current user: public




Query: gi|15923007|ref|NP_370541.1| adenylosuccinate synthetase (SAV0017) [Staphylococcus aureus subsp. aureus Mu50], from S.aureus

Results of FFAS03 search in COG0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .
# Score Template Links and tools%idFirst MSSIVVVGTQWGDEGKGKITDFLAEQSDVIARFSGGNNAGHTIQFGGETYKLHLVPSGIFYKDKLAVIGNGVVVDPVALLKELDGLNERGIPTSNLRISNRAQVILPYHLAQDEYEERLRGDNKIGTTKKGIGPAYVDKVQRIGIRMADLLEKETFERLLKSNIEYKQAYFKGMFNETCPSFDDIFEEYYAAGQRLKEFVTDTSKILDDAFVADEKVLFEGAQGVMLDIDHGTYPFVTSSNPIAGNVTVGTGVGPTFVSKVIGVCKAYTSRVGDGPFPTELFDEDGHHIREVGREYGTTTGRPRRVGWFDSVVLRHSRRVSGITDLSINSIDVLTGLDTVKICTAYELDGKEITEYPANLDQLKRCKPIFEELPGWTEDVTSVRTLEELPENARKYLERISELCNVQISIFSVGPDREQTNLLKELWLast
1 -150.000[F] COG0104 Adenylosuccinate synthase  ali follow..  65  1MSSVVVVGTQWGDEGKGKITDFLSENAEAIARYQGGNNAGHTIKFDGVTYKLHLIPSGIFYKEKISVIGNGMVVDPKALVEELKYLHDKGVDTSNLRISNRAHIILPYHIRIDEADEERKGANKIGTTKKGIGPAYMDKAARVGIRIIDLLDKETFKEKLEHNLGEKNRLLERFYELEGFKLEDILDEYYEYGQQFKDYVCDTSVVLNDALDDGKRVLFEGAQGVMLDIDQGTYPFVTSSNPIAGGVTIGSGVGPSKINHVVGVAKAYTTRVGDGPFPTELFDSIGDTIREVGHEYGTTTGRPRRVGWFDSVVVRHARRVSGLTDLSLTLLDVLTGIETLKICVAYKLDGKTITEFPASLKDLARCEPVYEELPGWTEDITEVQSLDDLPVNCRHYMERIAQLTGVQVSMFSVGPDRAQTHVVKSVW 427
2 -140.000[F] KOG1355 Adenylosuccinate synthase  ali follow..  39  28NRVTVVLGAQWGDEGKGKVVDLLAQDADIVCRCQGGNNAGHTVVVDSVEYDFHLLPSGIINPNVTAFIGNGVVIHLPGLFEEAEKNVQKGKGLKRLIISDRAHIVFDFHQAADGIQEQQRQEKNLGTTKKGIGPVYSSKAARSGLRMCDLVDFDGFSERFKVLANQYK----SIYPTLEIDIEGELQKLKGYMEKIKPMVRDGVYFLYEALHPPKKILVEGANAALLDIDFGTYPFVTSSNCTVGGVCTGLGMPPQNVGEVYGVVKAYTTRVGIGAFPTEQDNEIGELLQTRGREFGVTTGRKRRCGWLDLVLLKYAHMINGFTALALTKLDILDMFTEIKVGVAYKLDGEIIPHIPANQEVLNKVEVQYKTLPGWNTDISNARAFKELPVNAQNYVRFIEDELQIPVKWIGVGKSRESMIQL.... 455
3 -6.380[U] KOG0860 Synaptobrevin/VAMP-like protein  ali follow..  34...............................................................................................................................................................................................................................................................AEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRKAMWYKDLKMKMCLALVIIILLVVIIVPIAVHFSR........................................................................................ 117
4 -6.030[R] COG1058 Predicted nucleotide-utilizing enzyme related to molybdopterin-biosynthesis enzyme MoeA  ali follow..  12  7....................................................QAVRAAMLAIGDELLSGRTKDRNIGHLADVLTAA---GIDLKEVRI------VPDEEDAIVAALNALRANYDYVFTSGGIGPTHDD------------ITADAVSTAFGVPCIHDETALKLLGDNYARRGLEFTESRKRMARMPQSQHIPNPVSTAPGFHIGNVYVMAGVPSVFQAMLDNVLPTLRTGRKLF-SKAVECPFGEGVIGAPLAAIQQENPETVIGSYPKFENGRFSTELVVRGSD.................................................................................................................................... 228
5 -5.680[L] COG0514 Superfamily II DNA helicase  ali follow..  13  37....................QFRVGQQEVIEAALAGRDSLVIMPTGGGKSLCYQIPALVLE-------GVTLVISPLISLDQVDQLKANGVAAECVNISQWGHDFRPEYASLGQLKQRFPNVPVMALTATADDATRHDIMQRLQLNEPHQYLGSFDRPNIRYMLVEKHKPVSQIYCGSRKKVEMLTEKLCGNHIRAASYHAGMDADERAWVQE--AFQRDDLQIVVATVAFG-----------------------------MGINKPNVRFVVHFDIPRNIES------------YYQETGRAGRDG--DMNWLRRMLDEKPDGAVESHKLTAMGAFAEAQTCRRQVLLNYFGEYRD---KPCGNCDICLDPPKRFDATEEARKALSCVYRVNQNF-IRIREHGHDKITTYGIGRDHSHD....... 479
6 -4.940[T] COG2112 Predicted Ser/Thr protein kinase  ali follow..  11  22...............................................................................................................IRVEKFLAKGTTSFVFLGSYANRPVIVKFQRSDSPRRNLKKEAEILKMLEGEIKGREVLVREFIEGELLNSDIERKHVISIAEKT--YRLDRLGIDHGQIQGGKHIIVAPTDVWLIDFEKASM-LFLGENRIAERITKKFNVNKKFREELLVALREYKKSGNPKRIFDVL.................................................................................................................................................. 213
7 -4.850[C] COG1600 Uncharacterized Fe-S protein  ali follow..  11  28..................................................................................FQQVGITDTDLRASEPALQAWLDKQYHGEMAWMARHGMMRAR---------PHELLPGTLRVISVR--MNYLPANAAFASTLKDPTLGYVSRYALGRDYHKLLRSRLKKLGEQIQQYCVDSAPILERPLAEKAGLGWTGKHSLILNREAGSFFFL-KCVACMTICPTGAIVEPYTVDARRCI--SYLTIELEGAIPEAFRPLIGNRI------YGCDDCQ---CPWLELFSWSEAQFLKVTEGSAIRRIGHLRWLRNVAVALG---NAPWSNAVITALESRKGEHPLLDEHIEWAIAQQIEKRNACIIEVQLPKKQRLVRVIE...................... 377
8 -4.570[S] KOG4090 Uncharacterized conserved protein  ali follow..  16  56............................................................................................................................................................................................................................................MAQMATTAAGVAVGSAVGHTLGHAITGGFSGGSNAEPARPDITYQEPQGTQPAQQQQP----------------------LYEIKQF-------LECAQNQGDIKLCEGF-------------NEVLKQCR............................................................ 145
9 -4.560[G] COG3414 Phosphotransferase system, galactitol-specific IIB component  ali follow..  19  1...........................................................MTVRILAVCGNGQGSSMIMKMKVDQFLTQSNIDHT--------------SCAVGEYKSELSGADIIIASTH-IAGEITVTGNKYVVGVRNMLSPADFGPKLLEVIKEHFPQDVK.............................................................................................................................................................................................................................................................. 101
10 -4.560[R] COG2907 Predicted NAD/FAD-binding protein  ali follow..  14  21..SIAVIGA--GVSGLSAA--LLSHRHDVTLYEADNRLGGHANTIIAEGVA---VDTGF------------IVYNEPNYPNLTALFRHIGVETTETDMS--------FGVSLDGGALEYSSTKLLAQKRNVANPRFIKMLLDV-VRFYREGRNIPADLEQGGLCRLDDYLRRQGFGRAFQE---------DHLLPQAAAIWSASMRDIREFPAAALLRFFDNHGLMLPIDKRPIWRT-----------------------VVGGSARYVEKLAAGVSGPILTGRPVKAIHRGPDGVRIEDATGETRAFDHVVIGAHADQLSMLAAPSAEERELLGAFR-------YSRNRAVLHSDPALMPRRRGA---------WASWNHVGRRGEDGEGGVTYWMNILQPLGVERPYFLSLNPMQDPAGLMHD.. 369

FFAS is supported by the NIH grant R01-GM087218-01
8 5 6 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Slabinski L, Jaroszewski L, Rychlewski L, Wilson IA, Lesley SA, Godzik A. XtalPred: a web server for prediction of protein crystallizability. Bioinformatics. 2007 Dec 15;23(24):3403-5. Epub 2007 Oct 5.