000e+00gi|493491382|ref|WP_006446077.1| DNA polymerase III subunit beta [Alicyclobacillus hesperidum]  clstr ali  38  1.MRFAISKTALVLAIQTVSKAVAVRTPKQALTGILLEVREHELIATAYDLQLAIQMRI--QSDEHNQLTVLDPGSIVLPARYFSDIVRKLPDTQITMQVASNYMTEISSGKVQFHLHGIDADEFPELPKFLGITGAQIPSSTLARLIETTAFATATSEVRPILTGISITCKNDELTFIATDGLRLAKHRV-VQADLPNWEAVIPGKSLVELAKILPDNDEPVEIYLTPSHSLFVCGQTSFYTRLLEGTYPDTSRLIPTSAKTELVVSGDEMLGAIDRAALIARDRDNNMVRLEMEQDAITVSSSSPEIGNVSETVQVLQRQGEDLQIAFNARYVMDALRALNAAEVNIRFNGPTQAFVIEKTGDSSILQLISPV... 370
168 0.000e+00gi|495211355|ref|WP_007936135.1| MULTISPECIES: DNA polymerase III subunit beta [Pelosinus]  clstr ali  35  1.MKISCTKEQLNHAVQTVQKALATKTPMPILTGIYLSAFDEKLELQATNYEIGISCIIEAT--------IEEPGTVVISGRYFQELVRKLPGEMIEISSSEDRTIQITSNQAQFNLLSLPAEEFPVLKKPTSDTVINVKDNILRELIKKTVFACSTDESRPIFTGGLLEINQHEVNMVATNTHRLAIKKDHLGHNTDSIKMIIPAKILNELARIISDVPMDVTIYCQKNQVSFAFDNIYIISRLIEGQFPDYNKVIPPSFATTITIDTHAFMDAVERVSLLARDGDYNIIKLAFKNDCVIITSNNPDIGKACETVTTI-VQGNEVEIAFNAKYVTDILKNISSEQLVFSLNTPLSPASIKPIDDETYNYIITPVRT. 368
169 0.000e+00gi|544696245|ref|WP_021127389.1| DNA polymerase III subunit beta [[Clostridium] sordellii]  clstr ali  36  1.MKIICNQKILAHKIGIVQKAINGKTTLELLKGILLTAKEDRINLTGYDLEIGIDTYAQAE--------VIEEGEIVINARLFGDIIRKLPDTFVEIETDSDNNVYINCLNSRFKIKGDSAVEYPKLPDVNKNELYDIPQDLLKNMIKQTVFAISQDQTKPILMGELLEIGNGNISLVAIDGYRLAVRASELSGVEEDVKVIIPGKTLHDVNGLLASEGDFIKIGFDEKNAIFIINETKIITRLLEGEFIDYKKLLPREYGVRAKVNTKELLNSIERASLLSQSEKNNLIKLSIRDNSMAITSNT-EKGNVYEEVSI-ELEGDYLDIAFNSRYFLEALKVIDSEEIFIEFTTNVNPCIIKPVDGTKYTYLLLPVR.. 364
170 0.000e+00gi|493928414|ref|WP_006873108.1| DNA polymerase III subunit beta [Anaerotruncus colihominis]  clstr ali  32  1.MQLICDKQLLVDAVANVSRAVSSKNTLAALEGVLLRAKNNTLSLTGYDLELAISTEIEA--------DVREAGEIVLSARIFLDMIRRMPSEQISISSDAKMLTLVKGSMTEYTILGLPASEYPELPGVSETTELSIPQAALKNMISQTLFAIAVSDSKPVHTGSLFDIKGGELCLVSVDGYRLALRREKVAFD-ETLSFIVPGKSLSEVSKLLRDEEGDVELGVARRHIIFRTGSYRIVSRLLEGEFLDYRAAIPEGGATTVKIGTRDLISAIDRASLLISDNIKSPLRMKFEEGLIKISCSTA-IGKAYDEIRCEQ-SGDDVEIGFNSRYMLDALKASEGDEIRVLINGPLSPIKLMPVEGDAFVFLVLPVR.. 363
171 0.000e+00gi|524741144|emb|CDE46377.1| dNA polymerase III subunit beta [Clostridium sp. CAG:411]  clstr ali  36  1.MQIRCKKTDLLNSVNISLRAVTSKTTLPILECIVIEAQDNIIKLISNNQELGIETIVKGE--------IIENGSIAINAKLFSEIIRKLPDSDVTFTTNDSFMANIQCEKAKFNLMGKASDEFPLLPTVETDKSIRVSDFALKEIIHQTIFSVSDNESNKIMTGELFEIKGDIFKVVSLDGHRISIRKIQLHESYEGTRVIVPGKTLQEISKILSGEDQIVTISFTNKHILFSFDHTTVLSRLIEGEYYKIEQMLSDNYVTKVNVNNKELLSCIDRASLLIREVDKTPIVLNFQDENLELKINS-NMGSMKEDLDIKK-EGKDILIGFNPKFLMDALRVIDDETVDIYLFNPKAPCFIKDK-DENYIYLILPI... 363
172 0.000e+00 GL0036429 [Complete] locus=scaffold26001_2:735:1841:+  ali  31  1.MKIICQKDLLVEAVSNVSRAVCSKSPIPALEGILLKAQEGQLVLTGYDLELGIATTIESKT--------EQPGELVLSAKLLLDIIRRIPAETVSILSDEKNLATISGGASEFTIPGIIAEEYPELPNVEQKSDLMIKQGVLKSMIDQTLFAVATTDSKPVHTGSLFDIKDSSVTLVSVDGYRLALRREPLVTDL-TTRFIVPGKTLSEIAKLLRNEDEDVFLIVSQRHIAFQISGYYVVSRLLEGDFLDYNAAIPKVSKTTVKVNTRSLTESVERTSLLISDRLRSPIRLAVADHKMQLSC-SPTMGKAHDEVDC-EVSGEAVSMGFNNKYLLDALKASDCDMVKLEINGALSPMRMIPLEGDSFLFLVLPVR.. 363
173 0.000e+00 GL0008739 [Complete] locus=scaffold3048_2:1993:3102:+  ali  30  1.MKVICDALALAEACSNVQRAVSTKASIPAIEGILMKAEDHELTLTGYDLEVGITTSIEA--------RVEQEGSIILNARLLCDILRRLPGESVSVEADERQMTIIHSGEAEYSLIGIAADEYPELPSVTGGYPVTIAEELLKNMIRQTIFAVAVNDSKEVHKGVKFEVENGTIRLIAVDGVRLAVRTEQIDYSGTEISFVVPSKTLSEVTKLLGDEEGVVSMGVGKRHIVFEAGGYHIISRLLDGDFLDYKSAIPSNNATHVRVNTKLFIDSIERTSLLITDRLKSPVRCVFDENTIRISSITS-LGSANDKIDAV-IDGNRVEIGFNNRFMLEALKVVDTDEVRIELNGAVSPILILPPEGDSFLFLVLPVR.. 364
174 0.000e+00gi|940345436|ref|WP_054970433.1| DNA polymerase III subunit beta [Alicyclobacillus ferrooxydans]  clstr ali  37  1.MRFSIQQPALLHMLQVVSKAVAVRTPKQVLTGILLEADDNTLTTTAYDLELGIQDTI--HSDDTNQLDVSTPGSIVLPARYLSEVIRKLPSDNVSISVNNNYMTSIQCGQVEFHLHGIDAEEFPKLPEFQSDTQIQLQSELLNDFIRSTTFAASNSEVRPILTGTHIQYTDGTLNFTATDGLRLATRSTTFDDDTHNWTAIIPSKSLSELSRLLPDNDTVIDVQLTDSHSLFVIGETYFYTRLIDGTYPDTSRIIPKVQRTEIRVNVKSIASAIDRAALIARDRDNHMVRLEVQGQKMTFSSSSPEIGNVSESVEASQKEGDDFQIAFNAKYVLDALAVFDNTDVLIRFNGSNQPFTIQQVDGDVGLQLISPV... 372
175 0.000e+00gi|696601664|ref|WP_033121746.1| DNA polymerase III subunit beta [Oscillibacter sp. ER4]  clstr ali  28  1.MKFSCEKLLLQNAVNTASRAVAAKSSIPALEGLLLTCGGESLTVSGYNMQTGIRTKFTAE--------VEESGELVVNARLISEILRRLPDDVVTFNANDKFLIHLTCGDADFDIMGLSAADFPELPEVEEKYAVQIAEKTLKSMIQQTSFAVSTNEARPVHMGSLFEVSAEGLTVVSVDGFRLALRKEALEKEGGAFSFVAPGTALNEVERICEEIDEVVTITLGQRHILFEVGETELICRRLEGEFLDYKNAIPRRNPINVVVDTKTMLQSLERVSVVISEKLKSPVRCQFGEDKVTMSAKTAN-GDAKDVCRIAG-DGQGLEIGFNNRYLMDALRYAPADTVRMELNTGISPAIIVPVEGENFLYMVLPVR.. 366
176 0.000e+00JGI.Meta 7003520488 C3849306__gene_282075 DNA polymerase III, beta subunit [Human Stool microbiome from visit number 2 of subject 159207311]  ali  34  1.MKFVCYKDKIIKALNSVVKGVASKTTMPILEGILIQTNDNEIKLTTYDLELGIEYTMP--------CDVTEQGSTVVNAMMFTEIIRKLPDTEINISVNENNLLTIECEGSLYKLATMNPDEFPELPKIEIENSISLEQSALKNMIRKTIFAVSTEENRPIFTGCLFEIKNNKLNVVAIDGFRLALRTINIPVPVNDFKAVIPAKTLNEVNKILSDSFEPIKIGVSKNQAVFEMENCKIVTRILDGEFLNYSTVIPNSWQTRIRVEKEALQNSFERISLISSSEKKYPVKVTVDIGKLTILCTN-QTGDAKEEVFI-STEGKNLEVGFNPKYFLDSLKAIDEEEIYVEFGTNVSPCLIKSVENNDYVYMILPIR.. 368
177 0.000e+00gi|653218525|ref|WP_027431114.1| DNA polymerase III subunit beta [Lachnospira multipara]  clstr ali  32  1.MKLVFTKSNLTKAVNIVMKAVPTRTTMTILECILIDATTNVIKFTANDMELGIETIVEG--------DIIEKGKVALDAKFFSEFIRKLPDNEITLETDNNFVATIECENTKINIAGKSGEDFSYLPAIVKEKKITLSQFSLREVINQTLFSISMLDNNKLMTGELFEVSDNKLKVVGLDGHRIAIRNVTLEEHYNTIKAIVPGKTLSEISKILSDAEAMVNVYFTNNHILFEFDNTLVVSRLIEGDYFKIDQMLSNDYETKITINKKEFLESIDRANLFIKESDKKPIIISIQDGSLKVNVKSA-IGNFDENIEINK-DGKDIMIGFNPKFLIDALRVIDDETVDIYLVNPKSPCFIRDKE-QNYVYLILPV... 363
178 0.000e+00gi|497692679|ref|WP_010006863.1| DNA polymerase III subunit beta [Leuconostoc fallax]  clstr ali  42  1.MHFSINRQNFIKSLNAVSRAISSRTTIPILTNIKIEVSDTQLTLTGSNADISIQTRI-LDSDTTAELIIKETGGITLPATFFSNIIKRLPADTFELKL-EGLRAAITSGASSFTINGQDIQNYPQLPEVEDAESLSVSAAQLTDIISQTIISASTQESRPILTGVHFQLTGDSVKSVTTDSHRLSQRIVTLTGADAQVNVIVPAKSFKELGAMLEGQDRVV-IKLTANQAVFDLGNTTFYSRLLEGNYPETDRLIPTESTTELMINAMTLLGAIDRAALLSHESRNNVVQLTMKDNTAVLSGMSQEIGQVKEALDAKKVEGDDLEISFNPDYVRDALRVFHDKEVELQFTSNLRPFTITPAGDNKQLQLITPVRTF 377
179 0.000e+00gi|524330403|emb|CDA88055.1| dNA polymerase III subunit beta [Clostridium sp. CAG:230]  clstr ali  33  1.MNIICDKSKLIEGINIALKAIPGKSTMAILECLVLEVKDNIIKLIANDLEIGIETIIDG--------QIIEEGSVAINAKVFFEIIRKLPSDEVTISVDDNYVMNISGGKAKFNISARPTEEFPFLPQIVKNNNITISQFSLKEVIRQTVFSISDNENTKVMTGELFEVKGNKLKVVSLDGHRISIRNIELKNSYDEVSVIIPGKTLIEISKILNGGDDDVNIYFTDKHALFEFENTIVLSRLIEGEYYKIDKMLSSDYETKLTVNKKEMLDCIDRTTLLIKESDKKPVIIDIKDDSMGFNMHSS-IGSMDEEISATK-EGKDILIGFNPRFLMDALRVIDEEEITIYMINPKAPCFIRDKE-ESYIYLILPV... 363
180 0.000e+00gi|493352049|ref|WP_006308714.1| DNA polymerase III subunit beta [Facklamia languida]  clstr ali  40  1.MKFTINRASFTQQINHVQRAIPTKTTIDILYGIKLTANSEGLTLIGSDADISILSLI-AADDSMADLVIEEEGEVVLPARLLNDIIKKLPADEVSVSVNERHVATIRSAKAEFQIAGKDGNQYPRLPEIDATTEIQLPTLAFKNLINQTIFAASNQESRPILTGLHLTLEEGYINAVATDSHRLSQRQIPLELSDQQKVFTIPKKTMNELSRIVPD-EAQLTLTVSNQQIIFHFDAITIYSRLLEGNYPATDRLIPESSETDLVVNSLDFLQAIERASLMAHEGKNNIVQLDLQNNQAELSVTGNEIGNVAEMIDYESLTGPGLKISFNPDYMKEALRSFGDCSIRLQFNSPVRPMLLSRLEHNELIQLLTPVRTH 382
181 0.000e+00gi|736401866|ref|WP_034425370.1| DNA polymerase III subunit beta [Clostridiales bacterium DRI-13]  clstr ali  32  1.MKITATKENLLFGVQAVQKAVSTKNTLPILIGIKIEAQGNLLYFTATDLEMGIQCYVPA--------DIIYEGAIVVPARHFSEIVRRLPNCTITLELNTNHEITIKYENSELTLKTLPPDDFPVLPNIKGNYEISVQASLLRQMIRQTVFAAGNDEARPLFTGILCEVNENKLRMIATDTHRLALREIPQSSSGDNFSFIVPRKIMSELARLIVDEDEPCFISVTKNQVSFMSANIRLMCRLLEGQFPNYRQVIPTQFKSKIRCKTKLLQESLERISLFSMQNDNNTINIKIDEMTIVVSSRS-ELGQGYEQIAVEQ-EGEPVNISFNARYLIDVLKNVEAEMVTIEFTGPLSPGIVRPADSDNFLYLILPVRS. 367
182 0.000e+00JGI.Meta 7004267363 C4260906__gene_338292 DNA polymerase III, beta subunit [Human Stool microbiome from visit number 1 of subject 160400887]  ali  28  1.MKFSCEKLLLQNAVNTASRAVAAKSSIPALEGLLLTCGGESLTVSGYNMQTGIRTKFAAE--------VEESGELVVNARLIGEILRRLPDDVVTFTANDKFLIHLTCGDTDFDIMGLSAADFPELPEVEEKYAVQIAEKTLKSMIQQTSFAVSTNEARPVHMGSLFEVSAEGLTVVSVDGFRLALRKEALEKEGGAFSFVAPGTALNEVERICEEIDEVVTITLGQRHILFEVGETELICRRLEGEFLDYKNAIPRRNPINVVVDTKTMLQSLERVSVVISEKLKSPVRCQFGEDKVTMSAKTAN-GDAKDVCRIAG-DGQGLEIGFNNRYLMDALRYAPADTVRMELNTGISPAIIVPVEGENFLYMVLPVR.. 366
183 0.000e+00gi|737670874|ref|WP_035640293.1| DNA polymerase III subunit beta [Lachnospiraceae bacterium FE2018]  clstr ali  33  1.MKLTFEHQELLKSVNIAMKAVSSKTTMPILECILIDASADQIRFISNDMELGIETIAEGT--------IIERGMVALHAKTFSEIIRRLPASTVTIETGENLLTRITCEKAKFDIPGQAGDTFAYLPIVERNASVSVTQFTLRQMINQTIFSTAANETNKIMTGELFEMNGGNLRIVALDGHRIAIRMQELGADVENRRVIIPGKTLQELSRIIDGGEDPVTIYFSDNHVIFEFDRTMVLSRLIDGEYFSVDQMLSNDYETKVTIHKQELINCINRASLLVRESDKMPVILNISDNTMQLSINTA-IGSMDEAMDI-EMEGKDIRIGFNPKFLLDALRVIDDEDVAMYFIGPVAPCYIRDDEG-KYNYIVLPV... 363
184 0.000e+00gi|551017560|ref|WP_022761793.1| MULTISPECIES: DNA polymerase III subunit beta [Butyrivibrio]  clstr ali  33  1.MKFVCSKSNLIAGLQIVSKAVPNKTTMSILECILVDATEGVIKFIANDIDLGIQTELDG--------NIIERGYIAIDAKIFFDIIRKLPDSDVTIEADANGKVTISCEKAKFSIVGRNADDFTYLPNIERIDGISVSQYTLKNIIQQTIFSIAENDANKMMSGELFEINQDTLKLVSLDGHRISIRKIKLQNSYESKKVVVPGKTLSDISKIISDSENNVDIFFTDKHILFEFDRTIVVSRLLEGEYFNIDQMLSSDYETKMTISRKEMLDCIDRATLLVKEGDKKPVIISITDEKMELKINST-IGSMDEEIDIEK-QGKDLIIGFNPKFLIDALRAIDDESIDIYMVNPKAPCFIRDK-DSNYIYLVLPI... 363
185 0.000e+00gi|524784775|emb|CDE78020.1| dNA polymerase III subunit beta [Ruminococcus sp. CAG:353]  clstr ali  31  1.MKFTCKQSVLNEAVNNVSRAVPQKSPVSALEGIKMYLDKNTLELTGYDLELGIQTKIQVDSEDH--------GEFTVNAKLFAEIIRKMPSEDVSVEINDKLKATIKGGDAEYNILALSADDYPSMPDYDTSDSITISQGLLKNMIGQTIFAVSVSDNKPILTGELFDIENGIFNLVAIDGFRLAVRTEKLNTE-DRHHFVVKAKALSEVSKLLDDGDDPVNMYLSRKHIVFDINGYMVISRLLEGEFHNYKGSIPQNHSTEIVLNTKALIASLERCSLLIVEQTKAPVKCSFGDGQVKISCSTT-LGKLSDEFPV-DITGNKVDIGFNCKYLLDALKAAESDKVKLLLNGGLSPMKIVPIDGDAYTFLVLPVR.. 364
186 0.000e+00 [EC:2.7.7.7][KEGG:K02338] DNA polymerase III subunit beta;|[COG0592] DNA polymerase sliding clamp subunit (PCNA homolog)  ali  33  5.MKIVCYKDTLLKALNSVIKGVASKTTNPILEGILIQTNENQVKLTTYDMELGIEYIID--------SDVKEQGSTVVNAIMFSEIIRKLPDSEIYITLNSNNLLEIECEGALYKLTTMNPDEFPELPKIEIENSIDLEQNMLKNMIRKTIFAVSTEENRPIFTGCLFEVENNKLNVVAVDGFRLALRSIYLPVKVNDFKAVIPGKTLNEINKILLDSFDHVKIGIAKNQALFEMENCKVVTRTLDGEFLNYKSVIPSNWETRIRVNKNSLQDSFERISLISASSKKYPVKVSVDIGKITISCTN-QTGEAKEEIYI-STEGKNIEAGFNPKYFLDSLKAIDDEEVFVEFGTSISPCLIKSVENSEYVYMILPIR.. 372
187 0.000e+00 [EC:2.7.7.7][KEGG:K02338] DNA polymerase III subunit beta;|[COG0592] DNA polymerase sliding clamp subunit (PCNA homolog)  ali  27  1.MKFSCEKLLLQNAVNTASRAVAAKSSIPALEGLLLTCAGEKLTVSGYNMQTGIRTHFPVEAA--------EDGELVVNARLIGEILRRLPDDVVTFTADDKFLIHLSCGDADFDIMGLSAADFPELPEVEEKYSVQIAEKTLKSMIQQTSFAVSTNEARPVHMGSLFEVCADGLTVVSVDGFRLALRKEPLEKEGGAFSFVAPGTALNEVERICEEIDESVTITLGQRHILFEVGETELICRRLEGEFLDYKNAIPRRNPINLVLDTKTMLQSLERVSVVISEKLKSPVRCLFEDNKVTMSAKTA-SGDAKDVCRIAG-DGQGLEIGFNNRYLMDALRYAPADTVKMELNTGISPAIIVPVDGENFLYMVLPVR.. 366
188 0.000e+00gi|511031295|ref|WP_016285387.1| DNA polymerase III subunit beta [Lachnospiraceae bacterium 3-1]  clstr ali  30  1.MKIICSKSNLLHGVNIVSKAVPSKTTMAILECILIDASTNEIKLMANDTELGIETIIEGE--------IKEHGVIALDAKMFFEIVRRFSDDDITIEADSSFKTLITCGNAKYDIIGKSGEDFFYIPYIEKNKPIVISQFTLKDVIRQTIFSISDNDNNKLMTGELFDLKENQLKVVSLDGHRISIRNIVLKEAYDDCKAIVPGKTLQEVSKILSGNDDYVNTYFTDNYVIFEFDNTTVVSRLIEGEYFRIEQMLSSDYETKIRINKRGLLDCIDRTMPLVKEGDKKPIIMNITDDNMELRIKSF-VGTMKENISIKK-DGKDIMIGFNPKFFIDALRVIDEEEINLYMVNPKAPCFIKD-DNETFIYLILPV... 363
189 0.000e+00gi|524361044|emb|CDB16795.1| dNA polymerase III subunit beta [Clostridium sp. CAG:221]  clstr ali  36  1.MNFICSKQKLQEGISIVTKAITGKTTMPILEGIYIEANNEGVTLIGSDMDVSIETKVEAT--------VITPGKIVLDARLFGEIIRKLPNSDVKIEIADNDLIQVTCEKSVFNLVYMNPSDYPMLPTINEDLKVEVPQNLLKNMIKGTSFAIAQDEARPILQGILFEVKDKQLNLVALDGYRLAIRNELLDID-NDIEVVIPGKTLNEVSKILEDNSDLVEITFTNNHILFNLKTTKVISRLLEGKFVNYNSLLPQEHKLIVNVKKQELQNGIERASLMAKDGNSNLIKLDVQEDILIITSNS-QLGKVREEVAIN-LQGEEVQIAFNSRYLLDVLKNMEEEEIVMEMTSGITPCVIKGKNMNNSKYLVLPVR.. 363
190 0.000e+00gi|507809196|gb|EOS66043.1| DNA polymerase III, beta subunit [Oscillibacter sp. 1-3]  clstr ali  30  1MMKFSCEKALLQSAIAVTSRAVAQKSSIPALEGLFLRAGGD-LTVSGYNMNTGIRTKISA--------GVAEEGEIVLNARLFGDIIRRMPDDMVTFSADERQMVHLSCGDADFDILGLSAADYPELPEVEDEYSVSIQQKVLRAMIEETSFAVSTNESRPVHTGALFEISEKGLTMVAVDGFRLAVRREPLEQAGGAFSFVAPGSALNEVKSICGDTEDTASVTLGKRHILFEVGDTELICRRLEGEFLDYKNAIPRSNPISVIAETKSLIESIDRVSVVISDKLKSPVRCVFDHDKVMLSAKTGN-GEAKDVCRLSG-DGGGLEIGFNNRYLMEALRYAPADAVKIELNTGVSPAIIVPTDEDNFLYMVLPVR.. 366
191 0.000e+00gi|652505457|ref|WP_026899766.1| DNA polymerase III subunit beta [Peptostreptococcaceae bacterium VA2]  clstr ali  35  1.MKIICNQKVLAHKIGISQKAINGKTTLELLKGILLSAKGDQLKLTGYDLEIGIETYTQAE--------VIQEGEIVVNAKLFGDIIRKLPDSFVEIETDDENNVYINCVNSRFKIKGDSAKEFPKLPDVSKEDLYNIPQDLLKNMIKQTVFAISQDQTKPILMGELLEIVNGNISLVAIDGYRLAVKSCKIDNMITDAKVIIPGKALTDVNSLLSLEEEEVKVGFDDKNAIFIISDTKIITRLLEGEFIDYKKLLPREHNSKVKLNTKSLLNSIERASLLSQSEKNNLIKLSIRDSVMAITSNT-DKGNVYEEV-ALELEGDYLDIAFNSRYFLEGLKNIDSEEIFIEFTTNVNPCIIKPADGAKYTYLLLPVR.. 364
192 0.000e+00JGI.Meta 7076829177 C229215__gene_13963 DNA polymerase III, beta subunit [Human Anterior nares microbiome from visit number 2 of subject 159  ali  42  15IVKFTVKRTAFLNKLKDVQLAISTKATIPILTGIKLVVAQDGIHLTGSNSDISIETFID-RDDQSVDLTIEETGSIVLPAHLFSNIVGKLPDTHFTVELDERNQAQITSASSSFSINGIEASKYPKLPDINLDHAFLLPTVLLKNIIRQTVIAVSNHESRPILTGVNLSFKDETLKAVATDSHRLSQRVIPLEGDHEEFNIVIPGKSLTELSKLLDENTSHVKLAIVDNQILFNVKDTYFYSRLLEGNYPATDRLIPEKSNTDIVLDVQTLLGAVERASLLSHQGKNNVVKLSATADQLMITGQSPEIGHVEEIVEFDSFTGDPIDISFNPDYLKQALNAFGVGEVTMKLLSTLQPFVLMPNDENDFIQLITPIRT. 392
193 0.000e+00gi|524170340|emb|CCZ42555.1| dNA polymerase III subunit beta [Clostridium sp. CAG:122]  clstr ali  33  1.MNIICDKSKLLDGINIVLKAIPGKSTMAILECLVIEAENNIIKLIANDLEIGIETVIEG--------QIVEEGNVAIGAKVFSDIIRKLPSEQVEISVNENYQLFIKCGKAKFNIAAKPTDEFPYLPQIVKEKHVEISQFTLKDIIRQTVFSISDNENTKVMTGELFEITANKLKVVSLDGHRISIRNVELNNSYDNISVIIPGKTLIEINKILNGGDDIVKIYFTDKHILFEFESTVVLSRLIEGEYYKIDKMLSSDYETKITVNKKEMLDSIDRTTLLMKEAEKKPVIIDIKDNSMGLAMNSS-IGSMDEEIDAVK-EGKDILIGFNPRFLIDALRVIDDEEITLYMINPKAPCFIRDK-DESYIYLILPV... 363
194 0.000e+00gi|557313645|ref|WP_023389151.1| DNA polymerase III subunit beta [Youngiibacter fragilis]  clstr ali  34  1.MHFRCEKKDLVEGISTVQKAIQGKSTMQVLEGIYIETTSEGLILRGTDIDLSIETKVPAT--------VVEDGTIVIDSKLFGEIVRKLPNSEVDVLTTENNTITVTCENSVFNLLFLNADDFPDLPEIGRESGVEIRESLLKNLITATNFAVALDEARPILMGVLFEVKNSVLNMVALDGYRLALRTENLD-SVDDFSVVIPGKTLNEVNKILSDSTENVSISFNDNHIMFRIKDTKIVSRLLSGDFIKYESILPSDYRLSFTTSKAVLHDSIERASLMSKDGTSNLIKMNIDGGRMVITSNS-QFGKVREELSITS-KGEPIEIAFNSRYLIDVLKVIEEDEIMFEMTSSVSPCIIKNRIKDNCKYLVLPVR.. 363
195 0.000e+00gi|737310299|ref|WP_035293157.1| DNA polymerase III subunit beta [Clostridium sp. KNHs214]  clstr ali  37  1.MIFTCEKGKLQEAINIAQKAITGKSTMSILQGILLIAENNTVTLVGSDIDLSIETKVEA--------NVLENGRIVLDSRLFGEIIKKLPNSTVDIRTTEKNSIDIKCEKSNSTLFHMSAEEYPEIPTIDENKICFLSQKLLKNMIKGTIFAVAQDETRPILTGVLFEITKNKLNLVALDGYRLALRSETIDEE-NDINCVIPGKTLNEVSKILEDDEKKVAVSFTDNHILFNLGKTKIISRLLEGDFIKYDSIIPEEYNLRVTVKKDEILGCIERASLMGKDGNTNLVKFDIEDDNMIITSNS-QLGKVREELNII-LQGESLKTAFNSRYLIDVFKIIEEEEIYMEFSSSVSPCIIRNKENNNCTYLLLPVR.. 363
196 0.000e+00gi|503755451|ref|WP_013989527.1| DNA polymerase III subunit beta [Weissella koreensis]  clstr ali  41  1.MQFSINRQILIKALNNVNRAISARTAMPILANIKLVLTEEGLTLTGSDTDISIETTIP-KNDDQAQLKIDSISGITLPATFFTNIVKRMPGEEIKLANIDGFQAKISSGSAEYDIHGQDVNSYPHLPEVDIKNQLTLPAETLIEVIRQTVIAVSKQLSQPILTGVHFILGGGNLTAVATDRHRLAQRTVPFENEEVNADIIIPGPSLLQLQGMLEEV-ETVEIRVAANQVIFQLGNTLFYSRLLEGNYPDASRLIPTEKKTTLTINARELLQTIDRAALLSHEGRSNVIQFDISGEHSIISSNSPEVGKIEEEIFAAETAGEDLTISFNPDYMRDALKSFGDEEIQIGFKTALDPFTLVPTNNTNFIQLITPVRTY 376
197 0.000e+00gi|511344787|emb|CCX39023.1| dNA polymerase III beta subunit [Clostridium sp. CAG:1013]  clstr ali  28  1.MKFTVNKSDITEAVGNIQRAVSTKTSIPALEGILLGASEEGLELCAYDLELGITTVIPA--------FVTEPGKAVLSAKIFSDIVRRTPAETITITVDEKNMASLESGYSRFSIIGIPAEEFPELPKLTDSTQFSMASSVLKSMIRQTLFAIAESDAKPIHQGSLFNLENGVLDVVSVDGYRLAKRSEPM-AFADELNFVVPGKTLSEILKLLKDNDDPVEISAGRRHILFKIDNYTVISSLLEGEFLNYKAAIPPDSQTEVVLKTRDAIDSVERVSLLITDRLKSPVRCIFSDNEVKLNCTTS-MGRASDQIDV-EMTGQSVEIGFNNRYLLEALRNTECDEVKIQLGGPLSPMKVVPKEGDSFLFLVLPVR.. 363
198 0.000e+00 [EC:2.7.7.7][KEGG:K02338] DNA polymerase III subunit beta;|[COG0592] DNA polymerase sliding clamp subunit (PCNA homolog)  ali  37  1.MKIICNQKLLANKIGISQKAINGKTTLELLKGILLSAKDGQLKLTGYDLEIGIETYTQAE--------VIEEGEIVVNARLFGDIIRKLPDSFVEIETDAENNVYINCLNSRFKIKGDSAKEYPRLPEVNEEDLYNIPQDLLKNMIKQTVFAISQDQTKPILMGELLEIVDGDISLVAIDGYRLAVRSCKIDNITNNAKVIIPGKALNDVNSLLS-SEEDVKVGFDEKNAIFIINDTKIITRLLEGDFIDYKKLLPREYNSKVKLKTKELLNSIERASLLSQSEKNNLIKLSIRDNVMAITSNT-DKGNVYEEVN-LELTGEYLDIAFNSRYFLEGLKNIDSEEIFIEFTTNINPCIIRPADDVKYTYLLLPVR.. 363
199 0.000e+00gi|564812543|ref|WP_023859853.1| DNA polymerase III subunit beta [Lactobacillus equi]  clstr ali  42  1.MKFSIQRQTFLKYLTDVQRAISPKAAIDILHGFKLELFPDALKLTGSNADIT-IQTIISISDEKANLQIFEEGSVVLSANIFSEIIKKLPADELEVSVDSRLQTTITSGKAEFTILGQDADMYPHLPELSAQSSLVLSSDILKKVIDQTSIAISNQESRPLLTGIHLLITDQKLLAVATDTHRLSQRTIHLGEAAGDYDLVIPGKSLKELAKMLNDDHSEVEIQIADNQVLFILGHTSFYSRLLEGNYPDTKRLIPQTSETTATFNAQSLLQAIERSSLVSHAGRNNVVKLDVENQEVIITGNSPEVGTVEESISFSELTGKNLEISFNPDYMRDALRSLGNTETTLEFTMPLRPFILVPTEENDFIQLITPVRT. 379
200 0.000e+00gi|652796807|ref|WP_027095353.1| DNA polymerase III subunit beta [[Clostridium] viride]  clstr ali  32  1.MKFSCEKALLQSAIATASRAVSPKSSIPALEGLLLEA-ENVLTITGYNLETGIRTICDAE--------IQKQGSIVLPARLLGELVRKLPDDVVVISV-DKLSVHITCGFSEFFLLGLDPEEFPLLPEVDCQNTFSLEERGLKSMIAQTLFAVSDNESRPIHTGSLFEVEKEQVTIISVDGFRLALRREALLESEGEFTFVAPGAALSEVEKICRDTDEAVSVTMGARHIMFQMGQTMLISRRLEGEFLAWRKAIPRENPIGVTVNTRALLQSIDRVSLIISEKLKSPLRCVFGENEIQLSTKTA-IGNANDCCLAQG-SGGNLEIGFNNRYMMDALKAAPADEVRLELSTGVSPCVIMPVDGEEFLYMVLPVR.. 363
201 0.000e+00gi|547846453|ref|WP_022253698.1| DNA polymerase III subunit beta [Clostridia bacterium UC5.1-1D10]  clstr ali  34  1.MKLMCGKETLLNFINIVNKAVSSRTTLPILECILLTADQRGFTMTANNLELGIQT-------APIDADVLEKGEIAIEAKIFHEIIRRLNGDTVTLETDEKNSITITGGTSRFTIMGQSGDDFPALPDVAQEEAYTLGQNELRNLIRQTIFSISQESTKQILTGELFEMKENALQVVSIDGYRISFRKSPLEHDFTEKSVVVPGKTLTELTKILSEEEDKVHLYFTDKHVLFDLGMATMVSRLLEGEYVSYENNFTEDFKTKIIIDTNELIQALERASLVSRDNRKTPVRLELKPNVLVITARS-DMGTAYEEVP-NETDGDEMQIAFNPRYLIEALRAIDDEKVAIRFTGSLSPCTIVPLEGKAYQYLILPLR.. 366
202 0.000e+00gi|835193504|ref|WP_047389101.1| DNA polymerase III subunit beta [Firmicutes bacterium ZOR0006]  clstr ali  39  1.MKISISRQHFIKAISTVSKAITSKSVLPVLSGLKVEVDATQMTLTGSNAELTIVTHIPCIENEQKIIDVQEPGIVILPAKYVLEIVKKVQDEMIQLEKVDSGLIRLATASSEFQLNDLAVEEYPVIQLITDQPDFHISSNVLKTIIRQTLFCASTSESRPILTGVHFILEKNELLAVATDSYRLAQKVVPLPKAVDSKNIVIPAKTLTELMKVLEDEEKIVTIYFGDNKVLFTWDDIYLQSRLLEGSYPQTNRLIPTEFHTEVTIDHSALFQAIDRASLLAREASNNVVNLNISANKIEVTSNSPEVGQVRERLTPANLLGEPLRITFNARYALEALRALDGDAVTISFVGELRPFIIRSKNDEKVTQLILPVHTY 377
203 0.000e+00gi|652802390|ref|WP_027099038.1| DNA polymerase III subunit beta [Clostridium paraputrificum]  clstr ali  34  1.MIIICNKQKLQDGISICQKAITGKSTMPILEGIYINATKEGITLIGSDIDVCIETKVDA--------DVLEEGKVVIDSKIFGEIIRKLPNSDVRIEIIQDDTVQITCEKSVFNVVFMNADEFPSIPKLDIAKELKVSQSILKNMIKSTSFAIAQDETRPILQGILFEVKEKKLNLVALDGYRMAIKTEYLDNDF-DIEVVIPGKTLNEVSKILEDIESIVNITFTNNHILFDLGETKIISRLLEGKYVNYLSLLPQEHKLLINVNRQELQNGIERASLMAKEGNSNLVKLEMNEESIIITSNS-QLGKVREEVTAN-MQGDPIQIAFNSRYIIDVLKNMEDDNVQIEMTSSVSPCVIKGKEAESYKYLVLPVR.. 363
204 0.000e+00gi|524225010|emb|CCZ90548.1| dNA polymerase III subunit beta [Clostridium sp. CAG:167]  clstr ali  33  1.MKFTCTKSDFNNGINIALKAVPGKTTMPILGYVVIEAKDDYIKMTTNDMQLGIETKVPA--------QVQEPGVILMNAKMISEYVRRLPDDDINFEVDEQNNILLFCGRSKFSIPGMDNDEFPKLPNIEVDSKIEISQFTLREMIQQTIFSISDNESNKILTGELFEINGDEFKIASLDLVRVSIRKVHLKESYDHIKVVIPGKTLNEISKILGGTDDMITISFSKNHVLFEFNDTLVISRLIEGNFYNIDQMLKNNYETKVKINKKDFYGCIDRATLLLREAEKKPVILNIHDGEMKMEMNT-KIGSMDEEVMIEK-EGKDLTIAFNPKYIIDVLKVIEDEDVYLYLFNANAPCFIKNNE-ESYIYLILPV... 363
205 0.000e+00gi|493486155|ref|WP_006440946.1| DNA polymerase III subunit beta [[Clostridium] hiranonis]  clstr ali  35  1.MKLICNQKILSQKISIVQKAINSRTTIELLKGILLSTENGALKLTGSDAEIRIETFVQSE--------IEEDGKIVLDAKLFGDIVRKLPDSFVQIETDANNNVHIYCENSRFTIKGHSAEEYPAFSDVEESEMYSIPQELLKDMIKQTSFAISQDQTKPVLMGELLEAENGKASLVAIDGYRLAVRSCSIDSFTKDIKVIIPGKTLVDINSLMT-GEGSINVGFTEKNAVFMLGDTKVVTRLLEGDFIDYSRLLPKEYNSRIKLKSKALLNSIERASLLSQSERNNLIKLSIRDDAMVITSNT-DRGNVYEEVS-LELEGEYLDIAFNSRYLMEGLKNIDSEEIYIEFTTNVNPCIVKPVDEIDYTYLLLPVR.. 363
206 0.000e+00 [EC:2.7.7.7][KEGG:K02338] DNA polymerase III subunit beta;|[COG0592] DNA polymerase sliding clamp subunit (PCNA homolog)  ali  33  1.MKVVCYKDKILKAINSVVKGVASKTTMPILEGILIQTNDNEIKLTTYDLEIGIEYVIE--------CEVKEQGSTVVNAIMFSEIIRKLPDTEISISVNANNLLEIECEGSLYKLATMNPEEFPELPKIEVENGIEVEQINLKNMIKKTIFAVSMEESRPIFTGCLFEIENNKLNLVAVDGFRLALRSLFLNKPTQNFSAVIPGKTLNEVNKILSDSFDIVKIGVSKNQALFEMENCKIVTRILDGEFLNYKNVIPNNWDTRILVNKSNIQNSFERISLISASSKKYPVKVQVDIGKVTISCTN-QTGDAKEELYV-STEGKNLEAGFNPKYFLDALKSIDDEEVYIEFGTSISPCLVKSTQNNDYVYMILPIR.. 368
207 0.000e+00gi|488905025|ref|WP_002816100.1| DNA polymerase III subunit beta [Leuconostoc mesenteroides]  clstr ali  42  1.MQFTINRSAFIKALNDVSRAISSRTTIPILTNIKLVLNDEELVLTGSNAEISIETTVP-QSDTSAQLIITTPGGITLPATFFINIVKRLPNDAMTLNV-EGLRATITSGASSFTINGQDVQNYPQLPEMDDVQSLSVSAAQLVDIISQTKISASTQESRPILTGIHLQLTGNRVKAVTTDSHRLSQRIVQLDANNVDANVIIPAKSFNELQALLEGQD-RVEIKFSTNQAVFDLGHTTFYSRLLEGNYPETDRLIPTESTTQITIEASSLLGAIDRASLLSHESRNNVVQLSLKAGRAVLTGTSQEVGQVTEELNANSIEGEDLEISFNPDYVRDALRIFNGKRVDVKFTSNLRPFTLTPEGDNRQLQLITPVRTF 378
208 0.000e+00gi|769951867|ref|WP_045085054.1| DNA polymerase III subunit beta [[Clostridium] cellulosi]  clstr ali  31  1.MKFSCGKKNFSDAVSVIQRAVSTKTTIPALEGILIKAADNKITLTSNDLEIGMTTTLDA--------NVTEPGDVVLNAKLFSEILRKLPTDYVDISVDDKLLTTVTSGASEFTILGIPASEFPETPVLTECEKFSIPQNILASMIRQTIFCISTDDTKPVHTGSLFELSENQIRIVSVDGFRLAVRTEKINNSLTA-KFVVPGKTLSEILKMLSESDENINMCIGRKHILFEINGYTIISRLLEGDFLDYRSVIVNASSTEIRINVRNFTDSIERASLLISDRLKSPVRCVFDKDIIKVTCSTP-SGKVYDEIPAT-LTGDTVEMGFNNRYLLDALKAAECDEIRVFLNGPLSPMRIYPIDGENFIFLVLPVR.. 364
209 0.000e+00gi|921308149|ref|WP_053242848.1| DNA polymerase III subunit beta [Clostridium sp. DMHC 10]  clstr ali  38  1.MKFTCQKNILQEAISIVQKAVTGKSTMPILQGILINAKNDTLVLTGSDIDLSIETKI--------NVDIEENGSIVVDAKLFGEIIRKLPNAAVEVKTTENNCIEIICSKSKFTLVHLQSEDFPSLPEISEDKIFTINQKTLKSMIKGTIFAIAQDETRPILTGVLFEIKNKKLNLVAIDGYRLALKSDFLDSEDV-ISAVIPGKTLNEVIKILED-DGDVNITFTTNHILINLGSTKIISRLLEGEFIKYNSIIPEEFNLKVIAKREELLESIERASLVAKDGNTNLIKLNIEEDVMVITSNS-QLGNVREEINII-LQGQPLQIAFNSKYLIDVLKIMDEEEIIIQFSSSISPCIMKNKENDNCIYLVLPVR.. 362
210 0.000e+00 GL0102870 [Complete] locus=C3346740_1:399:1517:+  ali  34  1.MKIVCYKDKIIKALNSVVKGVASKTTMPILEGILIQTNDNEIKLTTYDLEIGIEYIME--------CEIKEQGSTVVNAIMFSEIIRKLPDTEIYISLNDKNLLEIECEGSLYKLATMNPEEFPELPKIEIENSIEVDQNVLKNMIRKTIFAVSSEENRPIFTGCLFEIENNKLNLVAVDGFRLALRSIYLNKQTNNFSAVIPGKTLNEVNKIISDSFEPVKIGVSKNQALFEMDNCKIVTRILDGEFLNYKNVIPSNWETRIRVNKNSIQNSFERISLISASEKKYPVKVQVDIGKVIISCTN-QTGDAKEELFV-STEGKNLEAGFNPKYFLDSLKAVEDEEVFIEFGTSISPCLIKSVENNDYTYMILPIR.. 368
211 0.000e+00JGI.Meta 7029569461 SRS019685_WUGC_scaffold_54505__gene_66866 DNA polymerase III, beta subunit [Human Stool microbiome from visit number 2 o  ali  32  3.MKIVCQKDNILKAINSVTKAVASKTTMPILEGILIQTNDNDIKFTTYDLEMGIEYII-------NEAQIIEQGATVVNSIMFSEIIRKLPDTEISISLDNNNLLIIECEGSLYKLATMNPEEFPELPRIDVENSIELEQKTLKEMIRKTIFAVSTEENRPIFTGCLFEIKNNRLNVVAVDGFRLAWKTKILKEQVKDFVAVIPGRTLNEINKILLDSFDNIKIGVNKNQALFEMENCKIVTRLLDGEFLNYSSVIPENWETRIRVDRKNIQDCFERISLISASEKKYPVKVCVDIGKVIISCTN-QTGDAKEEIYCA-TEGQNLEAGFNPKYFLDALRTIDDQEIYIDFGTSISPCIIRPVDEGDYIYMILPIR.. 371
212 0.000e+00 GL0056460 [Complete] locus=scaffold13085_5:1123:2241:+  ali  33  1.MKLRFQKDDIVNGISIVMKAVPSKTTMSILECILIDASSGEIKLTGNDMELGIETTVNGE--------ILEHGKIALDAKLFSEITRRVSSQNVTIESDDKFNTTISCENSVFNIQGRDGDEFSYIPYIEKNKYISLSQFTLKEVIQQTIFSISPNDSNKMMAGELFEVNENQLKVVSLDGHRISIRNVTLKDHYENTKVIVPGKTLSEISKILGDNEKDVLIYFSTNHILFEFDQTIVVSRLIEGEYFRINQMLSSDYETKVTINKKEFLDCIERATILIRENDKKPLILNVGDNSMELKLNSS-FGSMNAELMIHK-TGKDIMIGFNPKFLIDALRVIDDEEINIYMMNPKSPCFIKD-EEANYIYLILPV... 365
213 0.000e+00gi|995953351|gb|AMJ39630.1| DNA polymerase III subunit beta [[Clostridium] propionicum DSM 1682]  clstr ali  33  1.MKLICKKDLLLQYINIVNKAVSNRTTLPILECILLTADDKGFVLTGNDLELGIKT-------AAIEADILEKGEVAIEARIFNEIVRRLNGEDVTISTNEKNAVTIVCGSSEFSIMGQGGDDFPALPEVEQNQAYTLKQNDLRNMIRQTIFSIAQDNAKPVLTGELFEFHDEFFNIVSVDGYRISYRKNNLIQSCGKNDVIVPGKTLSELNKILSQSDEDVSLYVTDKHILFDLGTAIMVSRLIEGDFIRYEQSFSEDFKTEVLVDKNQMIQSLERASLVSRDNRKTPVRFQIKTKNMEITAKS-DMGTAFEEISV-EVEGEEISIAFNPRYFIEALRSIDEENVKIHFTASLSPCTILPVEGDSFKYLILPLR.. 366
214 0.000e+00gi|511025845|ref|WP_016280105.1| DNA polymerase III subunit beta [Lachnospiraceae bacterium A4]  clstr ali  35  1.MKIVCSKTNLLNGVNTVSKAVPSKTTMSILECILIDASKGEIKLTANDMELGIETIIEGE--------ILEKGIIALDAKIFLEMVRKLPDNDVTIATDPSYKATVTCEKAKFNIVGKSGEDFSNLPQIDRSESICVSQFTLKEVIRQTIFSIADNFTNKILTGELFEINQDILKVVSSDGLRISLRRIHLKNSYPAKKVIVPGKTLSEISKILPDADKDVNIFFTSKHILFEFDSTTVVSRLIEGDYLKIDNILSADYETKVTIHKKEFQNCIDRSTLLVKEGDKKPIILNIQDDVMELKMNSI-IGSLNEEIDITKM-GKDLMIGFDPKFLIDALKVIDDEQVEIKLLNSKAPCFIKDNE-ETYTYLILPV... 363
215 0.000e+00JGI.Meta 7011783803 SRS011302_Baylor_scaffold_5643__gene_10108 DNA polymerase III, beta subunit [Human Stool microbiome from visit number 1  ali  29  4MVRFSCEKALVQQAVAAVSRAVAAKSSIPALEGILLEC-GEGLRLSGYNMQTGIRTTVEAA--------VSEAGHIVLNARLFGEMIRRLPDDMVTFEADDKFNVKLNCGDASFELPGLSADDYPELPEVDDQFSVTLEQRTLKAMINQTSFAVSVNEARPIHTGALFEINDKGLTMVAVDGFRLALRREPLEHDGGAFKFVAPGAALNEVEKICADTDDMVTVTQGKRHLMFEAGATQLICRRLEGEFLDYKNAIPTTNPICIEVDNKTMIESLDRVSVVISEKLKSPVRCLFSQDRVYMSARTGN-GEARDICPVRG-DGQELEIGFNNRYLMDALRYAPADTVKMQLNTGISPCIITPVDDDNFLYMVLPVR.. 369
216 0.000e+00gi|500342735|ref|WP_011928082.1| DNA polymerase III subunit beta [Pelotomaculum thermopropionicum]  clstr ali  32  1.MKIISDRENLFNALQVVQRAVSVKNPLPILSGIKFEAEDDRLFLTATDLEMGIRCSITAE--------VLQPGAAVLPARYITELIRKLPDQPFLIESDDTGHVTIRYASSEASMNCFQADEYPEFPVPEGKIEFTVPADTVREVIRQVIFAVGSDENRPVFTGVLFEVREGQVQVVATDTHRLAWRKFDLEESGADINLIIPGRSLNELARIAGGQDGRVKVTAAESQVLFTVGETSLITRLIGGNFPNYRQVIPQEFVSRIRAKTKDLAEATERASLLSKDGAP-AVRLDAGGNVMVVTANS-EVGRVREELAVQQ-EGEPVQIAFNARYLSDVLKVVGSEEIDIEFTGPLSPGVIRPVGSTDYLSLLLPVR.. 366
217 0.000e+00gi|524175061|emb|CCZ46770.1| dNA polymerase III subunit beta [Firmicutes bacterium CAG:129]  clstr ali  29  1.MKFSCEKLLLQNAVNTTSRAVAAKSSIPALEGLLLQCGDGVLTVSGYNMQTGIRTRFPVEE--------QEGGELVLSARLFGDIIRRMPDDMITFSSDEKLMVHLSCGDADFDILALSAADFPELPEVEEKYSVSLPEKTLRSMIQQTSFAVSTNEARPVHMGELFEIGDNGLTVVAVDGFRLALRREPLEREGGAFSFVAPGAALNEVEKICEDIDAFATITLGQRHILFEMGETELICRRLEGEFLDYKNAIPRRNPISVTVDTKAMLESLDRVSVVISEKLKSPVRCIFEQDRVLLSAKTAN-GDAKDVCRIDG-DGQGLEIGFNNRYLMDALRFAPADEIKLELNTGISPAILVPTDGESFLYMVLPVR.. 366
218 0.000e+00gi|490194733|ref|WP_004093300.1| DNA polymerase III subunit beta [Acetonema longum]  clstr ali  35  1.MKFTCTKASLQQAVQTVQKAVATKTPLSILTGIYLSASDSQLELQATDYEIGISCSIAAE--------VSEPGKAVLSGRYFQELVRRLPGETVEISTNEDTTIRISCAASQFNLLNLPYEEFPTIQKMALDHSLILKDNILRELIKKTVFACATDESRPIFTGGLLEAENTQIKMVGTNTHRLALKQDTIEEVPQPVKMIIPAKILNELGRVLTDIPQDVSVCWQKNQVAFSFDNVYISSRLIEGQFPDYNRVIPPGFQTRVQIQSQEFLDAVERVSLMARDSDYNVIKFHFADNQVQITSNNPDIGKACEIVSAV-IEGDPVDIAFNAKYVTDILKNIDSESLIFALNNSLSPASIKPIDDENYTYIITPVRT. 368
219 0.000e+00 GL0113845 [Complete] locus=scaffold1548_7:1403:2689:-  ali  32  55IMKLTFQQDAILNGINIVLKAVPSKTTMSILECIFIDASGSEIKLTANDMELGIETKVEGT--------IHERGKIALDAKLLSEIVRKLSDSVVTIESDEKFTTTISCEKSVFHIQGRDGEEFAYLPYIERDNYICLSQFTLKEVIRQTIFSIAPNDSNKMMTGELFQVSGSQLKVVSLDGHRISIRNVELKDTYHDIKVIVPGKTLSEVSKILGDNEKEVLIFFSSNHILFEFDDTIVVSRLIEGEYFRIDQMLSSDYETKITVNKRELLDSIERATILIRENDKKPLIINVVDQELQLKMNSS-FGSMNAEVTAHK-TGSDIMIGFNPKFLIDALRIIDDEEVTLYMLNPKSPCFIRDEEG-KYIYLILPV... 421
220 0.000e+00gi|524079427|emb|CCY58493.1| dNA polymerase III subunit beta [Clostridium sp. CAG:632]  clstr ali  35  1.MKIACSKSNLLSAVNTVMKAVSTKTTLPILECILIEVS-DRIKLTATDMELGIETYVDGT--------ILEEGKIALEAKLFYEYIRRLPDSEISIETNEAFQAVIRCEKSKFSISGKSGDDFSLLPEVERSHGITLSQFTIKEVIRQTIFSTVENESTKLMSGELFEINGDVLKVVSLDGHRISIRNVTLKENHDLIKVVVPGKTLNDVSKILDGGEDMVDIYFTDKHVLFEFNETKVVSRLLEGEYYKINQMLTNDYETKIMINKKELLDCIDRASLLIRESDKKPIIMNMKNDEMYIKIDSS-IGSMNEELDTRK-EGKDLIIGFNPKLLMDALRVIDDEEVSIYFINQKAPCYIKD-DEESYRYVILPV... 362
221 0.000e+00JGI.Meta 7057783704 SRS019397_WUGC_scaffold_2416__gene_6864 DNA polymerase III, beta subunit [Human Stool microbiome from visit number 1 of  ali  33  1.MKLRFQKDDIVNGISIVMKAVPSKTTMSILECILIDASSGEIKLTGNDMELGIETTVNGE--------ILEHGKIALDAKLFSEITRRVSSQNVTIESDDKFNTTISCENSVFNIQGRDGDEFSYIPYIEKNKYISLSQFTLKEVIQQTIFSISPNDSNKMMAGELFEVNENQLKVVSLDGHRISIRNVTLKDHYENTKVIVPGKTLSEISKILGDNEKEVLIYFSANHILFEFDQTIVVSRLIEGEYFRINQMLSSDYETKVTINKKEFLDCIERATILIRENDKKPLILNVGDNTMELKLNSS-FGSMNAELMIHK-TGKDIMIGFNPKFLIDALRVIDDEEINIYMMNPKSPCFIKD-EDATYIYLILPV... 365
222 0.000e+00gi|491758207|ref|WP_005587154.1| DNA polymerase III subunit beta [[Clostridium] ultunense]  clstr ali  38  1.MRIQVDQSSLSNHINIVQKGISTRTTLQILDGILLETVNGRLKLTATDLEIRIETYLD--------CDIIEEGAIVVNSRIFGDIIKKLPNSSINIKVKDN-SINITCESSEFNILGSSPYEYPELPTIINQNSFNIPKDLFKSAIRQTVFATTQDETRPILTGVLLEISNGIGSFVALDGYRLALRSIPV-ALKEDIKIVIPGRVLGELNKILDD-EEDLTITTAPGHVIFDMGDTVVSSRLLEGQFLNYKDIIRKEHKTNIKVNRKEFQDSLERASLLAKEEKANLVKLNIANNQIIIKSNS-EIGNVNEEVP-SKQEGEDINIAFNSKYVIDGIKAIDSEEIELYFMGSLNPCIINPVEDKSYTYLVLPVR.. 361
223 0.000e+00 GL0046476 [Complete] locus=scaffold4433_2:11659:12765:+  ali  32  1.MKFSCEKALLSAAVATTSRAVAVKSSIPAMEGILIEA-DTRLRLTGYNLETGIQATVPAE--------IQEPGSLVLSARLFGEIIRKMPDDVVVFTAN-HYMVNIKCGLSEFNILGTDPEEFPELPAVDQQNSLTMEQSVLRSMIAQTLFAVSDNESRPIHTGSLFEVDQTGLTLVSVDGYRLALRREAVEEGAESFSFVVPGSALGEVEKICS-GEGPVTVNQGACHILFQTGDTVLVCRRLEGEFLAYRNAIPRNNPIHVECDARTLLASIDRVSLIISEKLKSPLRCVFGDGLVSITTKTG-IGDAADQRPITG-DGQELEIGFNNKYLMDALKAAPADRLRLEFSSGVAPCVILPAEGENFIYMVLPVR.. 364
224 0.000e+00gi|551008728|ref|WP_022753297.1| DNA polymerase III subunit beta [Butyrivibrio fibrisolvens]  clstr ali  35  1.MKFVCSKSNLVSGLQIVSKAVPAKTTMSILQCILIDTTEGVIKFIANDMELGIETIVDG--------NILDRGYIAIDAKIFFDIIRKLPDNDVTIETEGNIKVTISCEKAKFTILGRSGDDFSYLPAIERIDGIQISQYTLRNIILQTIFSISDNDTNKVMGGELFEVDGNMLKMVSLDGHRISIRRVELASSYGFKKVIVPGKALSEVSKILTDSESIVSIFFTDKHVLFEFDKTVVVSRLLEGEYFNIDQMLSSDYETKLTINRREFLDCIDRATLLVKEGDKRPVIISIEDGFLEMKINSA-VGSMDEKVDIEK-QGKDLKIGFNPKFLIDALRAIDDDNVDIYLVNPKAPCFIKDA-DASYTYLILPV... 366
225 0.000e+00 [EC:2.7.7.7][KEGG:K02338] DNA polymerase III subunit beta;|[COG0592] DNA polymerase sliding clamp subunit (PCNA homolog)  ali  32  55IMKLTFQQDAILNGINIVLKAVPSKTTMSILECIFIDASGSEIKLTANDMELGIETKVEGT--------IHERGKIALDAKLLSEIVRKLSDSVVTIESDEKFTTTISCEKSVFHIQGRDGEEFAYLPYIERDNYICLSQFTLKEVIRQTIFSIAPNDSNKMMTGELFQVSGSQLKVVSLDGHRISIRNVELKDTYHDIKVIVPGKTLSEVSKILGDNEKEVLIFFSSNHILFEFDDTIVVSRLIEGEYFRIDQMLSSDYETKITVNKRELLDSIERATILIRENDKKPLIINVVDQELQLKMNSS-FGSMNAEVTAHK-TGSDIMIGFNPKFLIDALRIIDDEEVTLYMLNPKSPCFIRDEEG-KYIYLILPV... 421
226 0.000e+00 GL0030641 [Complete] locus=scaffold26274_2:584:1702:+  ali  33  1.MKIVCEKENILKAINSVTKAVASKTTMPILEGILIQTNDNDIKFTTYDLEMGIEYII-------NEAQIIEQGATVVNSIMFSEIIRKLPDTEISISLDKNNLLIIECEGSLYKLATMNPEEFPELPKIDVENSIELEQKSLKEMIRKTIFAVSTEENRPIFTGCLFEIKNNRLNVVAVDGFRLAWKTKALKEAVKDFVAVIPGRTLNEINKILLDSFDIVKIGVNKNQALFEMENCKIVTRLLDGEFLNYSSVIPENWETRIRVDRKNIQDCFERISLISASEKKYPVKVCVDIGKVIISCTN-QTGDAKEEIYCA-TEGQNLEAGFNPKYFLDALRAIDDPEIYVDFGTSISPCIIRPIDDGDYIYMILPIR.. 369
227 0.000e+00 GL0084224 [Complete] locus=scaffold3179_3:518:1633:-  ali  34  1.MKFICEKEKLLKGINSVINGVASKTTMPILEGILINTNDNEVKLTSYDLEIGIEYII--------NCKVEEQGNTVVNATMFSEIIRKLPNTDIKITINSNNLLVIECEGSLYKLATMNPDEFPELPKINVDNSIEIEQNVLKNMIRKTIFAVSTEENRPIFTGCLFEVVDNKLNVVAVDGYRLAIKSNVLNVKANDFNAVIPGKTLNEVNKIILDSFDTVKIGISKNQALFEMENCKIVTRLLDGEFLKYSNAIPSSWETKIIVNKNNLQDCFERISLISSASKKYPVKISIDIGKVVISCAN-QTGDAKEEIYV-ETEGKNLEAGFNPRYFLDALKAIDDEEVAIEFGTSISPCIIKSVENGDYIYMILPIK.. 368
228 0.000e+00gi|524091788|emb|CCY69261.1| dNA polymerase III subunit beta [Eubacterium sp. CAG:161]  clstr ali  32  1.MKLVCKKSDLISGINIVMKAVSSKTTMSILECILIDATEGEIKMTANDMELGIETKVLGE--------IIEAGSIAIDAKIFSEIVRKLPDNDVLIEVNDEIKANITCENAKFNILVKSAEDFSYLPVIEKNNKITISQFSLKEVIRQTIFAINDAEKNKLLTGELFEVHGNKLKVVALDKFRIAIRNIELKEEYGDFKVLVPGKSLNEISKILNGGDDDVNIYFTNNHILFEFDDTIVVSRLIEANYFDTDKMISNDYKTKITINKKEMADCIDRATLLIKEGDKKPVFLTIKDTEMELSINTF-IGSMDESIPISK-EGSDIMISFNPKFLIDILKVLDQEQVSIFFTNPKAPCFIRDEEN-SYIYIVLPV... 364
229 0.000e+00JGI.Meta 7017086730 C3362013__gene_294477 DNA polymerase III, beta subunit [Human Stool microbiome from visit number 1 of subject 706846339]  ali  33  1.MNIICDKNKLLEGINIVLKAIPGKSTMAILECLVIEAENNTIKLIANDLEIGIETVIEGE--------IVEEGCVAISAKVFSDIIRKLPSEQVEINVDEAYQLNIKCGKAKFNISAKPTDEFPYLPQIVKDKYVEISQFTLKDIIRQTVFSISDNENAKVMTGELFEINNSTLKVVSLDGHRISIRKVELKNNYDNISVIIPGKTLIEINKILNGGDDEVKIYFTEKHILFEFDNTIVLSRLIEGEYYKIDKMLSSDYETKITVNKKDMLDSIDRTTLLVKESEKKPVIIDIKDNSIGFAMNSS-IGSMHEEMDAVR-EGKDIIIGFNPRFLMDALRVIDDEEITLYMINPKAPCFIRDK-DESYIYLILPV... 363
230 0.000e+00JGI.Meta 7009619471 C2356461__gene_173891 DNA polymerase III, beta subunit [Human Stool microbiome from visit number 1 of subject 160218816]  ali  31  32.MKFTVEKRLLNEAVTNLQRAVSSKTSIPALEGILIRSEENRLILTAYDLEIGMQTELPAI--------ISAPGAIILTAKLFAEIVRRSPDEDITIDVDDRNTATITSGVSCFTIIGMDSAEFPELPKIADADTIKMPQELLKSMIRQTLFAVADSTAKPIHQGSLFKIENGNLDVVSVDGYRLALRREAI-NYANNTEFVVPGKTLSEVLKLLKDSEGEVEICPSRRHILFRIDNYTVISALLEGEFLDYKSALPKDKKTEVTVSTRTMIESVERVSLLITDRLKSPVRCVIGEDTVKLFCTTT-MGRATDQISA-EISGDQLEIGFNNKYLLDALRAAETDEVRLQLGGPISPMLVLPKEGDAFSFLVLPVR.. 394
231 0.000e+00 GL0044139 [Complete] locus=scaffold33203_1:301:1401:+  ali  33  1.MKLVCKKSDLITGINIVTKAVSSKTTMSILECILIDATEGVIKFTANDMELGIETKVEGE--------IIEAGSIAIDAKIFSEIVRKLPDNDVVIEVNDETKANITCENSKFNILVKSADDFSYLPEIEKKDKITLSQFALKELIRQTIFTVNDADKNKILTGELFEVMGNRLKVVALDKFRIAIRNMELKEDYGNFKVLVPGKSLNEISKILNGGDDEVNIYFTSNHFLFEFDETKVVSRLIESNYFDTDKMISNDYKTKITINKKEMANCIDRATLLIKEGDKKPVFLTIKDTEMELSINTF-IGSMDESIPIVR-EGSDMMISFNPKFLIDILRVLDSEEVNIYFTNPKAPCFIRD-DENSYIYVVLPV... 364
232 0.000e+00gi|493963147|ref|WP_006906608.1| DNA polymerase III subunit beta [Shuttleworthia satelles]  clstr ali  32  1.MKITCSQAELVKGVNIVTKAVPTRTTMPILQCILIDASANQIKLMANDMEIGIETIIDG--------RIEERGIIALDASIFSNIVKKLPDSQVVITTGESFQANISCEKANFNINGMDGENFAYLPVIPRNEPVVISEFTLKEVIRQTIFSIADNENNKLMAGELFEIHGSRMRVVSLDGHRISIRNIELKSECPDYKVVVPGKTLNEISKIIPGSEENVMIYITENHIIFEFGQTTVVSRLIDGEYFKIEQMLSSDYETKIRISKRELLECIDRATLLVNPGDKKPIIMNVTDGNMELNIQSF-IGSMNENIAIDK-EGRDILIGFNPKFFIDALRNIDDEEITIYMVNPKAPCFIKD-DDNKFLYLILPV... 363
233 0.000e+00JGI.Meta 7034679281 C2662819__gene_274175 DNA polymerase III, beta subunit [Human Stool microbiome from visit number 1 of subject 763577454]  ali  33  1.MRFVCDTNELNTALSIVSRALAVRSTKPILEGILFESCDEGLRLTCTDLALGIETTLPATF--------SEEGRAVLPGKLLCEIIRKLPGGSCDIAIGERMQATIRCASIRTTITGFDPVEYPELPQVEGE-SFSLPQNTLKDMIGRTLFAIAQDESRPILTGCLMEINHTEMRVVALDGFRLALRKENVQGPNAEINAVVGGRVLGDIAKILADTEEEASLCFTKTHIRLNIGQTRIVARLLEGEFIRYRQILPEEWQTRVTVERAELGSAIDRASLIAREGKTNLVCFKIDGETLEVTSNS-ETGDMEEKMNVM-TEGKDLTIAFNVRYITDVLKALSDDQVVMRFNSNVSPCVVCPTEGDAYLYLVLPVRVF 365
234 0.000e+00JGI.Meta 7037930057 SRS014923_WUGC_scaffold_57160__gene_113808 DNA polymerase III, beta subunit [Human Stool microbiome from visit number 1  ali  32  1.MKIVCYKDKILKAINSVVKGVASKTTMPILEGILIQTNDNEIKLTTYDLEIGIEYVME--------CDVKEQGSTVVNAIMFSEIIRKLPDTEIYLTLNDKNLLEIECEGSLYKLATMNPEEFPELPKIEVENSIEVEQNTLKNMIRKTIFAVSNEENRPIFTGCLFEVKQNKLNIVAVDGFRLALRSIFLNKQTNDFSAVIPGKTLNEVNKILLDSFEPVKIGVSKNQALFEMDNCKIVTRILDGEFLNYKSVIPDNWETRIEVNKNNLQNSFERISLISASSKKYPVKINVDIGKVVISCTN-QTGDAKEELFV-STEGKNLEAGFNPKYFLDSLKAIDDENVYVEFGTSISPCLIKSTENKDYVYMILPIR.. 368
235 0.000e+00gi|491802612|ref|WP_005608202.1| DNA polymerase III subunit beta [Granulicatella adiacens]  clstr ali  42  1.MKFSVNRQGFLKNLVDVQRAIPSKTTIPILTGIKLVASEEGLTLTGSDSEVSIEVFLPIE-DEELQLTVQEPGSIVLPARFFGEIVKKLPLNLFSIETNDQLQATITAGSASFTLNGLSAVDYPQLPEIEKNHVITIPVPLFRQVIVQTAVAVSTAESRPILTGIHMVIKDNKLKAVATDSHRLSQRIIPLQMPAGSFEMTLPGKTLLELSRII-DGLETIDFAITDNQILFQTETLSFYSRLLEGMYPDTDRLINDGANTSITVVASELVAAVERASLMSHTDKNNIATLTLSPERILLTGKSPEVGTVEEEIAVENFEGAPLEISFNPDYLKEALKLFGSSEAVINFLEANRPFTLKLKEDHSFIQLVTPVRTF 383
236 0.000e+00gi|524754148|emb|CDE53075.1| dNA polymerase III subunit beta [Roseburia sp. CAG:303]  clstr ali  34  1.MHLVFNKSNLLQSINIVLKAVPSRTTMPILECILIDASSDCIKFTSNDTELAIETIVEGE--------IISKGIVAIDAKIFSEIIRKLPDSEITITTDENFKTTITCEKATFSLAGKPGDDFSYLPAFEKNQFIYLSQFTLKELIRQTIFSIADNDTNKLMTGELFEVKGNLLTVTALDGHRIAMRKAELKETFDNIKVIVPGKTLNEISKILSDTESDIRIFFENNLIAFEFDHTVVVSRLIDGDYFKVEQMISSNFDTIIKVNKKEFLDCIDRSTLLVKEGDKKPIIINITENELELKISSF-LGSMNEHIAIEK-NGKDIMIGFNPKFLMDALKVIDEENVDIYLVNSKAPCVIKN-EDETYIYLILPV... 363
237 0.000e+00gi|960881447|ref|WP_058352937.1| DNA polymerase III subunit beta [Acetivibrio ethanolgignens]  clstr ali  33  1.MKIICSKADLLNSVNIVMKAVPAKSTMPILECLVIEVKNGIIKLTANDMELGIETLVKGE--------VIADGVIAINAKIFADIIRKLSDNDIIIETDDNFMAHISCEKAKFDIAGKSNDEFPLIPKIERDCSIELSQFSLKEIIRQTVFSISDNESNKIMTGELFEITGNEFKVVSLDGHRISIRKISLKESYDHIKIIVPGKTLNEISKILSGEEDMVKIFFTNKHIVFEFNDTMVLSRLIEGEYYRIEQMLSSDYETKVTINKKEFLNCIDRATLLVKESEKKPIIINVGEQNIELCINST-IGSMKEEIDITK-EGKDILIAFNPRFLMDALRVIDEEEVDIYLFNPKAPCFIKDKE-ETYIYLILPV... 363
238 0.000e+00gi|501391671|ref|WP_012423237.1| DNA polymerase III subunit beta [Clostridium botulinum]  clstr ali  34  1.MIFICEKHKLLDGISIVQKAITGKSTMKVLDGIYINATNDGLRLIGSDMDLSIQTLVNA--------DVLDKGEIVIDAKIFGEIIRKLPNSDIKIETVKEDVIQITCEKSVFNVVCMNAEEFPSLPNINEDLKVEVNESILKNMIKGTSFSIAQDEARPILQGILFQVKDRNLNLVALDGYRLAIRSEFLDNDI-NLEVVIPGKTLVEVSKILEDHDKNVDITFTNNHILFNLENTKIISRLLDGKFVNYTSLLPQEHKLLVTVKKEEFQNGIERASLMAKDGNNNLINLDLKEETLIITSNS-QLGKVREEVSIN-LQGDEIEIAFNSRYLLDVLKNMESDEVILEMTSGVSPCVIKEKDGENSQYLVLPVR.. 363
239 0.000e+00gi|928937967|ref|WP_053962786.1| DNA polymerase III subunit beta [Clostridiales bacterium mt11]  clstr ali  38  1.MRIQVDQKNLANRINIVQKGISSRTTLQILDGILLETVNGKLKLTATDLEIGIETYV--------NCNIIEEGSIVVSSRIFGDIIKKLPESTINIVVEENN-INIKCEGSEFNILGNGANEYPELPTIINQTSFNMPKDLFKSAIRQTVFATTQDETRPILTGVLLEIVNGIGSFVALDGYRLALRSIPI-NSDEDVKVVIPGRALSELNKILDDDEDDFTIIIAPSHIIFNIGDTLVSSRLLEGQFLNYKDIIRKEHKTNVVVNKKAFQDSLERASLLAKEEKANLVKLNVMDDEIVIKSNS-EIGNVYEKISA-EHEGEAVNIAFNSKYIIDGIKVIDAEKIELNFMGSLNPCIIKPVGDENYTYLVLPVR.. 362
240 0.000e+00gi|503035769|ref|WP_013270745.1| DNA polymerase III subunit beta [[Clostridium] saccharolyticum]  clstr ali  32  1.MKLTFKQDEILNGINIVLKAVPSKTTMSILECIFIDASGSEIKLTANDMELGIETKVEGT--------ILERGKIALEAKLLSEIVRKLSDSLVTIESDEKFTTTISCENSVFHIQGRDGEEFAYLPYIERDHYICLSQFSLKEVIRQTIFSIAPNDSNKMMTGELFQVTGNQLKVVSLDGHRISIRNIELKDTYHDIKVIVPGKTLNEVSKILGDSEKEVLIFFSTNHILFEFDDTIVVSRLIEGEYFRIDQMLSSDYETKTSVNKRQLLDCLDRATILVRENDKKPLIMNIEDQEMELKMNSS-FGSMNAQVPIHK-TGSDIMIGFNPKFLIDALRIIDDEEVTLYMLNPKSPCFIRDEEG-KYIYLILPV... 366
241 0.000e+00gi|497924522|ref|WP_010238678.1| DNA polymerase III subunit beta [Clostridium arbusti]  clstr ali  33  1.MKFKCEKSKLQEAISIAQKAVTGKSSMPILQGLLLIAEQDQITIIGSDIDLSIETKLEAE--------VIETGKIVVDSKLFGDIIRKLPNSNIEISSIDDNSIKLICEKSNFTLVHMNPDDFPSLPSIDEEMIFSIEQKTLKNMIKSTIFAIAQDESRPILTGVLFEVKDKKVNLVALDGYRLAFRSEPIDND-NSMSAVIPGKTLNEVVKILQD-DGVVNITFTSNHILINLEKTKIISRLLEGEFIKYTSIIPEEHNLRVDVKRGELLNCIERASLVGKDGNTSLIKLDIEDDYMVITSNS-QLGKVREELNII-LQGEKLQIAFNSKYLIDLLKIIEEEEIYMDFSSSVTPCLVKSKENNNYTYLILPVR.. 362
242 0.000e+00gi|914631367|ref|WP_050623042.1| DNA polymerase III subunit beta [Clostridium sp. GD3]  clstr ali  31  1.MKFSCEKALLLGAVSTASRAVAVKSSIPALEGILIEA-GEQLRLTGYNLETGIRAAVPAE--------IREKGSLVLSARLFGEIIRKMPDDVVVF-TSENYMVNIKCGLSEFNILGTDPEEFPELPSVEEQNGLTIGQPVLRSMIAQTLFAVSDNESRPVHTGSLFEVDESGLTVVSVDGYRLALRHEPVDSSQGPFSFVVPGSALSEVEKICA-GEDAVSVAQGARHIQFQAGDTVLVCRRLEGEFLAYKNAIPRNNTIKIEGDARTLLQSIERVSLIISDKLKSPLRCVFGDGMLSITTKTG-IGDAADQCPITG-DGQGLEIGFNNKYLMDALKAAPADRLRLEFTSGVAPCVILPAEGENFVYMVLPVR.. 364
243 0.000e+00gi|503249313|ref|WP_013483974.1| DNA polymerase III subunit beta [Ethanoligenens harbinense]  clstr ali  33  1.MQFRCNTKKLAEALAVAGRAVSSKTSMPALEGILIRTGDHQIILQAYDLELGISTTIEAECRSD--------GEIVLNAKIFADMVRKLPGDTVEVKSDDKLLTIVTSGAAEFTILGTPAVEFPELPSLSDGASIELPENLLSSMIRQTIFAISTDESNPIHTGILFELQEKTLRLVAVDGFRLAIRTEPVTQD-GSFAFVVPGKTLAEISKLLSESDEKITVTVGEKHILFDIAGYTVISRLLEGQFLDYKSVLGGNTTAHARVNARALTDSIDRASLLITDRLKSPVRCIFESDRIRIKCSSS-IGKVYDEVSAA-FEGEPCEMGFNNRYLMDALKAADCDEVRIQLGGPLSPMKICPPDGDAFIFLVLPVR.. 364
244 0.000e+00gi|524380292|emb|CDB32480.1| dNA polymerase III subunit beta [Clostridium sp. CAG:575]  clstr ali  33  1.MKIVCYKDKILKAINSVVKGVASKTTMPILEGILIQTNDNEIKLTTYDLEIGIEYIME--------CDVKEQGSTVVNAIMFSEIIRKLPDTEIYITLNDKNLLEIECEGSLYKLATMNPEEFPELPKIEVENSIEIEQNNLKNMIRKTIFAVSTEENRPIFTGCLFEIQNNKLNIVAVDGFRLALRSIFLNKQTNDFSAVIPGKTLNEVNKILQDSFEPIKIGVSKNQALFEMDNCKIVTRILDGEFLNYKNVIPENWETRIKVNKNNLQNSFERISLISSSSKKYPVKVKVDIGKVTISCTN-QTGEAKEELFV-STEGKNLEAGFNPKYFLDSLKSIDDEEVYVEFGTSISPCLIKSVENKDYVYMILPIR.. 368
245 0.000e+00gi|524268136|emb|CDA30513.1| dNA polymerase III subunit beta [Clostridium sp. CAG:492]  clstr ali  34  1.MKIICEKEKIIKALNSVTKAVASKPNNPILEGILIQTNNNELKLTTYDLEIGIEYIID--------CEVEEEGAIVVNATMFSEIIRKLPNTDISISVNDKNLFVIECEGSLYKLATMNPSEFPELPQISIENSIQIEQNNLKDMIRKTIFAVSTEENRPIFTGCLFEITNNKLNLVAVDGFRLAWKSKYLQTKVNDFKAVIPGRTLNEINKILVDSFEPIKIGVAKNQALFELENCKIVTRLLDGEFLNYSSVIPETWETRIRVNKSNLQNCFERISLISSSSKKYPVKISVDIGKVTISCTN-QTGDAKEEMFV-STEGKNLEAGFNPKYFLDACRSIDDEEIFVDFGTSISPCIIRPVEDGDYIYMILPIR.. 368
246 0.000e+00 [EC:2.7.7.7][KEGG:K02338] DNA polymerase III subunit beta;|[COG0592] DNA polymerase sliding clamp subunit (PCNA homolog)  ali  33  16.MKLQFQKSALLNGISIVSKAIPAKTTMSILECILIDADADQIKLTGNDMELGIETKVEGS--------ILERGKIALDAKLFYEIIRKLPDGEVIITSDNKFNTTIQCESALFNILGRDGEEFSYLPYIERDQYITLSQFTLKEAIRQTIFSISPNDSNKMMAGELLEVKENILKVVSLDGHRISIRNIALKESYESHKVIVPGKTLSEISKILGDNEKEVQIFFSKNHILFEFDDTMVVSRLIDGEYFKIDHMLSSDYETRVKVNKREFMDSIDRSMILIRDSDRKPIILNVEDSNVNLKVRST-IGSMNADVSAYK-AGKDIMIAFNPKFLLDALRVIDDEEVELYMMNPKSPCFIKDEEG-TYIYLILPV... 380
247 0.000e+00JGI.Meta 7021524117 SRS011126_Baylor_scaffold_77820__gene_103465 DNA polymerase III, beta subunit [Human Supragingival plaque microbiome fro  ali  42  1.MKFSVNRQGFLKNLVDVQRAIPSKTTIPILTGIKLVASEEGLTLTGSDSEVSIEVFLPIE-DEELQLTVQEPGSIVLPARFFGEIVKKLPLNVFTLETNDQLQATITAGNASFTLNGLSAVDYPQLPEIEKNHVITIPVPLFRQVIVQTAVAVSTAESRPILTGIHMVIKDNQLKAVATDSHRLSQRIIPLQMPAGSFEMTLPGKTLLELSRII-DGLETIDFAITDNQILFQTETLSFYSRLLEGMYPDTDRLINDGANTSITVVASELVAAVERASLMSHTDKNNIATLTLSPERILLTGKSPEVGTVEEEIAVENFEGAPLEISFNPDYLKEALKLFGSSEAVINFLEANRPFTLKLKEDHSFIQLVTPVRTF 383
248 0.000e+00gi|769141143|ref|WP_044918453.1| DNA polymerase III subunit beta [Lachnospiraceae bacterium MA2020]  clstr ali  32  1.MKITCLKDNLVNGVSIVSKAVPGKTTMPILECILIEASNGIIKFISNDMEMGIETIIDGE--------IEENGIIALNAKFFGDMVRRLPDGFVTIQTDSSMQTTITCSHTKFNLPGKSGDDFPYLPAFDRTDSISISQYALKELVRQTIFSISDNDNNKIMTGEYFEINEDHLRAVALDGHRISIRNIDLDQSYDPKKVIVPGKTLSEVSKILPDTDKKVNIFFMDNNIIFEFDNTTVISRLIEGKFFDIDQMITDNYASKVKIKKSDFLNSIERATLLIKEGDKKPVVFNITEGNIELKINSS-LGSLDENLEIEK-SGNDVMIGFNPKFLIDVLRVIEEDEISVYLLDSKAPCFIRD-DAHKYIYIVLPV... 363
249 0.000e+00gi|524391706|emb|CDB41905.1| dNA polymerase III beta subunit [Ruminococcus sp. CAG:177]  clstr ali  33  1.MKFVCGTAELSEACLNVQRAVSTKTSIPAVEGILIKAVSGQLILTGYDLELGINTAIKAT--------VEEEGSIIINARILCDIMRKLPGESVRFESDARLLASIVSGNAKYSLIGMSAEEYPELPSVSGGYPIVINQGILKDMVRQTIFAVAVNDSKVVHTGVKFDISGNILKLIAIDGFRLAVRKENIDYSGDDISFIVPAKTLSEIMKLMNDDDGTISLGVGKRHIVFEISSYSVVSRLLEGEFLNYESAIPPKCTTRVRVNTRDMINSIDRASLIISEKYKSPIKCVFADNMIRLSSVTS-LGTASDSVSA-EIDGDDVEIGFNNKYLTDALRVADTDEVNFKLNGPVSPIIILPPEGDSFLFLVLPVR.. 364
250 0.000e+00 [EC:2.7.7.7][KEGG:K02338] DNA polymerase III subunit beta;|[COG0592] DNA polymerase sliding clamp subunit (PCNA homolog)  ali  31  58.MKFVCQKDLLVEAVSNVSRAVCAKSPIPALEGILLKAQEGQLQLTGYDLELGIVTTIEAKT--------EQQGELVLSAKLLLDIIRRIPGETVSIVSDEKNLATIRGGASEFTIPGILADEYPELPNVEEKSDLVMKQGTLKSMIDQTLFAIATTDSKPVHTGSLFDIKDSCVTLVSVDGYRLALRREAIVSDL-NTKFIVPGKTLSEISKLLREEDEEAYLVVSQKHIVFRISGYYVVSRLLEGDFLDYNAAIPKISKTTVKINTRSLTDSVERTSLLISDRLRSPIRLVVTENKVQLSCSTA-MGKAHDEVDC-EVSGEAVSMGFNNKYLLDALKASDCDMVKLEINGALSPMRMIPMEGDSFLFLVLPVR.. 420
251 0.000e+00 GL0149246 [Complete] locus=scaffold25019_1:1017:2174:+  ali  29  17MLRFSCEKALLQGAVNTASRAVAAKSSIPALEGILLE-GGDTLTLSGYNMQTGIRTGVDA--------QIQSPGRIVLSARLFGEMIRKMPDDVIVFDADDKLTVHFTCGDASFEIIGLSADDYPELPEVDDQFSVDIRQGTLKAMINQTSFAVSTNESRPVHTGSLFEVGDKDLTVVSVDGFRLALRREPLDSEGGAFKFVAPGSALNEVEKICEDSDEKITIIQGKRHLLFEAGATQLICRRLEGDFLDYKNAIPRNNPIRLTVDTKTMLGSLDRVSVVISEKLKSPVRCVFENGRVMLSARTG-AGEAKDICPLDG-DGNGLEIGFNNRYLMDALRYAPADAVTMELNTSISPAVLVPVDGESFLYMVLPVR.. 382
252 0.000e+00gi|654793195|ref|WP_028247153.1| DNA polymerase III subunit beta [Pseudobutyrivibrio ruminis]  clstr ali  32  1.MKITCQKSDLVKGVNIVSKAVPVRTTMAILECILIDASAGEIKLTANDMEIGIETIVNGS--------ILERGIIALDAKKFSEIVRKLPDNEVTIETDSAYRTSITCEKAKFDIIGKSGEDFSYLPNIQRNQPIVISQLTLRDIIRQTIFSVADNENNKMMTGELIEIKDNKLKVVALDGHRVSIRNVELKNPAEDVKVVVPKKTLNEIIKIVDGGDDEVNIFVTDNHIIFEFDQTTVVSRIIEGEYFKIEQMLSADYETKIKINKREFFDCIDRATILVNEGDKKPIIVNAAGNTMSLSISSF-IGSMNEDIDIVK-EGKDIMIGFNPKFVMDALKVIDDEEINLYMLNAKSPCFIKDDEG-SFIYIVLPV... 363
253 0.000e+00JGI.Meta 7007511350 C2590984__gene_236335 DNA polymerase III, beta subunit [Human Stool microbiome from visit number 1 of subject 764588959]  ali  35  1.............GVNIVSKAVPTRTTMNILECILIDASTDEIKFTANDMELGIETKIEGE--------IVEHGIIALDAKIFSEIVRKLPDNEVTIETDNSFQTLITCEKAKFNIIGKSGEDFSYLPYVERMDSIIMSQFTLKEVIRQTIFSIADNDNNKLMTGELFEISENQLKVVSLDGHRISIRNINLKDYYKYKKVVVPGKTLNEISKILPGSDKEVVIYITDNHIIFEFDQTTVVSRLIEGEYFRIEQMLSSDYETKVRINKKELLDCIDRATLLIKEGEKKPIIMNVADGHMELKINSF-IGSMNEDIDIDK-EGKDILIGFNPKFFIDALRVIDEEEVTLYMVNPKAPCFIKD-DEESYIYLILPV... 351
254 0.000e+00gi|524498656|emb|CDC36120.1| dNA polymerase III subunit beta [Butyrivibrio sp. CAG:318]  clstr ali  32  1.MKIICTKNDLLKGVNIALRAVPVRSTMSILECILIDARETDIKLTANDMELGIETSISG--------DIIERGRIAIEARFLSDIVRKLPDSEVTIETDDSYNATISCEKSVFNIPGKSGEDFSYLPYIERDKHITLSQFALKETIRQTIFSIGDSESNKIMKGELFEVTNNNLKVVSLDRYRVSIRNVTLNNSYEPVSVIVPGKTLSEINKILSEADSDVNVFFSENHIIFEFENTVVVSRLIDGEYFKINQMLSKDFQTKIEINKKELLDCIDRATLFVKEGNKNPVIFNITDGSLKINIVSP-VGKMNEEIDINK-EGSDIRIGFDAKFLIDALRVIDDEVLSMYYMNAKAPCTIKD-DKENYIYLILPV... 363
255 0.000e+00gi|524416963|emb|CDB66933.1| dNA polymerase III subunit beta [Eubacterium sp. CAG:248]  clstr ali  33  1.MKLVFSKSELNKAVGIVMKAVPVRTTMNILECILIDATTNVIKFTGNDMELGIETIVDGE--------ILEKGKVAIEAKLFSEIVRKLPDSEVTITTDSNYTSLITCENSKINIAGKSGDDFSYLPIIDKDKMITISQFKLKEIINQTIFSTAPNDNNKMMTGELFEVSENTLKVVGLDGHRIAIRNITLEGRADDVKVVVPGKTLQEISKILSDAENMVNIYFTNNHILFEFDNTIVVSRLIEGEYFKISQMLSSDYETKVVINKKEFIDSIDRANLLITESEKKPIIINITDGSLEVNVNSSK-GKSNENIDIKK-EGKDLMIGFNPKFLMDALKVIDDETVDIYLVNPKAPCFIRDA-NQSYIYLILPV... 363
256 0.000e+00gi|524100725|emb|CCY76505.1| dNA polymerase III subunit beta [Butyrivibrio crossotus CAG:259]  clstr ali  33  1.MKIVCTKSELLKGVNITLRAVPVRTTMTILECILIDATELDIKLTANDMELGIETTIDG--------DIIEKGKIAIEAKFFADIIRKLPDSEITIETDSNFNASITCEKSVFNIPARDGEDFSYLPYIEKNNMITISQFDLKELIRQTIFSIGDNESNLIMTGELFEVTEDNLKVVSLDRYRVSIRNVKLNNIYNDIKVIVPGKTLNEISKIIGDAESMVDVYFSDNHILFEFDKTIVISRLIEGEFFKINQMLSKDYETKITINKRELLDCIDRATLFVKEGNKKPVIFDIEDGSVKINITST-VGKMNEEIDIEK-EGSDIKIGFNPKFVIDALRVIDDETISMTFMNAKSPCTIRDKDN-RYIYLILPV... 363
257 0.000e+00 GL0049799 [Complete] locus=scaffold85847_1:3193:4314:+  ali  34  1.MKLICEKDKILKALNSVTKAVAVRTTMPILEGILIQTNDNEIKLTTYDLEIGIEYII-------NDCKVEEQGATVVNAIMFTEIIRRLPDTDISIEVNDKNLLVIECEGSLYKLATMNPDEFPELPKISVENSIEIEQTILKDMIRKTIFAVSTEENRPIFTGCLFEIANNKLNVVAVDGFRLAWKSKFLQNKVNNFSAVIPGRTLNEINKILIDSFDMIKIGVAKNQVLFEMENCKIVTRLLDGEFLNYSSVIPETWETRVRVNKSILQDCFERVSLISASSKKYPVKVTVDIGKVTISCTN-QTGDAKEEIYV-STEGKNLEAGFNPKYFLDALRNIDDEEIFVDFGTSISPCIIRPVDEEDYTYMILPIK.. 370
258 0.000e+00 [EC:2.7.7.7][KEGG:K02338] DNA polymerase III subunit beta;|[COG0592] DNA polymerase sliding clamp subunit (PCNA homolog)  ali  33  1.MKIVCYKENMIKAINSVVKGVASKTTMPILEGILIQTNDNEVKLTTYDLELGIEYVIE--------CDVKEQGSTVVNATMFSEIIRKLPDTEIYITLNEKNILEIECEGSHYKLATMNPDEFPELPKIEVENSIELEQNTLKNMIKRTIFAVSTEESRPIFTGCLIETENNKLNIVAVDGFRLALRSVYLTQKTNDFNAVIPGKTLNEVNKILLDSFEPVKIGISKNQALFEMDNCKIVTRILDGEFLNYKNVIPNTWETRIRVNRSNLQDCFERISLISSSSKKYPVKVVVDIGKVTISCTN-QTGDAKEELFI-STEGKNLEAGFNPKYFLDSLKVIDDEEVYVEFGSSISPCLIKSTENNDYVYMILPIR.. 368
259 0.000e+00 [EC:2.7.7.7][KEGG:K02338] DNA polymerase III subunit beta;|[COG0592] DNA polymerase sliding clamp subunit (PCNA homolog)  ali  33  1.MKLIFTKSNLSKAVNIVLKAVPSKTTMNILECILIDASSDIIKFTANDMELGIETIVEGE--------IIEKGQIAIDAKIFSDIVRKLPDNDITIETDDNFNALITCEKSKFNIAGKSGEDFSYLPIITKEKSIHISQFELKEVIAQTIFSIAINDNNKIMTGELFEVVNGTFKVIALDGHRIAIRNVSLSGMADDVKVIVPGKTLNELNKILSDAESQVNIYFTSNHILFEFENTTVVSRLIEGEYFKVNKMLSNDYKTKVVINKKDLLDSIDRANLLIKENDKKPIIINVIDGSMEVKVTST-LGSSKEDIDIQK-DGSDIMIGFNPKFLLDALRAIDDEYVSIYFVNPKAPCFIRD-NNETYTYLILPV... 363
260 0.000e+00gi|494123557|ref|WP_007063334.1| DNA polymerase III subunit beta [Clostridium carboxidivorans]  clstr ali  37  1.MKFTCEKSILQEGISTVQKAITGKSTLPILNGIHIKTHENELILTGSDIDLSIESKIK--------SDIIEEGSIVIDAKIFGEIIRKLDNDTIHISTIDNNSIEIVCKKSRFTLIHMNSEDFPELPNINENMIFSIPQSILKNMIRGTIFATAQDETRPILTGILFEIKDKKLNLVALDGYRLALKSETLDTD-NIISAVIPGKTLSEVSKILEENDESVNITFTPNHILFSVGETKIISRLLEGEFIKYNSIIPEEYNLKIIAKRIVLLNSIERASLMGKDGNTNLIKFDIEDENMVITSNS-QLGMVREELNII-LQGEPLQIAFNSKYLIDVLKIMEEDEVVIELSSSVSPCIIKNKNTNNCTYLVLPVR.. 363
261 0.000e+00JGI.Meta 7037944605 SRS014923_WUGC_scaffold_59797__gene_128356 DNA polymerase III, beta subunit [Human Stool microbiome from visit number 1  ali  30  1.MNIICNKNQLAKGVGIVSRAVSGKTTLPILECILLDATSGEFTLIGNDLDMGIKTVLEA--------NIKEQGTIAVNAKIFNEIIRKLPDEDVSIETDERNNITIRCAKSKFNIPGQSSADFPELPTIESNHQLVLSQGIFKNMIHETIFSIAPEDSRPILTGELIDVRDGYLHLVAVDGFRISMRRTEV-NSENDFKVTVPGKALNEIHKILSEDDELMTVSFTGKHILFQMNETLVVTRLLEGEFLQYQRNLSMDFTSKIRINKKDLLDSIDRAALISRESKNSPVRLEIDKEKMVITSNT-ELGSAYEEVPLQ-LEGEGLTIAFNPKYYLEALRVIEEEEVCILYSSSLTPCIIQDPEKEDYQYFILPIRLH 367
262 0.000e+00 GL0074021 [Complete] locus=scaffold47710_1:358:1473:+  ali  34  1.MKIICEKEKIIKALNSVTKAVGSKTTMPILEGILIQTNNKEVKLTTYDLEIGIEYIID--------CEVKEEGAIVVNATMFSEIVRKLPNTEITIYVNENNLLVIECEGSLYKLATMNPNEFPELPQINIENSIQIEQNVLKDMIRKTIFAVSTEENRPIFTGCLFEISNNKLNLVAVDGFRLAWKSKYLQNKVNDFSAVIPGRTLNEINKILVDSFEHLKIGVAKNQALFELENCKIVTSLLDGEFLNYSSVIPETWETRIRVNKENLQNCFERISLISSSSKKYPVKVSIDIGKVIISCTN-QTGDAKEEMYV-STEGKNLEVGFNPKYFLDACRSIDDEEIFVDFGTSISPCIIRPVNDGDYIYMILPIR.. 368
263 0.000e+00gi|930607767|ref|WP_054259934.1| DNA polymerase III subunit beta [Propionispora sp. Iso2/2]  clstr ali  35  1.MKISCSKELLTHAVQTVQKAVASKTTLPILTGIYLSAADGKLELQATDYEIGISCTVDA--------DIEEPGTIVLSGRYFQELVRKLPGDTIQISQQAEKTIQITSNSAQFNLLLLPAEEFPVLNKLQGESSFVIKDNVLRELIKKTVFSCATDEARPIFTGALLEINQMNAKMVATNTHRLALKQDTLEKNSNQFKMIIPAKILNELARLLSEHPLDVWVSWQKNQVSFSFDNVYIKSRLIEGQFPDYNRVIPENFATLVKLNTDYFLDAVERVSLLARDGEYNVIRLCFKNNMVIINSNNPDIGKACETVEA-EIEGNELEIAFNAKYVTDILKNIHSDKLVFSLNTPLSPACIKPVDDDLYTYVITPVRT. 368
264 0.000e+00gi|503044437|ref|WP_013279413.1| DNA polymerase III subunit beta [Butyrivibrio proteoclasticus]  clstr ali  32  1.MKFVCSKSNLVSGLQIVSKAVPSKTTMSILECILVDATEGIIKFIANDMELGIQTVVEG--------NIVERGYIALDAKIFVDIVRKLPDNDVTIESDSTNKVTISCERAKFNLIGRKGDDFTYLPSIEKIDGVTVSQYTLRNVIQQTIFSIAENDANKMMAGELFEVDGENLKLVSLDGHRISIRKVKLNGSYPYKKVIVPGKTLGEISKILGDSEKMVNIYFTDKHVLFEFDKTTVVSRLIEGEYFSIDQMLSSDYETKISINRKEFLDCIDRATLLVKEGDKKPVIISVTDGKIELKINSA-IGSMDEEIEIDK-QGKDLMIGFNPKFLIDALRVIDDELVDIYMVNPKAPCFIRDKE-STYIYLVLPV... 363
265 0.000e+00gi|655109558|ref|WP_028557241.1| DNA polymerase III subunit beta [Paenibacillus sp. URHA0014]  clstr ali  45  1.MKLTILKDHLIESIGHVSKAISSRTTIPILTGIKIDATLSGVTLTASDTDISIQSFTASENSTIKIIELIQAGSVVLPAKFFVEIIRKLPAQLIEIEVRANFQTIIRSGSSEIQIMGLDPDEYPLLPEIEESKMLRLPSDLLKTMIKQTSYAVSTNESTPILTGVLWNITGDKLKFIACDRHRLASREVTVDNDQAQNNIVISGRTLNELSKILPDQNTLIDIVIADNQVLFKIQNILFYSRILDGTYPDTSKLIPQSFQTEMVVPTKELAEAIDRAYLLSKEDKTNIVKMMLEDKSIEISSTSSELGKVTEQIALQHIVGDLLKISFNSKYMLDALKVLDSEFIQIGFTGAMQPIIMKPQDSTNILQLILPYRT. 378
266 0.000e+00JGI.Meta 7035679753 C1921381__gene_131724 DNA polymerase III, beta subunit [Human Stool microbiome from visit number 1 of subject 159753524  ali  35  1.MKLSCSKDSLLNAINIVSKAVSSRTTLPILECILLTADENGLKLTSNDMELAIESYIDA--------DIETEGNVALEAKFFSDIIRKVNGEEVNISVDDKFVATISCGKSEFKISGQNGEDFPPIPEVEKNDKYVISQTELKNLIRQTIFSVSQDESKPILTGEYIEIEGNMIDFVSVDGYRISYKQSELVQSSGTKSAIVPGKSLGEIAKILSDEDEKAVIYFTDNHIMVDIDGNIVVSRLIQGDFIKYQQSFTNDYKTSAKINKNEMLNSLERASLIARDSRKIPVKMEISGSNIIITSN-AETSTAYEEVSA-EIDGDKLLIAFNPKYLIDALRAIDDEEVYIHFNTQLSPCVFKPVEGDSYKYLVLPLR.. 366
267 0.000e+00gi|933757582|ref|WP_054331919.1| DNA polymerase III subunit beta [Clostridia bacterium UC5.1-2F7]  clstr ali  31  1.MNILCDKALLVQAVSNVSRAVSGKTTLPALEGILMVAKGGQVQLTGYDLELGISTHLEA--------QVLEEGEIVLSAKLLLDMIRRMPGDQVAIESDAKLLTQLKSGVTEYTILGMPATDYPELPSVTEGSAIQLPQTTLKSMIDQTLFAVATTDSKPVHTGSMFDVDEEGITLVSVDGYRLALRREKVKIG-QPMKFIVPGKTLSEVSKLLGDEDTPTELFISRKHIVFNINGYSVISRLLEGEFLDYHAAIPQNSTTTVKISTRSFMDSIERTSLLISDRLKSPLRVKFTQDLIKVSCSTT-IGKAYDEIPC-SIDGGEVEMGFNNKYILDALKASGCDEVKLEISGPLSPMKVVPPEGDQFLFLVLPVR.. 363
268 0.000e+00gi|511076095|ref|WP_016317539.1| DNA polymerase III subunit beta [Anaerotruncus sp. G3(2012)]  clstr ali  33  1.MHVICNKQLLVEAVSNVSRAVSSRNTLAALEGILLKTAAGTISLTGYDLELAITTEIEA--------DIREQGEIVLPAKLFLDMIRRMPSEQVSIKTDEKMLTIIKGDVTEYTILGIPASEFPELPSISQTTGLNLPQRILKNMIGQTLFAVSTSDSKPVHTGSLFDIRGGELYVVSVDGYRLAMRKEP-TGYQEDLMFIVPGKSLSEVAKLLKEEDADVELTVSKRHIIFQIGSYHVVSRLLEGEFLDYKAAIPNGSQTTVRINTRELIGSIDRSSLLISDNIKSPLRLYFQEGMIRISCSTA-IGKAYDEIPCKQ-EGADVEIGFNSRYMLDALKASEGDEIQLILNGPLSPLKLTPVEGDSFTFLVLPVR.. 363
269 0.000e+00gi|507078097|ref|WP_016148867.1| DNA polymerase III subunit beta [Butyricicoccus pullicaecorum]  clstr ali  29  1.MKFSCEKSAFLDAISIASRAVSTKSTIAILEGLRLTA-ADTLTLSGYDLSMGIRTQVDA--------DVLEPGEIVLSAKLLGDIVRKLPNDVVYVETDDKLLTTIKCGRSVFNLVASASDDFPAMPEVDAACEIPMHEKVLKSMINQTVFAVSDNQAKPIHTGCLFELTDGKLTVVAVDGFRLSIRREMLENPAEDMKFVVPGTALREIERILEDGDSVATVCPGEKHILFALGKTTLVCRLIDGEFLNYNAAIPASFEYTVTADTRELITCLERVSLLVSEKLKNPVRITFDGSVMKMTCITA-VGKSYDECAING-SVDPLEIGFNSRYLLDALRACSDDTIQLSIKGALNPIVITPTEGEKYTYLVLPVR.. 365
270 0.000e+00JGI.Meta 7051346742 SRS020328_Baylor_scaffold_37263__gene_94017 DNA polymerase III, beta subunit [Human Stool microbiome from visit number 1  ali  34  1.MNVICDKQLLVEAVGNVSRAVSAKNTLAALEGVLLRAQDGRLYLTGYDLELAISTAIEAK--------VLAPGEIVLSARIFLDMIRRMPSETISITSDEKMLTLIKGSLTEYTILGIPASEYPELPAVNQTTEISLPQAALKNMINQTLFAVAVSDSKPVHTGSLFDIKGGELNVVSVDGYRLALRREKVAFDS-DFSFIVPGKSLSEVAKLLRDEEGDIEIAVSKRHIIFKAGSYNVISRLLEGEFLDYRAAIPAGGQTTVKISTRELIAAIDRASLLISDNIKSPLRLKFEGGVIKISCSTA-IGKAYDEITCQQ-TGDDVEIGFNSRYMLDALKASECDEIQLLINGALSPIKLVPLEGDSFTFLVLPVR.. 363
271 0.000e+00gi|495748298|ref|WP_008472877.1| DNA polymerase III subunit beta [Lactobacillus gigeriorum]  clstr ali  46  1.MQFTINRNLFIENLNNVMRAISSRAAIPILAGIKIDLFEDELILTGSDTDISIEIKLPASED----LTINSTGSIILTARFFSEIIKKLPGKDFSFEVTTGNQVRIKSENSEFTINGYDAETYPRLPEITDESAFLIGGKVLREIINETQFAVATQESRLILSGVHFTFDPDAIKAVATDSHRLAERKINLENGPKTTDLIIPGRNLQELSRIIGEADPDVQVCPGENQVLFKIGNISFYSRLLEGNYPDTDRLLPIESTTTVEFDLAELSSALDRASLLTHAGRNNVVDLELENQKVKLTGTSAEIGNVEEEVSFRALEGSQLKISFNPDYLRDALRASVTDAVVMKFTQPLRPFTVTPNKADQFIQLITPVRTF 376
272 0.000e+00gi|489546396|ref|WP_003451044.1| DNA polymerase III subunit beta [Clostridium perfringens]  clstr ali  34  1.MIFTCDKNKLQESIAIAQKAITGKSTMPILEGLYIEASENIVTIIGSDKDVSIETKFEA--------DVTEPGKLVVDAKIFGEIIRKLPNDKIKIETVSEEAIRITCQKSVFDLLHMNAEDFPSLPKINENMIFSINQGILKNMIKGTSFAIAQDETRPILQGILFEIKDSKLNLVALDGYRLAIRTENIDTN-NTINAVIPGKTLNEVAKILEDSEEIVNITFTPNHILFNMGDTKVISRLLEGEFIKYDALLPKEHKLQIEVDKQTLQNGIERASLMAKEGNSNLVKFDITDENIVITSNS-QLGKVREEVTI-KLQGDEIQIAFNSKYLLDVLKNMEEDKIELRMTSSISPCIIRNKNNDLCEYLVLPVR.. 363
273 0.000e+00 [EC:2.7.7.7][KEGG:K02338] DNA polymerase III subunit beta;|[COG0592] DNA polymerase sliding clamp subunit (PCNA homolog)  ali  34  1.MKLVCKKSDLITGINIVMKAVSSKTTMSILECILIDATEGVIKFTANDMELGIETKVEGE--------IIEAGSIAIDAKIFSEIVRKLPDNDVVIEVNDETKANITCENSKFNILVKSADDFSYLPEIEKKDKITLSQFALKELIRQTIFTVNDADKNKILTGELFEVMGNKLKVVALDKFRIAIRNMELKEDYGNFKVLVPGKSLNEISKILGDVDDEVNIYFTSNHILFEFDETKVVSRLIESNYFDTDKMISNDYKTKITINKKEMANCIDRATLLIKEGDKKPVFLTIKDTEMELSINTF-IGSMDESIPIVR-EGSDMMISFNPKFLIDILRVLDSEEVNIYFTNPKAPCFIRD-DENSYIYVVLPV... 364
274 0.000e+00 [EC:2.7.7.7][KEGG:K02338] DNA polymerase III subunit beta;|[COG0592] DNA polymerase sliding clamp subunit (PCNA homolog)  ali  28  13MLRFSCEKALLQSAVNTVSRAVAAKSSIPALEGILVE-GSDRLTMSGYNMQTGIRTAFEAE--------VHEEGRIVLNARLFGEIIRKLPDDLVVFAADEKYMVRLTCGDASFEIMGLSAEDYPELPEVDDEYSVAIQQGTLKAMINQTSFAVSTNETRPIHTGSLFEINEQGLTMVSVDGFRLALRREPLGRDGGAFRFVAPGSALNEVEKICEDSDNLMTIIQGKRHLMFETGSTQLICRRLEGEFLDYRNAIPRNNPISILVDTKAMLNSLDRVSVVISEKLKSPVHCIFDAGRVYLSAKTGN-GEAKDICPVEG-DGQGLEIGFNNRFFMDALRYAPAEKVKMELNTGISPCIMTPVEGENFLYMVLPVR.. 378
275 0.000e+00 GL0005308 [Complete] locus=scaffold44890_1:1218:2426:-  ali  32  31.MKLVCEKDVILKAINSVTKAVASKTTMPILEGILIQTNDKEVKFTTYDLEIGIEYIME--------CTVEEQGATVVNAIMFSEIIRKLPDAEIHIEINENNLLVIECEGSLYKLATMNPEEFPELPKIDIENSIEMEQNSLKDMVRKTIFAVSTEENRPIFTGCLFEIRNNKLNVVAVDGFRLAWKSKFLQTAVNDFSAVIPGRTLNEINKILNDSFDTIKIGVSKNQALFEMENCKIVTRLLDGEFLNYASVIPETWETRIRVDKGSIQNCFERVSLISASSKKYPVKVNIEIGKVTISCTN-QTGDAKEEIFV-ETEGKNLEAGFNPKYFLDALRAIDDPEVFIDFGSSISPCIIRPTEENDYIYMVLPIR.. 399
276 0.000e+00 [EC:2.7.7.7][KEGG:K02338] DNA polymerase III subunit beta;|[COG0592] DNA polymerase sliding clamp subunit (PCNA homolog)  ali  32  1.MKIVCYKDKILKAINSVVKAVASKTTMPILEGILIQTNDNEIKLTTYDLEIGIEYIMD--------CEVEEQGSTVVNAIMFSEIIRKLPDTEIKIYLDTNNLLVIECEGSLYKLATMDPTEFPELPKINVENSIQIEQNVLKNMIRRTIFAVSNEENRPIFTGCLFEVINNKLNVVAVDGFRLAWRSSFLNVQANNFSAVIPGKTLNEVNKIISDSFEPIKIGISKNQALFEMDNCKIVTRVLDGEFLNYSNVIPNEWDTRIRVNKNILQSCFERISLISSSSKKYPVKVTVDIGKLTISCAN-QTGDAKEEIYV-STEGKNIEAGFNPKYFLDALKVIDDEEVFVHFGSSISPCVIRPVDEGDYVYMVLPIR.. 368
277 0.000e+00 GL0140255 [Complete] locus=scaffold90567_1:1205:2314:+  ali  35  1.MKLICSKSNLLNGVNIVSKAVPSKTTMSILECILIDATKGQITLTANDMELGIETVIEGE--------IIEKGIIALDAKIFLEMVRKLPDNDVTIETDSSYKTIITCEKATFNIIGKSGEDFSYLPQIERSDSILLSQFTLKEVIRQTIFSIADNFTNKILTGELFEINGNLLKVVSSDGLRISLRRIELKNTYPDKKVIVPGKTLNEISKILSDADKDVNLFFTDKHILFEFDNTTVVSRLIEGEYLKIDNILSADYETKVKINKREFLSCIDRSTLLVKEADKKPIILDIKDDVMELKMNSI-VGSLDEEIDIVK-NGKDLMIGFDPKFLIDALKVIDDEDIEIKLLNPKAPCFIKD-EQESYIYLILPV... 363
278 0.000e+00gi|497984187|ref|WP_010298343.1| DNA polymerase III subunit beta [Clostridium senegalense]  clstr ali  38  1.MKFLINKNSLLEAISNVQKAITGKSTLPILQGIYINAYKNTLTLIGSDIDVCIETKVDAE--------ILEEGSIVVDSRLFGEIIRKLPNAEIEICTIDNNTIELNCQKSCVNLIHMDASEYPLLPTITEDTNFSISQKTLKNMIKGTIFAVAQDETRPILTGVLFEVKDRKLNLVALDGFRVAFRSEQLD-CDDNKEAVIPGKTLNEVSKILEDKDENVEITFTNNHILFNIGNTKVISRLLEGEFIKYASIIPQEYKTKVIVNKNEILGCIERASLMAKDGNTNLVKLEIVDDNLIVTSNS-QLGKAREEMNII-LQGESLKIAFNSKYLIDVFKNIEEEEIIMELSSSVAPCVVKNKEVNNCTYLLLPVR.. 363
279 0.000e+00gi|737669427|ref|WP_035638944.1| DNA polymerase III subunit beta [Lachnospiraceae bacterium ND2006]  clstr ali  32  1.MKISCTKESLVNGVSIVSKAVPGKTTMPILECILIEASNGIIRMTANDMELGIETRIDG--------VIEDNGIIAINAKFFGDMVRRLPNGMVTIETDASLLTTITCMNTKFNLPGKSGEDFPYLPDISKNDVLSISQYSLKELIRQTSFSLADNETNKIMTGELFEISGNRLRAVALDGHRIAIRNIELSQSYEAKKVIIPGKTLNEISKILSGTESDVNIYFAETNVVFEFDDSTVVSRLIEGDYFDIDQMITDNYSTQVNVNKNDFLSSIERTTLLIKEGEKKPVVVNILDDNMEISINSA-LGSLDEKVEIQK-TGNDIMIGFNPKFLIDVLKVVDEDNISMYLMSAKAPCFIRD-EDNKYIYIVLPV... 363
280 0.000e+00gi|737148374|ref|WP_035135509.1| DNA polymerase III subunit beta [Clostridium sulfidigenes]  clstr ali  37  1.MKFLIEKSLLQEAISDVQKAITGKSTLPILQGIYISAKDGLLTLIGSDIEVSIETKIPA--------NIIEEGEVVLDSKIFGEIIRKLPNDIVEITEINSNEVELKCQKSNVQLVYLNPKEYPTLPSIEEDVVLSVSQKTLKNMIKSTIFAIAQDDTRPILTGVLLQVKENKLNMVALDGFRVALKSESMD-CKSNKESVIPGKTLNEVSKILKDTDDVVQITFTKNHILFNFGNTKVISRLLEGDFIKYESIIPKEHNLKVTVNRNEILGCIERASLMAKDGNTNLVKFDISDDTLVVTSNS-QLGKAREEVQII-LQGEGIKIAFNSKYLIDVFKTMEEENITMEFTSTVSPCVIRNQDSDNSVYLLLPVR.. 363
281 0.000e+00gi|518036054|ref|WP_019206262.1| DNA polymerase III subunit beta [Lactobacillus ingluviei]  clstr ali  43  1.MKFTINRTGFTNELANVLRAISAKTTIPILTGVKLVATDDQLVLTGSNSDITIQSTLAAS-EGQLGLVVEEPGAIVLQARLFNEIVKKLPAETVTLEVKTGFLTTITSGPAEFKINGQDANNYPKLPELESDKTVQLAPDLLREVIDQTRIAVSKQESRPILTGIHVLLTQDQLTAIATDSHRLAQRKVTLAADVVIPGV-----SMTELARMIPDQKDPIDLLIAENQVLFKFGHTLFYSRLLEGKYPDTSRLIPETSETDLTIDANVLLAAISRASLLSHQGRNNVVKLTIDPELVKISGDSADVGNVEEELQFDAITGQELAISFNPDYMGDALKSFGGVKVKLAFTSPLRPFTLVPVDDQNFVQLITPVRTF 379
282 0.000e+00gi|497760225|ref|WP_010074409.1| DNA polymerase III subunit beta [Clostridium cellulovorans]  clstr ali  35  1.MNFTCDKTNLQEAISIAQKAVTGKSTMPILQGLLLNARGNKLTINSSDIDLGIETKCNA--------NIKEEGSIVVDSKLFGDIIRKLPNSEIQIKSISEGTIEITCQRSRFTLVHMKADEFPQLPYIDEDEIISIPQKLIKNMIRSTIFAIAIDETRPILTGILFEIKNRTLNLVALDGFRLALKKETIDTEQE-FSAVIPGKTLHEVVKILED-EGDVDITFTTNHILFNLGETKVVSRLLEGEFIKYQAIIPEEHELSISVNRASLLNSIERASLVSKDASSNLIKFNISEDNIVITSNS-QLGDVREEVSIKLLKGNELQIAFNSKYLIDALKIMEEETITLQFTSAVSPCIIKNIENDNVIYLVLPVR.. 363
283 0.000e+00JGI.Meta 7019864219 C2445446__gene_177557 DNA polymerase III, beta subunit [Human Stool microbiome from visit number 1 of subject 160603188]  ali  33  1.MKFTCNKSDMTEAVNIVLKAVPSKTTMPILECVVIEAAGDQIKLTTNDMQLGIETRFPA--------QVEEDGIILVNAKMISDIIRKLPENDVYFEADDNENILLFCGKAKFNLSGKNHEEFPMLPNIEKSYKITVSQFTLKEMIRQTIFSISNNESNKILTGELFEINGDEFKIASLDLHRVSIRKIQLKESYDDMKAVIPGKTLSEVSKILTGGDDNVDIYFTKNHVLFELENTIIISRLIEGNFYNINQMLTNDYETKVTVNKRDLLECIDRATLLLREAENKPVIMNVKNSEIKMEMTT-KIGSMDENITIEK-EGKDLRIAFDPKFLIDVLRVIDEEEVNLYLFNAKAPCFIR--DDNSYIYLILPV... 362
284 0.000e+00 GL0056355 [Lack 5`-end] locus=scaffold24190_6:812:1927:-  ali  35  6.MKFTCTKTNFNNGINIALKAVPGKTTMPILECVVIEAKGDMVKLTTNDMQLGIETKIPAE--------IEQDGIILVNAKMISEIVRRLPDDDVNFEVDENNNILLFCGKSKFNIPGIPHDEFPMLPKIEADKTIHISQFTLKEMIRQTIFSISDNESNKILTGELFEINGDEFKIASLDLVRVSIRKIHLKESYDPIKVVIPGKTLSEVSKVLNGGDDEVSISFSKNHVLFEFDETVVVSRLIEGNFYNIDQMLKTNYETKVKINKNELYGCIDRATLLLREAEKKPVILHIKEDEIQMEMNT-KIGSMDEEVTAEK-EGKDLVIAFNPKYINDVLKVIDDEEVTLYLFNANAPCFIKN-EEESYIYLILPV... 368
285 0.000e+00gi|984720446|gb|AMB94007.1| DNA polymerase III subunit beta [Aerococcus sanguinicola]  clstr ali  42  1.MKFSVNRAVFVENLSNVQRAISSRTTIPVLTGVKILATDNGILLTGSDSTISIEAFIDANNEDNQ-LQVEKAGSIVLPSRFFGEIVKKLPNEIMHLEVKDNLQTDITAGQAAFTLNGTAGSEYPKLPEIDSDTSFTIPANIFRQVINHTIISVSNQEIRPIFTGIHFVIANNHLKAVSTDSHRLSQRIVPLEVPDQEFALNIPGRSLSELTRIAEDSD-NIEMMVADKQVLFKTDNIYLYSRLLEGKYPDTDRLLPEDYQTRIQIDAPDLLSAIERALILSHEGRNNVVKLSIDSDQVVLSGQSAEVGEVEEELNISSADGESLAISFNPDYMRQALRTFGAQEIALRFQSPSHQFILLPADNFNFVQLITPIRT. 380
286 0.000e+00gi|653221037|ref|WP_027433594.1| MULTISPECIES: DNA polymerase III subunit beta [unclassified Lachnospiraceae]  clstr ali  32  1.MKITCSKENLVKGVNIVSKAVPVRTTMPILECILVDASTTEIKLMANDMEIGIETIVEGT--------IEERGIIAIDAKFFGELVRKLPDSDVTITTDEKYNAKIQCESVIVETPCKPGDDFSYIPNVERFNPVVISQFSLKEVIRQTIFSIAENDNNKLMTGELFEIKGNKLKVVSLDGHRISIRNIELKDEYEDKKVIVPGKTLNEIAKIIPGADEDVNIYLSKNHIVFEFENTTVVSRLIEGEYFKIDQMLSSDFETKVKVNKRALFSSIDRSTIMVKERDKKPIIMNITDNNLELKIDSAMTGNMEENIGINK-EGKDIKIGFNPKFFMDALRVIDEEEVTLYMVNPKAPCFVKD-EDESFIYLILPV... 364
287 0.000e+00 [EC:2.7.7.7][KEGG:K02338] DNA polymerase III subunit beta;|[COG0592] DNA polymerase sliding clamp subunit (PCNA homolog)  ali  33  34.MKIICSKSNLVKGVSIVSKAVPSKTTMPILECILIDATTDIIKLTANDMELGIQTEIEG--------QITERGMIAIDARIFSEIVRKLPDNEVTIETDSNLQTVITCEKAKFDIAGKPGEEFSYLPIIEKEESIEISQFTLKEIIRQTIFSIADTESNKLMTGELFEIKDNILRVISLDGHRISIRKIELKDQVTDKKLIVPGKTLIEVSKILSGEESMVNISYTNNHIVFEFDNTIVVSRLIEGEYFKIDQMLSSDYETKVRINKKELLNCIDRATLLVKEGDKKPIIINIGDELMELKIKS-QVGSMNEEIYISK-EGKDLLIGFNPKFLIDALRVIDDEEVTLYLMNAKAPCFIKD-DEENYIYLILPV... 396
288 0.000e+00gi|556498966|ref|WP_023346650.1| DNA polymerase III subunit beta [Firmicutes bacterium ASF500]  clstr ali  33  1.MKFSCEKALLSAAVSVTSRAVAAKSSIPAMEGILIEA-GNTLRLTGYNLETGIQATVPAE--------IGEGGSLVLSARLFGEIVRKMPDDVVVFSAQ-GYTVNIRCGLSEFNILGTDPEEFPELPSVDQQNALTMKQPVLRSMIAQTLFAVSDNESRPIHTGSLFEVDDTGLTVVSVDGYRLALRHEAVEEGADAFSFVVPGSALNEVEKICS-GEEEVTITQGARHVMFQTGDTVLVCRRLEGDFLAYRNAIPRNNSIKVEVEARALLSSIDRVSLIISEKLKSPLRCVFGDGMVDITTKTA-IGDAADQCVING-DGSGLEIGFNNKYLMDALKAAPADKLRMEFTSGVAPCVILPAEGENFTYMVLPVR.. 364
289 0.000e+00gi|496270300|ref|WP_008982338.1| DNA polymerase III subunit beta [Ruminococcaceae bacterium D16]  clstr ali  32  1.MKFSCEKALLTAAVSIASRAVAAKSSIPAMEGILIEA-DTRLRLTGYNLETGIQATVPAE--------IKQPGSLVLSARLFGEIIRKMPDDVVVFTSKD-YMVNIKCGMSEFNILGTDPEEFPELPTVDQQNSITLEQSALRSMIAQTLFAVSDNESRPVHTGSLFEVDHNDLTVVSVDGYRLALRREKADGGSEQFSFVVPGSALSEVEKICS-GEGPVTVNQGARHILFQAGDTVLVCRRLEGEFLPYRNAIPRNNPIQIQCDTRALLSSIERVSLIISEKLKSPLRCVFGDGMVDITTKTA-IGDAADQCPIDG-DGQGLEIGFNNKYLMDALKAAPADKLRLEFSSSVAPCVILPAEGEEFVYMVLPVR.. 364
290 0.000e+00gi|490159585|ref|WP_004058250.1| DNA polymerase III subunit beta [Eubacterium plexicaudatum]  clstr ali  34  1.MKLICSKTNLLYGVNIVIKAVPSKTTMPILECILIDASKGHVKLIANDTELGIETVIDGT--------IEEPGIIALNAKIFSEIVRKLPDNDISIISDENLKTTITCEKSKFNIVGKLGDDFAYLPEIEKNEPISITQFTLKEIIRQTIFSIADNDTNKLMTGELFEIQENRLKVVSLDGHRISIRNIELKNNYNNKKVIVPGKTLQDISKILSGSDEYVHIFITENHILFEFENTTVLSRLLDGEYFRIDQMLSSAYETKIKINKRELLGSIDRATLLVKEDDKKPIVMDVQDDYMELKISSY-VGSMNEDIEIEK-EGKNMIIGFNPKFFIDALRVIDEEEIMLYMVNPKAPCFIKD-ENESYIYLILPV... 363
291 0.000e+00gi|697195456|ref|WP_033164199.1| DNA polymerase III subunit beta [Clostridium sp. KNHs205]  clstr ali  33  1.MKIICPKGELLNRVNIVLKAVPAKSTMPILESIVIDVKQDTIKLIANDMELGIETIAKGE--------VIEPGSVALNSKIFSEIIRKLPDNDVTIQTSDNYSTLITCEKAKFTISGSSSEEFPYLPDIVRTEGITLSQFTLKEIIRQTVFSIADNESNKIMTGELFEIKEDELKVVSLDGHRVSIRKIKLNQNYSDIKVIVPGKTLNEVSKILSGESDEAYIYFTDKHVIFEFDDTIVLSRLIEGIFFKIDQMLSSDYETKVTVNKKELLSCIDRATLLVKESDKKPIIINIADGNMELKMNSS-IGSMDEEIDITK-EGKDILIGFNPKFLIDALRVIDDEEVDIYLINSKAPCFIRDKE-ENYIYLVLPV... 363
292 0.000e+00gi|488646186|ref|WP_002582818.1| MULTISPECIES: DNA polymerase III subunit beta [Clostridium]  clstr ali  34  1.MIFTCEKQEILEGISIVQKAITGKSTMPILEGVYIKTNDSSLTLIGSDMDVSIQTTVNA--------NIIEPGSIVIDAKIFGEIIRKLPNSTIKIETIENQVIRITCEKSVFDVVYMNTNEFPELPEINEDLKISVNQNILKNMIKGTSFAIAQDETRPILQGILFEVKNKNLNLVALDGYRLAIKSEFLDSDIE-IEVVIPGKTLNEVSKILEDVEDIVDITFTNNHILFNLEKTKIISRLLEGKFINYNSLLPQEHKLSVHVNRQELQNSIERASLMAKDGNTNLIKLDIQQDNLIISSNS-QLGKVREEIS-MKLQGDEIQIAFNSRYLLDVLKNMEEDEVVLKMTSGISPCVIEENNNENAKYLVLPVR.. 365
293 0.000e+00gi|515408138|ref|WP_016897193.1| DNA polymerase III subunit beta [Aerococcus viridans]  clstr ali  42  1.MKFSINRSVFIQNLTDVQRAISSRTTIPVLTGVKISVKEEGLYLTGSDATISIEAFIDAKDDDNK-LKIDATGDIVLPSRFLGEIVKKLPSDMMNLEVVENFQTEITSDRASFTLNGINGNEYPRLPEIDAKQTYALPTDTFKQVVNQTIISVSNQEIRPIFTGIHFEIGNGELKAVATDSHRLSQRIMPLPEAAGDLDINIPGRSLQELIRIV-DSNEDIEMMVTDNQVLFKARNIYLYSRLLEGNYPNTDRLLPNDHSTIIEVAASELVNAVERALILSHEGKNNVVRLNISDQDIILSSQSAEVGNVEEEINVVKAEGEALEISFNPDYLREALKSFGQQNVQIGFQSSSHPFTLLPTDNFNFVQLITPIRT. 380
294 0.000e+00JGI.Meta 7053851687 SRS017521_Baylor_scaffold_13261__gene_22937 DNA polymerase III, beta subunit [Human Stool microbiome from visit number 1  ali  34  1.MKIICTKQNLAKGVSIVSKAVPSKTTMPILECILIDASTDVIKLTANDMELGIETSIDGE--------IIERGILALNAKIFAEIVRKLPDNEIIIDTQGDNQALITGGKAKFKIASLPGDEFSYLPNIEKDDFITVSEFTLKEVIRQTIFSIADSDTNKMMTGELFEIEDNILKVVSLDGHRISIRKIELKDSYAPKKVIVPGKTLQEISKIIGEAEADVDISFTKNHIVFEFDRTIVVSRLIEGEYFRIDQMLSSDYETKVKINKRELLECIDRATLLIKEGDKKPLIIDIRDESMEFKIKS-QVGSMDEDIMCIK-EGKDLLIGFNPKFLIEALRVIEDEEVDLYFMNAKAPCFIKD-EAQSYIYLILPV... 363
295 0.000e+00gi|492907810|ref|WP_006038216.1| DNA polymerase III subunit beta [Paenibacillus curdlanolyticus]  clstr ali  41  1.MKLSIAKNELNDAIQQVAKAASTRPAIPILGGIKFDVTHQGITLTASDTDISIQSFIPVESGDSIVAKVDKPGSVVLPSKFIVEIVKKLPSDEVEIEVGEQFITMIRSGSTDIQMVGLDPEEFPVLPSIEQSDVLQIPGDLLKSLIRQTVFAASTSEQTPILTGALVNLFEGELRFVATDRHRLANRSAHVDTSLRFSNVVISAKTLNELSRLIPDASALVEMVVADNQALFKIGSVLFYSRLLDGTYPDTSKIIPQSYKTELVVDTKKLTDAIDRAYLMSREEKTNIVRLTLEHGGIEISSSSSELGRVTEQLEAFKMEGEALRIAFNSKYMLDVLKVIDSEQLNIQFTGAMSPIIIRPADHPHSTYIILPYRT. 378
296 0.000e+00gi|749947704|ref|WP_040329772.1| DNA polymerase III subunit beta [Candidatus Clostridium anorexicamassiliense]  clstr ali  38  1.MKFLTNKNSLMEAISNVQKAITGKSTLPILQGIYINAHKNTLTLMGSDIDVCIETKIDA--------NIIEEGSIVVDSKIFGEIIRKLPNSELQITTLEDGAIEIICEKSCVNLIHMDANDYPLLPDINEDTIFSIEQKILKNMIKGTIFAVAPDETRPILTGVLFEIKDYKLNLIALDGFRVAFRSEPI-NCSDNKEAVIPGKTLNEVSKILEDSDNEVKITFTNNHILFNIGNTKVISRLLEGEFIKYASIIPQEYKLKVNVNKNDILSCIERASLVAKNGNTNLVKLDISEDSIVITSNS-QLGKSREEVSIV-LQGEALKIAFNSKYLIDAFKNIEEENVVMELSSSVSPCVIKNKENDNCTYLVVPVR.. 363
297 0.000e+00gi|524642614|emb|CDD56849.1| dNA polymerase III subunit beta [Clostridium sp. CAG:43]  clstr ali  34  1.MKLSFEKDHLMNGINIVLKAVPSKTTMPILECILIDAVSDEIKLTGNDMELGIETKVEGT--------ILERGKIALDAKLFSDIIRKLSGETITIESDEKYNTTITCDKAIFQIQGKDGDEFSYIPHIERDKFITLSQFTLKEIIRQTIFSISPNDSNKMMTGELMEVTGNELKLVSLDGHRMSIRKVALKEQYSDIKVIVPGKTLGEISKILGDNDSEVQIFFSTNHIMFEFDDTIVLSRLIEGEYFRINQMLSSDYETKVTLNRRDFMDAIDRASILVRENDKKPLILNFTDEEMELKMHSA-FGTMDARLAITKF-GKDLMIGFNPKFLGDALRIIDDEEVTLYMMNPKSPCFIRD-EEETYIYLILPV... 365
298 0.000e+00gi|524644267|emb|CDD59098.1| dNA polymerase III subunit beta [Bacteroides pectinophilus CAG:437]  clstr ali  32  1.MKLVFSKSELSKGVNIVSKAIPTRTSMPILECIMIDSTEGQIKFTANDMELGIETIVEG--------DILEKGKIAIDAKIFSDIVRKLPDNDITIQTDDNYNALITCENSKFNISGKSGDDFSFLPVIEKQKSIRLSQFALRELVNQTIFCTAPNDNNKMMAGELFEVIDSELKVVALDGHRIAIRKKKLEGRADDVKVVVPGKTLNEISKILSDADDMMNIYFSNNHILFEFDQTIVVSRLIEGEYFKISQMLSSDYETRITANKKEMLGSIDRATLLIKESDKKPIILNITDGNMEVKVVSS-IGSLNENVAVEK-EGKDIMIGFNPKFLMDALGKIDDENVDIYLLNPKAPCFIRDKE-ENYIYLILPV... 363
299 0.000e+00gi|655102897|ref|WP_028550663.1| DNA polymerase III subunit beta [Paenibacillus sp. UNC451MF]  clstr ali  45  1.MKLTILKEHLNESIQHVSKAISNKTTIPILTGIKIDADATGMTLTASDTDISIQSFIPIEKNELSIIELERPGSVVLSSKFFVEIVRKLPAQVVEIEVKDHFQTTIRSGSSEIQLVGLDPEEYPTLPSIEENRRIQMPSDLLKTMIKQTSFAVSTNESTPILTGVLWTIADRKLKFTACDRHRLGSRETNIEVDADFQNVSISGKTLNELSKILPDQNTLIDIIFAENQVLFKLSSILFYTRILDGTYPDTSKLIPQSFQTELVINAQQLAEAIDRAYLLSREEKTNIVKLIMREDTIEISSSSSELGKVTEQLEVSSLTGELLRISFNSKYMLDALKVMDGELIRIGFTGAMQPIIFRPEETSSLLQLILPYRT. 378
300 0.000e+00 [EC:2.7.7.7][KEGG:K02338] DNA polymerase III subunit beta;|[COG0592] DNA polymerase sliding clamp subunit (PCNA homolog)  ali  34  8.MKLVFTKSNLNKAVGIVMKAVPTRTTMNILECILIDATTNEIKFTGNDMELGIETIVEGE--------IIEKGKIAIDAKLFSEIVRKLPDNDITLTTDSNNNALITCEKSKFNIAGKSGDDFSYLPAIIKDKMITLSQFQLKEVINQTIFSIAINDNNKMMTGELFEVNEGTLKVVGLDGHRIAIRNIKLEGRADDVRVVIPGKTLQEISKILNDAESLVNIYFTNNHVLFEFDQTHVVSRLIEGDYFKISQMLSNDYETKVSINKKEFLDSIDRANLLIREGDKKPIIINILNGLLQVNVNSA-IGALNEDIDIDK-EGKDIMIGFNPKFLMDALRVIDDENVTMYLVNHKSPCFIRDKE-ENYIYLILPV... 370
301 0.000e+00gi|503001740|ref|WP_013236716.1| MULTISPECIES: DNA polymerase III subunit beta [Clostridium]  clstr ali  35  1.MNFICTKTELQEAISIAQKAITGKSSMPILNGLLITTCKNQIKLTGSDIDLSIETKINAE--------IKEEGSVVVDSRLFGEIIRKLPNDNINISTTENNSIEIICQKSKFNLIHMNAEDFPEIPNINENIIFLIPQKILKDMIKSTIFAAAQDETRPILTGILFEIKDKKLNLVALDGYRLALKSEYLNTE-NIINAVIPEKTLSEVSKILEDNDKNVNITFTPNHILFNLDNTKIISRLLEGEFIKYNSIIPDEFNLQVTAKREELLSCIERASLMAKDSNTNLIKLEIEENNMIITSNS-QLGMVREELNIL-LQGDTLKIAFNSKYLIDVLKIMDEEEIIMKFSSSVSPCVIKNKDKDNCTYLVLPVR.. 363
302 0.000e+00gi|524733576|emb|CDE37063.1| dNA polymerase III subunit beta [Eubacterium sp. CAG:38]  clstr ali  32  1.MKLVFSKTNLAKAVGIVMKAVPAKTTMNILECILIDATTNEIKFTANDMELGIETIVEGE--------IIEKGKVAIDAKIFSEIVRKLPDNEICIETDSNYTSLITCEKSKFNIAGKSGDDFSYLPIIEKDKFITLSQFTLRETINQTLFSIAMNDNNKMMTGELFEVANGILKVVGLDGHRIAIRNIELTSHADDVKVVVPGKTLSEISKILSNAEDAVTIYFTNNHILFEFDNTTVVSRLIEGEYFRINQMLSSDYETKVTINKKEFLDSIDRATLLIKESEKKPIILSITDGSLEVHVNSS-MGSLNEDIDINK-DGKDIMIGFNPKFLIDALKVIDDEQIYIYLVNPKAPCFIKDKE-ESYIYLILPV... 363
303 0.000e+00 GL0008887 [Complete] locus=C4346297_1:4745:5860:+  ali  33  1.MKIVCYKDKILKAINSVVKAVASKTTMPILEGILIQTNDNEIKLTTYDLEIGIEYIMD--------CEVEEQGSTVVNAIMFSEIIRKLPDTEIKIYLDDNNLLVIECEGSLYKLATMDPTEFPELPRINVENSIQIEQNVLKNMIRRTIFAVSNEENRPIFTGCLFEVVNNKLNVVAVDGFRLAWRSSFLNVQANDFSAVIPGKTLNEVNKIISDSFEPIKIGISKNQALFEMDNCKIVTRVLDGEFLNYANVIPKEWDTRIRVNKNILQSCFERISLISSSSKKYPVKVTVDIGKLTISCAN-QTGDAKEEIYV-STEGKNIEAGFNPKYFLDALKVIDDEEVYVHFGSSISPCIIRPVDEGDYVYMILPIR.. 368
304 0.000e+00 GL0559394 unmapped_[Lack_5`-end]_[mRNA]_locus=scaffold648748_1:852:2024:-  ali  33  21.MKLICKKNDLLSGVNITMKAVSSKTTMSILECFLIDATEGKIKMTANDMELGIETVVQGE--------IIEPGSVAIEAKLFSEIIRKLPDNDVVIDVDNEYKANITCENAKFNIIGRDGDGFSYLPEIKKEKSISISQFSLKEVIRQTIFSIDDKNNNKLMTGELFEISGNNLKVVALDGHRIAIRNIELNAEYEDIKVVVPGKTLNEISKILNGGDDIVNIYFTTNHILFEFDNTLVVSRLIEGEYFKINQMLSSDYETKVVINKREMLDCIDRATLLIKEGDKKPIIITIKDGVMEFKINSF-IGSMDEEIYIQK-EGKDMMIGFNPRFLIDTLKVIDEEQINIYYVNPKSPCFIRDDEG-KYIYLILPV... 383
305 0.000e+00JGI.Meta 7034439430 SRS014459_WUGC_scaffold_25862__gene_34324 DNA polymerase III, beta subunit [Human Stool microbiome from visit number 1 o  ali  29  1MLRFSCEKALLQSAVNTTSRAVAAKSSIPALEGILLE-GGDTLTLSGYNMQTGIRTIVDA--------QVQSPGRIVLSARLFGEMIRKMPDDVIVFAADENLSVHLTCGDASFEILGLSADDYPELPEVDDQFSVDIRQGTLKAMINQTSFAVSTNESRPVHTGSLFEVGDQDLTVVSVDGFRLALRREPLDAEGGAFKFVAPGSALNEVEKICEDSDEKVTIIQGKRHLLFEAGATQLICRRLEGDFLDYKNAIPRNNPIRLTVDTKTMLGSLDRVSVVISEKLKSPVRCVFENGRVLLSAKTG-AGEAKDICPLDG-DGNGLEIGFNNRYLMDALRYAPADSVTLELNTSISPAVIVPADGESFLYMVLPVR.. 366
306 0.000e+00gi|501153316|ref|WP_012198036.1| DNA polymerase III subunit beta [Lachnoclostridium phytofermentans]  clstr ali  35  1.MKIACQKNELLNSVNIALKAVSSKSTMPILECIVIEVQNDTIKLISNDMEIGIETIVKGS--------IISNGSVAINAKVFSEIIRKLPDNEVNVETDEKFMTTITCEKAKFTIAGKSAEEFPMLPTIEKKEAIELSQFTLKEVIRQTVFSISDNESNKIMTGELFEINGNELRVVSLDGHRISIRKVELKNSYAPKKILVPGKTLQEVSKILSGESDEVFIYYTDRHVLFVFDDTLVLSRLIEGEYYKIDQMLSGDYETKVKINKKEFLSCIDRATLLIKETEKKPIIVGIEDKKLELKINTS-IGTMDEDIDIEK-EGKDILIGFNPKFLIDALRVIDDEEVEIYLINPKAPCFIKDKE-ESYIYLILPV... 363
307 0.000e+00gi|511039105|ref|WP_016293120.1| DNA polymerase III subunit beta [Lachnospiraceae bacterium 28-4]  clstr ali  32  1.MKLVLSKSNLLTGVQIVSKAVPNKTTMSILECILVDARGSEIKLMANDMELGIETIIEG--------NIVEKGMIALDAKIFLEIVRKLPDSDITIVTDDMFKTTITCEKSKFNIIGKSGEDFSYLPSIEKIDSIIVSQFTLKEVVRQTIFSIADNDNNKLMTGELFEINEDILKVVSLDGHRISIRKIRLKNFYMPKKVVVPGKTLNEISKILSDMDSEVHIFFTDKHIVFEFDHTTVVSRLIEGDYFKIDQMLSSDYETKVRINKKEFLNCIDRATLLVKEGDKKPIIINIMDGMMELKINSA-VGSMNEEIDIEK-KGKDIMIGFNPKFLIDALRVIEDEEIDIYLVNPKAPCFIRDAE-EKYIYLILPV... 363
308 0.000e+00JGI.Meta 7073529436 SRS017025_Baylor_scaffold_37971__gene_47455 DNA polymerase III, beta subunit [Human Supragingival plaque microbiome from  ali  43  13.MKFSINRQAFLKNLADVQRAIPSKTTIPILTGIKLVVSQEGITLTGSDSEVSIEIFLPVEHEELQ-LSIHETGSIVLPARFFGEIVKKLPQNTFTLETNDQLQATITAGSAAFTLNGLSAHDYPQLPEVEKDHVLTLPVPLFRQVILQTSIAVSTAESRPILTGIHMVIANNQLKAVATDSHRLSQRIIPLESNALTFEITLPGKTLIELSRII-DGLETIDFAITENQVLFQTETLSFYSRLLEGRYPDTDRLINDQFNTAITVVASDLVAAVDRASLMSHTDKNNIATLSINENRILLTGNSPEIGKVEEEIMVENYEGASLDVSFNPDYLKDALRLFGSSEATIQFLEANRPFTLTLKDNHSFIQLVTPVRTF 395
309 0.000e+00gi|517986714|ref|WP_019156922.1| DNA polymerase III subunit beta [Bacillus massiliosenegalensis]  clstr ali  43  1.MKISVQKETMVTAINQVSKAVSARTTLPILTGIKLTSTDKGIELTGSDGDISITTFIPCEMNGDTLVEVEKDGSIVLQGKFFSDIIKKLPKDDLQINV-DNLVSTIKSGKSKFTLNGLDSEEYPRLPVIDDENTITLSARKLKELIHQTVFAVSTSESRPVLTGVQWKVDSDVLIATATDSHRLSRREVAIKGLNEPVSVVVPGKSLVELNKVLEDTDEEVDIILEETQIIFRYRYLTFYTRLLEGNYPDTSRLIPTQSKTVLILNKAEYSESLSRASVLLASSKNKVVKMTINKDNMFITAKAPEIGEVKDELLAISLEGDDLELSYSAKYMLDALKTM-GNEIEIEFNGAMRPFVIREKGKSDLLQIVLPVRTY 376
310 0.000e+00gi|557696254|ref|WP_023436895.1| DNA polymerase III subunit beta [Clostridium tetani]  clstr ali  34  1.MKIFCNKSILQERISIAQKAVTGKSTMPILQGIFIKAENNNLTLTGSDIDLSIETIMDAE--------VIEEGSIVIDSKIFGEIIRKLPNDVIEITSKDNNIIEIKCQKSKFNLVHMSADEFPELPKINENIIFSIPEALLKNMVRGTIFATSQEETRPILTGLLFEIKDKILNLVALDGYRLAVKSEIID-SENSISAVIPGKTLNEVSKILSENDEKVNITFTPNHILFSIGKTKIISRLLEGDFINYKSIIPKEYNLKVIAKRIKFLECIERASLMGKDGNTSLIKLNITDDSIVITSNS-QLGMVREEMGII-LQGEDLEIAFNSKYLIDVLKVMEEDEIILELSSSISPCVIKNKEANDCTYLVLPVR.. 363
311 0.000e+00 GL0026869 [Complete] locus=scaffold16383_4:567:1670:-  ali  34  1.MKLVFTKSNLNKAVGIVMKAVPTRTTMNILECILIDATTNEIKFTGNDMELGIETIVEGE--------IIEKGKVAIDAKLFSEIVRKLPDNDITLSTDSNNNALITCEKSKFNIAGKSGEDFSYLPAIIKDKMITLSQFQLREVINQTIFSIAMNDNNKMMTGELFEISEGNLKVVGLDGHRIAIRNIKLDGRADNVRVVIPGKTLQEISKILNDAESFVNIYFTNNHVLFEFDQTHVVSRLIEGDYFKINQMLSNDYETKVSINKKEFLDSIDRANLLIREGDKKPIIINIQNGLLQVNVNSA-VGALNEDIDIDK-EGKDIMIGFNPKFLMDALRVIDDENITMYLVNHKSPCFIRDKE-ENYIYLILPV... 363
312 0.000e+00gi|493231337|ref|WP_006207386.1| MULTISPECIES: DNA polymerase III subunit beta [Paenibacillus]  clstr ali  45  1.MKISILKNVLNESIQHVSKAISSRTTIPILSGIKLDVTYSGVTLTASDTDISIQSFIPSEDEKHTIVQVEQPGSVVLPAKFFVEIIKKLPSQEIQMEVKDNFQTFISSGATEIQMVGLDPEEFPVLPNIEDSQTVSIPGDLLKNMIKQTVFSISTHETTPILTGVLWNLNDNELKFTATDRHRLATRSAQLEGDISFNNVVIAGKTLNELSKIIPDQNTLVDIVVADNQVLFKIDRVLFYSRILDGIYPDTSRIIPTSHKTELVLDTKKLSESIDRAYLLSKEEKTNIVLLTMEHGGIEISSSSSELGKVREELDLIDFKGEPLRISFNSKYMLDVLKVVESEQLMIAFMGVMSPIVLKPLDDSKSQYIILPYRT. 378
313 0.000e+00JGI.Meta 7046727632 SRS014287_WUGC_scaffold_38240__gene_76267 DNA polymerase III, beta subunit [Human Stool microbiome from visit number 1 o  ali  34  1.MKLTFKKDALLNGINIVLKAVTSKTTMSILECILIDASGTDIKLTGNDMELGIETTVEGT--------ILKRGKIALDAKLFSEIVRKLSDSEITIESDDKLNTVISCENSVFTIQGRDGDEFSYIPYIERDKYISLSQFTLKEIIRQTIFSISPNDSNKMMTGELFEIAENELKVVSLDGHRISIRKVELKEHYENIKVIVPGKTLSEISKILSDNEKEVLISFSQNHIMFEFDNTVVVSRLIEGEYFRISQMLSNDYETRVTINKKEFLDCIERATILIRENDKKPLILTISDNEMDLKLNSS-FGTMNAQVLIHK-TGKDLMIGFNPRFLIDALRVIDDEEITLYMMNPKSPCFIRD-EEEHYIYLILPV... 365
314 0.000e+00gi|489873880|ref|WP_003777400.1| DNA polymerase III subunit beta [Alloiococcus otitis]  clstr ali  42  1.MKFSVKRTEFLKVLKNVQIAVSSKSTIAILTGIKLEADNQGLTLTGSNSDISVESYLSVTDEGADLV-IDEPGQIVLPARLFANIVQKLPDTHFKVNVSQGQQTQITSASASFTINGIDAMSYPHLPDIDLEESFTLPVDLFKNMINQTVIAVSNHESRPILTGVNLSLKEGRLKAVATDSHRLSQRSIQLESAPDSFDIVIPGKSLTELTKLM-DADEEVRVAISDNQILFALSTSQFYSRLLEGKYPDTDRLIPGDTPTEITLDTKELQGAVDRASLLSHEGKNNVVQLTVTADKLEIEGQSAEVGHVQEEIDFGHFQGQDLTISFNPDYLKEALATFGQGEIKLKLVSTLRPFVIVPSEDQDFIQLITPIRT. 376
315 0.000e+00 GL0012145 [Complete] locus=scaffold2151_2:100:1209:-  ali  29  1MLRFSCEKALLQSAINTVSRAVAAKSSIPALEGILVE-GSDRLTMSGYNMQTGIRTAFEAE--------VHEEGRIVLNARLFGEIIRKLPDDLVVFAADEKYMVRLTCGDASFEIMGLSAEDYPELPEVDDEYSVAIQQGTLKAMINQTSFAVSTNETRPIHTGSLFEINEQGLTMVSVDGFRLALRREPLERDGGAFRFVAPGSALNEVEKICEDSDDLMTIIQGKRHLLFETGSTQLICRRLEGEFLDYRNAIPRNNPISILVDTKAMLNSLDRVSVVISEKLKSPVHCIFDAGRVYLSAKTGN-GEAKDICPVEG-DGQGLEIGFNNRFFMDALRYAPAEKVKMELNTGISPCIMTPVEGENFLYMVLPVR.. 366
316 0.000e+00gi|489599240|ref|WP_003503682.1| MULTISPECIES: DNA polymerase III subunit beta [Clostridiales]  clstr ali  35  1.MKLSFNKDNLMNGINIVLKAVSSKTTMPILECILIDATSNEIKLTGNDMELGIETKVEGM--------ILERGKIALDAKLLSDIIRKLSGDEITIESDEKFNTVITCEKSVFKIQGKDGEEFSYIPHIERDNYICLSQFTLKEVIRQTLFSTSPNDSNKMMTGELIEVNDNILKVVSLDGHRMSIRKVILKDQYHDIKVIVPGKTLGEISKILGDNESEVLIFFTSNHIMFEFDDTVVVSRLIEGEYFRINQMLSSDYDTKVTVNRREFMDSIERASILIRENDKKPIIINITDEGMELKLNSA-FGTMNAEINITKF-GKDLMIGFNPKFLVDALRIIDDEEVTLYMMNPKSPCFIKD-EEENYIYLILPV... 365
317 0.000e+00gi|652488853|ref|WP_026883403.1| DNA polymerase III subunit beta [Clostridium akagii]  clstr ali  37  1.MKFICKKSILQEAISVAQKAVTGKSAMPILQGLLLEASDGKITIIGSDIDLSIETTIDAK--------VIESGKIVVDARLFGDIVRKLPNNEIELSSTTDSSIEIICEKTKFNLVHMSADDFPTLPTIDENNIFSIEQKLLKNMIKGTIFAVAQDESRPILTGVLFEIKDKKINLVALDGYRLALKSEYIDIDTESVKAVIPAKTLNEVVKILED-EGDVNITFTTNHILITLGETKIISRLLEGEFIKYTAIIPEEYNLKITVNKGEILSCIERASLVAKEGNTNLIKFDIKDEYMILTSNS-QLGNVREELNIN-LQGQPLEIAFNAKYMIDLLKIIEGEEVFMEFSSSVSPCVVKDKESDNCTYLVLPVR.. 364
318 0.000e+00gi|490741061|ref|WP_004603369.1| DNA polymerase III subunit beta [[Eubacterium] cellulosolvens]  clstr ali  33  1.MKLIFDQQDLANSVGIVMKAVPSKTTMPILQCILIDASFSQIKFTANDMELGIETIVPGE--------IAEKGKIALDAKIFSDIVRKLPNSRVTIETNENDVTTITCEKAKFDIPGKSGDDFADLPKIDRNDFISISQLSLREVIRQTIFSIAVNENNKLMTGELFEVSNNKLKVVALDGHRIAIRNLEISSECSPKRVVVPGKTLNEISKILSEADDLVTIYFSDNYLLFEFDDTVVLSRLIDGEYFKIDQMLSSDYETKIEVNRQEFISCIDRATLLVRESDKMPVIIDITDEQMELQIDSA-IGSMDEEIDIEK-TGKDITIGFNPKFLLDALRVIDDERVSIFFVNAKAPCFIRDEEG-NYIYLILPV... 363
319 0.000e+00JGI.Meta 7044931762 SRS012273_Baylor_scaffold_24565__gene_57859 DNA polymerase III, beta subunit [Human Stool microbiome from visit number 1  ali  37  10.MKFICEKQKLQEGISIASKAITGKTTMPILEGIYITAKNNELTLIGSDMDVSIETKV--------QSKIIEEGMLVIDSKIFGEIIRKLPNSDVIIETLENEIIQITCEKSVFNLVYMNGEDYPEVPKINENLTVEVPQNILKSMIKGTSFAIAQDETRPILQGILFEVRDRNLNLVALDGYRLAIRSEFLDND-NNIEVVIPGKTLNEVSRILEDTNEIVKITFTDNHILFNLSETKIISRLLDGKFVNYVSLLPQEHKISIEVKKQELQNCIERASLMAKDSNSNLIKLDVQEETVIITSNS-QLGKVREEVNIN-LQGDSIQIAFNSRYLIDVLKNIDGDEVILEMTSSVSPCVIKCKNTDNSKYLVLPVR.. 372
320 0.000e+00 GL0096553 unmapped_[Lack_5`-end]_[mRNA]_locus=scaffold97184_2:3:1145:+  ali  34  11FMKIICKKTDLLKSVNIVMKAVSSKTTMPILGCILIHATTDEIRFTANDMELGIETKTDGI--------IQEKGMVALDAKLFSEIIRKLPDNDVIITSDSNNNTQIVCEKAKFTIMGQTGEDFPFLPFVEKDYQITISQFTLKEVIRQTIFSIAVNDSNKMMTGELFDINDGELKVVSLDGHRISIRKIELKSSYPAKKVIVPGKTLTEISKILTGGDDNVDIYFTDNHILFEFEDTVVVSRLIEGNYFRVEQMLTNDYETKVTINKREFLDCIDRATLMVKEGDKRPIILNINDDVMELKI-SSQIGSMDEMIDIQ-LEGKNIKIGFNPKLLIDALRVIDDEMIDIYYMNPKAPCFIRD-EAQTYIYLILPV... 374
321 0.000e+00gi|516361963|ref|WP_017751996.1| DNA polymerase III subunit beta [Clostridium tyrobutyricum]  clstr ali  36  1.MKFICKKSNLQEAVFTVQKAITGKSSMPILNGILIETNGSELILTGSDIDLSITTKIEAT--------ILEEGSVIINAKLFGEIIRRLPNDDINIETIDDNTTQILCKKSKFNIINMNTNDFPELPNINENMLFSIPENILKNMIRETIFATAQDETRPILTGILFEIKNKTINLIALDGYRLALRFETLDNDNE-INAVIPGKTLNEVSKILEDREDNVDITFTPNHILFNLGKTKIVSRLLEGEFIKYKSIIPEEFNLKVTAKREELLNCIERASLMAKDSNTNLIKLNIEENNMIITSNS-QLGMVKEEVNII-LQGSTLQIAFNSKYLIDVLKIMDEEEIILNFSSSVSPCVIKNKDKNNCTYLVLPVR.. 363
322 0.000e+00gi|518366669|ref|WP_019536876.1| DNA polymerase III subunit beta [Paenibacillus ginsengihumi]  clstr ali  44  1.MKLTVLKEYLNESIQHVSKAITSRTTIPILSGIKIDADTSGITMTASDTDISIQSYIPMEQDELQVIELKQSGSVVLPSKFFVEIVRKLPAALVEIEVKEHFQTTIRSGSTEIQLVGLDPEEYPVMPGIEENTRIQIPSDLLKTMIKQTAFAVSTNEATPILTGVLWTIADGKLKFTGCDRFRLASRETKIDVDPDFTNISISGKTLNELSKILPDQNTLIDIVFAENQVLFKMNQLLFYTRILEGTYPDTSKLIPQSFQTELVANHHELANSIDRAYLLSREEKTNIVKMVMEDQTIEISSSSSEVGKVTEELNVERMDGELIRISFNSKFMLDALKVMDSERVFIGFTGPMQPIIIRPEGDSSLLQLILPYRT. 378
323 0.000e+00gi|696591671|ref|WP_033117621.1| DNA polymerase III subunit beta [Intestinimonas butyriciproducens]  clstr ali  31  1.MKFSCEKALLQSAIAVTARAVSPKSSIPALEGILLEARTD-LRLTGYNLETGIRTVVPA--------QIDQEGSLVLSARLFGEIIRKLPDDIVSFQA-DGYMVNITCGMSQFNILATDPEDFPELPTVEDKNGFTIPRGKLGSMIRQTIFAVSDNESRPIHTGSLFEIDDTGLTVVSVDGYRLALRHEPITEGALSFSFVVPGSALSEVEKICGDGEEEATVTQGERHVMFRVGDTMLVSRRLEGEFLAYRQAIPRNNGIKVEGDTRALLTSIDRVSLIISDKLKSPLRCVFDDNVLKITTKTG-IGDASDQCPISG-DGGGLEIGFNNRYLMDALKAAPADRVRLELSSGVAPCVILPAEGENFLYMVLPVR.. 365
324 0.000e+00gi|671563591|ref|WP_031544028.1| DNA polymerase III subunit beta [Lachnospiraceae bacterium AC2014]  clstr ali  34  1.MKIVCSKSTLLKGVNIVSKAVPTRTTMAILECILIDASTDEIKLIANDMELGIETKIEG--------DIVERGIIALDAKIFSEMVRKLPDEDVSIESDSSFKTIISCGKAKFNLVGKPGDDFSYLPYIEKNTSIVLSQFTLKEVIRQTIFSVGFNDNNKIMTGELFEIDGNILKVVGLDGHRISIRNIEMKNSYENKKVIVPGKTLNEISKIISGNDEDVIISMTDNHIVFEFDNTVVVSRLIEGDYFKVDQMLTSDYTTKVRINKKDLLECIDRSTLLVKEGDKKPIVMEVKDNSVELRINST-IGSMREEIDIEK-EGNDITIGFNAKFYIDALRVIDEEEIDIYMMNPMAPCFIRD-ENNTYIYLILPVK.. 364
325 0.000e+00gi|510897453|ref|WP_016230490.1| DNA polymerase III subunit beta [Lachnospiraceae bacterium 10-1]