current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: PF09445.8; Q6CRW0_KLULA/100-266; RNA cap guanine-N2 methyltransferase, from PfamA30U

Results of FFAS03 search in PfamA30U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .
# Score Template Links and tools%idFirst GNCIVDVFCGGGGNTIQFARLFEKVYGIDSNIDHLYCAYKNAECYNSAVKLKLIYGDWEESLKKTLVKNLGKTPDCIFASPPWGGVDYLRQDTYDLEEHLQPSPLSKILSVFFSVCQNVVLFLPRNSDLDQLSSITHDLLGPDEKCKVVYVKDNGYMKGILAFWGRPLast
1 -99.500PF09445.8; Q6CRW0_KLULA/100-266; RNA cap guanine-N2 methyltransferase  ali  100  1GNCIVDVFCGGGGNTIQFARLFEKVYGIDSNIDHLYCAYKNAECYNSAVKLKLIYGDWEESLKKTLVKNLGKTPDCIFASPPWGGVDYLRQDTYDLEEHLQPSPLSKILSVFFSVCQNVVLFLPRNSDLDQLSSITHDLLGPDEKCKVVYVKDNGYMKGILAFWGRP 167
2 -32.400PF05958.9; TRMA_SHEON/10-365; tRNA (Uracil-5-)-methyltransferase  ali follow..  16  201QGDLLELYCGNGNFSIALAQNFNRVLATELAKPSVDAAQYNIEINGI-DNLQIIRMSAEEFSDAMAKKRSSYLCNTIFVDPPRAGIDPAT-----LDLVQGYERILYISCNPDTLKDNLQQ-LYKTHKVTRFA-----FDQFPYTDHMETGVLLERI.......... 356
3 -22.100PF01170.16; Q9RTT7_DEIRA/193-364; Putative RNA methylase family UPF0020 topsan  ali follow..  17  29EDRIFNPMSGSGTLLIERALLGPALVGVDIDPVAVACARTNLRAAGK--EVEVAQVDALHT------GLPSRSFDLVISDLPWGDAIGSHQSNETLYPAF-----LKEMHRLTSRRGRLCLLTHELRLFERVMR................................. 151
4 -20.300PF01861.14; Q8U1U4_PYRFU/105-348; Protein of unknown function DUF43 topsan  ali follow..  45NKDIFVLGDDDLSIALMLSGLPKRIAVLDIDERLTKFIEKAANEIGY-EDIEIFTFDLRKPLPDYALH----KFDTFITDPPETLEAIRAFVGRGIATLKGPRCAGYFGITRRESSLDKWREIQKNVVITDIIRNFNEYVNWGYAEETRAWKL.............. 199
5 -20.000PF13649.4; D8K355_DEHLB/33-128; Methyltransferase domain  ali follow..  24  1...VLDVCCGTGDQAIRLAEQGIEVHGIDLNGSMLATAESHKRRAGL-DNVSFGQADASAL--------PNRSFDYATTS....................................................................................... 70
6 -18.500PF02475.14; O28306_ARCFU/90-284; Met-10+ like-protein  ali follow..  21  99GEVVVDMFAGIGYFSIPIAVHSKRIYSIEINPESYKLLLENIKLNDVGNIVP-ILGDSQFVTPEGV-------ADRVVMGHI..................................................................................... 174
7 -18.200PF13847.4; B2J9C6_NOSP7/55-253; Methyltransferase domain  ali follow..  18  4EKVILDAGCGTGYKSLVLAEANPKIVGIDISEESIKLAQQRLEHHGF-DNAEFHVLPIQEL------PKLNYQFDYINCDELLYLFPDLAAALQGMISVLKPNGIIRS........................................................... 106
8 -17.900PF11599.6; A9KJB4_CLOPH/1-237; RRNA methyltransferase AviRa  ali follow..  19  50EISLYDCCCGGAYMLSILGLLKSQTYKKASHIDALHSIDRIEELLTREIKTYLFKGNVLEVCDL------PFTPDIIITDVPYGEGSGGINQMMALSAVCGSDTIICVCMDKKQKIHNDIF.............................................. 213
9 -16.700PF10672.7; Q87QG2_VIBPA/25-310; S-adenosylmethionine-dependent methyltransferase  ali follow..  13  124HKNVLNLFAYTCGFSVAAIA-ADKVVNVDMAKASLSKGRENHKLNGHNNQVSFMGHDIFKSWGKIKKSG---QYDLIIIDPP----------SFQKGSFALTKDYKKILRRLPDLLAE-QVMACVNSPSVTSDFLIESMKEEAPELTFRE................. 263
10 -16.300PF05175.12; A6WWW0_OCHA4/169-336; Methyltransferase small domain  ali follow..  15  29FGNVADLGAGWGYLAAQCLKFADRIKSIEADYEALEAARGNLERLGASVPISFNWFDVTSEKMA--------IYDTVIMNPP-----------FHEGRVTDVSLGQAFIAAAASLKPGGRLLMVANRQLPYETTLKG.............................. 151
11 -16.100PF03602.13; RSMD_ECOLI/12-188; Conserved hypothetical protein 95  ali follow..  17  42DAQCLDCFAGSGALGLELSRYAAGATLIEMDRAVSQQLIKNLATLK-AGNARVVNSNAMSFLAQ-----KGTPHNIVFVDPPFRGLLEETINLLEDNGWLADEALIYVESEVENGLPTV----PANWSLHR.................................... 164
12 -16.000PF07091.9; A5UUR5_ROSS1/30-301; Ribosomal RNA methyltransferase (FmrO)  ali follow..  16  127IRSVLDVGCGLNPLAIPWMPLADVYYASDIDSALIEFIGRFMALIGI--PGNAEVRDQTTDPG-------GPPVDLALA........................................................................................ 198
13 -15.100PF05401.9; Q98A39_RHILO/5-200; Nodulation protein S (NodS)  ali follow..  16  41.ANALEVGCAAGAFTERLAPICQRLTVIDVVEPAITRARLRMK----TPHISWIISDVQQFSSD--------LFDLIVVA-------------------------------------EVLYYVGDLVQIRAAVRNLVGLLAPGGQL..................... 138
14 -14.700PF04445.11; M4RGN1_BIBTR/17-246; Putative SAM-dependent methyltransferase  ali follow..  16  72LPTVIDATAGLGRDAFVLACIGCKVTLIERNPDGLKRAYQDTEIGAMQERMVLAGVSAINEL-----NIEQDFADVVYLDPPHKQKSALVKKEMRVFQHLVGADSDDFWLPAKQLARKVVVKRPDYAPFLAAQKPDFSHTTKNHRFDI................... 227
15 -14.600PF02390.15; TRMB_DROME/71-251; Putative methyltransferase  ali follow..  11  2QVSFADIGCGYGGFLVTLGEMFKLSIGMEIRVDRIAALRRRCADTGAYQNIACLRTNAMKYLPNYFVKGQLEKMFFLYPDPHFKRAKHKWRII-EYAYILRKGGLLYTMTDVEDLHKWIVTHMEEHPLYERLTE................................. 149
16 -14.400PF03848.12; TEHB_HAEIN/91-282; Tellurite resistance protein TehB  ali follow..  18  34...VLDLGCGQGRNSLYLSLLGYDVTSWDHNENSIAFLNETKEKENL--NISTALYDINAANIQENYDFIVSTVVFMFLNRE..................................................................................... 110
17 -14.100PF01189.15; RSMB_ECOLI/239-427; 16S rRNA methyltransferase RsmB/F  ali follow..  16  9GEHILDLCAAPGGKTTHILEVAPQVVAVDIDEQRLSRVYDNLKRLGM--KATVKQGDGRYPSQWC----GEQQFDRILLDAPCSATGVIRRHP-DIKWLRRDRDIPELAQLQSEILDAIWPHLKTGGTL...................................... 132
18 -13.900PF08704.8; Q6DFS3_XENTR/64-300; tRNA methyltransferase complex GCD14 subunit  ali follow..  12  41GSVVCESGTGSGSLSHAIIRTVAHLYTVEFHQQRAEKAIEEFRQHKVDHLVTVKNQDVCK--------GVTGIADAVFLDSPW-------------------EAIGHAKSAMKSEGGRICSFSPCIEQVQRTCLALEE............................. 159
19 -13.100PF05219.10; METL9_HUMAN/56-317; DREV methyltransferase  ali follow..  15  91THRLLDLGAGDGEVTKIMSPHFEEIYATELSETMIWQLQKKKYRVLGINEWQNTGFQY----------------DVISCLNLLDRCDQPLTLLKDIRSVLEPTRGRVILALVLPFHPYVENVGGKWEKPSEILEI................................ 209
20 -12.700PF07757.11; Q7Q535_ANOGA/200-315; Predicted AdoMet-dependent methyltransferase  ali follow..  27  66...FVDIGCGNGLLVYILASEGHRGYGIDLRKRKLWDMYPAEPKVDLRVET.................................................................................................................... 113
21 -12.700PF08241.10; Q83DM1_COXBU/77-169; Methyltransferase domain  ali follow..  17  1....LDIGCAKGFLVKDFMKACPEAYGIDISEYALMNCEPEV-------VGRLHLGNADHL--------------------PFPDNSFDAVISLNTVHNLPRERVIIALREIQRVSG.................................................. 88
22 -12.600PF06325.11; PRMA_STRA5/3-308; Ribosomal protein L11 methyltransferase (PrmA)  ali follow..  13  170GETVIDVGTGSGVLSIASSLLAKDIYAYDLDDVAVRVAQENIDMNPGTENIHVAAGDLLKGVQQ--------EVDVIVAN-------------------ILADILIHLTDDAYRLVKDEGYLIMSGIISEKWDMVRESAEKAG--FFLETHMVQGEWNACVF..... 303
23 -12.600PF07279.9; Q9LZY5_ARATH/1-218; Protein of unknown function (DUF1442 topsan)  ali follow..  42TRLIVETWSRGDPIATSVGLAVARHVCIVPDEESRSEYEAVMRGAVTSDSTEVMVLDSAEDVVERISG-----VDFMVVD....................................................................................... 122
24 -12.600PF08123.11; DOT1_DEBHA/959-1163; Histone methylation protein DOT1  ali follow..  13  43QHKFYDLGSGVGNTTFQAALEVHLSGGCEIMEHASKLTELQTMLLNFALSQSFVENDIVRQ----------IECDVLLVN....................................................................................... 130
25 -12.200PF01596.15; A9PCU8_POPTR/22-233; O-methyltransferase  ali follow..  18  54....VGVFTGYSLLSTALALPEDQVTAIDKDREAYEIGLPFIQKAGVEEKINFIQSEATPILNEMLSNDKQPEFDFAFVD....................................................................................... 130
26 -11.600PF02005.14; TRM1_CAEEL/9-442; N2,N2-dimethylguanosine tRNA methyltransferase  ali follow..  11  85..RILDALSASGLRALRFSKEVGFIMANDFSDNAVASIQENVKLNGVEDIVEAHFGDAVMTMMEHRGIDK--RFHAVDLD-PYGTAS................................................................................ 169
27 -11.300PF03291.14; MCES_YEAST/109-424; mRNA capping enzyme  ali follow..  16  57GDVVLELGCGKGGDLRKYGAGISQFIGIDISNASIQEAHKRRSMRNLDYQVVLITGDCFGESLGVAVEPCRFPCDIVSTQ-------FCLHYAFETEEKAR-----RALLNVAKSLKIGGHFFGTIPDSEFIRYKLNK............................. 187
28 -11.200PF12147.6; Q2K5I6_RHIEC/285-593; Putative methyltransferase  ali follow..  10  137...LLDIAAGHGRYVLDAIEAAGSARLQDYSPINVDAGRNSIARRGLNDFVSFHQQDAFDGEG----AAITPAPDLAIVS....................................................................................... 214
29 -10.900PF05185.14; ANM5_ORYSJ/175-630; PRMT5 arginine-N-methyltransferase  ali follow..  13  197KTVLMVVGAGRGPLVRASLQAAEKVYAVEKNPNAVITLHSLIKLEGWESLVTIISSDMRCW-------EAPEKADIL-VSELLGGDNELSPECLDYTSFIEPITASKLHNDIKAHKDIAHFETAYVVKLHRIARLAPNQRYTKLKFEIPQETGSCLVHGFAGYF... 393
30 -10.700PF05891.10; NTM1_ORYSJ/61-283; AdoMet dependent proline di-methyltransferase  ali follow..  11  56HLVALDCGSGIGRVTKNFLLRFNEVDLVEPVSHFLEAAQENLTECMEVGEANFYCVPLQDFTPD------EGRYDVIWIQWCIGQLPDDDFISFRAKIGLKPNGFFVLKE---NIARNGFVLDKEDNSITRSDAYFKELFKKCGLYIHSIKDQSDLPKEL....... 214
31 -10.700PF08003.9; CMOB_VIBVY/7-322; Protein of unknown function (DUF1698 topsan)  ali follow..  13  117NRSVLDVGCGNGYHMWRMLGEARLCVGIDPSHLFLIQFEAIRKLMGGDQRAHLLPLGIEQL-------PKLEAFDTVFSMGVLYHRRSPLDHLIQLKDQLVSGGELILETLVIEGDETAVLVPKERYA....................................... 238
32 -10.600PF02353.18; CMAS2_MYCTU/12-298; Mycolic acid cyclopropane synthetase  ali follow..  10  62GMTLLDIGCGWGSTMRHAVAEYDNVIGLTLSENQYAHDKAMFDEVDSPRRKEVRIQGWEEFDEPVDRIVSLGAFEHFADGAGDAGFERYDTFFKKFYNLTPDDGRMLLHTITIPDKEEILTEIFPGGRLPRISQVDYYSSNAGWKVERYHRIGANYVPTLNAWADA. 246
33 -10.600PF03059.14; A3DUI9_MALBX/3-277; Nicotianamine synthase protein  ali follow..  12  123......AFVGSGPTSIVLASNKTSFDNYDINASANSKALGLVSSDPLSKRMVFHTTDIMDV------TTALKDYEIVFLAALVGMDKMEKLKIIDHLAKYMAPGATLMLRSAHGARA.................................................. 234
34 -10.400PF01555.16; YHDJ_ECOLI/34-254; DNA methylase  ali follow..  20  182GDIVLDPFAGSFTTGAVAIASGRKFIGIEINSEYIKMGLR............................................................................................................................... 221
35 -10.100PF04989.10; A8ZT86_DESOH/39-259; Cephalosporin hydroxylase  ali follow..  11  34.DLILETGIAHGGSLIFSASMLALLRVLGIDIDIREHNRAAIEAHPMAGRIQMIQGSSVDVIQKVHAVAKEFSRILVCLD------MHTHDHVLAELEAYAPL----VSPGSYCMVFDTIV.............................................. 165
36 -9.820PF16950.3; D7SU76_VITVI/181-480; SAM-binding_domain  ali follow..  12  192TTVLMVVGAGRGPLVRASLQAAEKVYAVEKNPNAVVTLHSLVKLEGWENIVTIVSCDMRQW-------DAPEKADILVSE....................................................................................... 270
37 -9.760PF00398.18; RSMA_BACSU/19-283; Ribosomal RNA adenine dimethylase  ali follow..  15  31KTGVIEIGPGIGALTEQLAKRAKKVVAFEIDQRLLPILKDTLSPY---ENVTVIHQDVLDVKSVIEEQFQDCDEIMVVANLP-----YYVTTPIIMKLLEEHLPLKGIVVMLQKEVAERMAADPSSKEYGSLSIAVQFYTEAKTVMIVPK----------TVFVPQP 181
38 -9.570PF05575.9; Q56677_VIBCL/1-286; Vibrio cholerae RfbT protein  ali follow..  12  80DTTYIDIGANVGTFCGIAARHITKIIAIEPLTEMENSIRMNVQLNNPLVEFHHF----------------------CAIGENEGENIFEVYEFDNRVSSLYFKKNTDIADKVKNSQVLVRKLSSLDISPTNSVVIKIDAEG------AEIEILNQIYEFT....... 214
39 -9.260PF01269.15; A8M8R8_CALMQ/9-236; Fibrillarin  ali follow..  72GSKVLYLGAASGTTVSHVSDIVGLIYGVEFSPRVFREFMQNIIDQGR-LNVIPILADARY---PEQYISLVKGVDVAYID-----PFQAKILADNADVYLVKGGYIILVIKAMSIDVTKEPSETFKREIDTIKE................................. 202
40 -9.240PF00107.24; ADH_SULSO/182-311; Zinc-binding dehydrogenase  ali follow..  17  1.........GLGTMAVQIAKAGATIIGVDVREEAVEAAKRAGADYVINASMQ-------DPLAEIRRITESKGVDAVI......................................................................................... 64
41 -9.210PF00154.19; RECA_ACIAD/7-268; recA bacterial DNA recombination protein  ali follow..  18  36GSLTLDIALGIGGLP-----RIVEIYGPESSGKTTMTLQAIAQCQKAGGTCAFI--DAEHALDPQYARKLGVDIDNLLVSQPDHG-----EQALEIADMLVRSGAIDLI-----VVDSVAALTPKGLQARLMSQALRKITGNAKRSNCMVIFINQIRMKIGVMFGSP 199

FFAS is supported by the NIH grant R01-GM087218-01
1 1 6 6 5 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Godzik A. VISSA: a program to visualize structural features from structure sequence alignment. Bioinformatics. 2006 Apr 1;22(7):887-8. Epub 2006 Jan 24.