current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: PF09412.8; B8LDL9_THAPS/223-504; Endoribonuclease XendoU, from PfamA30U

Results of FFAS03 search in PfamA30U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280
# Score Template Links and tools%idFirst ETDLQTAAQTLWNLDSNRLTPHTDYSIDVQSSKHPCNKEDAADEPLFTRINTQIFQVRPTFKAFRALLDNYSSYCGDEEEISEKELQEIRVFLDAIMDTAVMKYCHQYCLAKEASYEGEAIPESEYGFKKVLNSIWFELYSRSGGGGRRGRKMDSSGFEHVFVGEVKNGQISGFHNWVQFYLEEQKGNVDYRGYIKPRSGNSAETNDDDQVLTLQFSWNGVEKFVGTSFIGVSPEFELALYTMAFLTGEDDNEVTLNTGREMFDLNIKCHKYNGGANVGSCYLast
1 -129.000PF09412.8; B8LDL9_THAPS/223-504; Endoribonuclease XendoU  ali  100  1ETDLQTAAQTLWNLDSNRLTPHTDYSIDVQSSKHPCNKEDAADEPLFTRINTQIFQVRPTFKAFRALLDNYSSYCGDEEEISEKELQEIRVFLDAIMDTAVMKYCHQYCLAKEASYEGEAIPESEYGFKKVLNSIWFELYSRSGGGGRRGRKMDSSGFEHVFVGEVKNGQISGFHNWVQFYLEEQKGNVDYRGYIKPRSGNSAETNDDDQVLTLQFSWNGVEKFVGTSFIGVSPEFELALYTMAFLTGEDDNEVTLNTGREMFDLNIKCHKYNGGANVGSCY 282
2 -45.300PF14436.4; K9ZCI9_ANACC/290-423; Bacterial EndoU nuclease  ali follow..  14  1.........................................................................................................................................................NVAGFDHVFCGEPSGGAIGGLHFVGRYVQLQNDGLAGRKANNSSNE-EVDPGAIYTIGAIIKVGSGISQSNIKGYGYTLNAEDILKMGAKAYKQNPNITHWTITDDGETFKSVFVR----RSGGIRTFY 131
3 -7.450PF12318.6; Q5NPF0_ZYMMO/13-180; Membrane bound FAD containing D-sorbitol dehydrogenase  ali follow..  36........................................................LQDQFFQISTFLTGHDLDRALSNRALTALIAVDAHFPEKLQNLQQALAVEKLTDSSLLRTSPIGQDDALMATSKTIVSAWYLGYAGEPASHAMEDNARFITYSGALMYRPTMDATVAPSYWVN....................................................................................................... 166
4 -7.040PF05634.9; I1MQ97_SOYBN/64-263; APO RNA-binding  ali follow..  10  9.......................................................KTLPQNEDLPPILPKNKKKPYPIPFKEIKQAGREDRKLAHMGIEKPLEPPKNGLLVPDLVPVAYEVFDAWKLLIEGLAQL-LHVIPAHGCSECSEVHVAQTGHHIRDCSGTNGRQRRSSHAWVKGSVND--------------------------ILVPIESYHRRIKHDTRFEYDRIP----AVVELCIQAG.................................. 176
5 -6.910PF15122.4; G1KFB8_ANOCA/52-346; TMEM206 protein family  ali follow..  15  97.................................................................................LTETVNYTAPFTNETKKHAIIVEGPRDVKKRELVFMQFHLNETDQDFSAIDYLLFFQEFLSSPNKSEFMKVCESSYSSWKFSG--------GFRTWVKMSLVKTKEEDSRETVEFRQEISRRTKAEGDQLFFVVFEWKDPFIQEVQDIVTANPWNMIALLCGVFLA................................... 262
6 -6.410PF10778.7; Q1ITK9_KORVE/30-184; Halocarboxylic acid dehydrogenase DehI  ali follow..  16  4..........................................................PTIFKAAAGNSTYIREMDLYEVACSKEFHASAETLNQFINAQVIGTRWRFSNQERLLTAQKFSPADVSTFQRALPRLFTRLMQRGYSGGQRSARHGSSPFARMITLHIPSESEASLRTWLIYSEIKRN................................................................................................ 145
7 -5.910PF12972.5; F6GSV4_VITVI/527-824; Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain  ali follow..  11  95.SEVKDALGLFIAS-GGQLLGSNTYRYDL---------VDLTRQALAKYANQ----------LFLEVIEAYQLNDVRGAACHSQKFLELVEDMDTLLACHDGFLLGPWLESAKQLAQDEQQEIQFEWNARTQITMWFDNTEDEASLLRDYGNKYWSGLLRDYY----------GPRAAIY--------FKYLLESLETGNEFALKDWRREWIKLTNDWQNSRNAYPVRSSGNAIDTSRRLYN........................................ 297
8 -5.500PF12626.5; H8GHQ0_METAL/330-448; Polymerase A arginine-rich C-terminus  ali follow..  12.............................................................................................................AAGEILTRQVRRTAFPRHISLAMREVWFEQRIGPRPARLLTHPRFRAAYDFLLLRAETGDAGPELADWWSKFQEADEAA.............................................................................................. 95
9 -5.370PF10776.7; C5D6E4_GEOSW/20-348; Protein of unknown function (DUF2600 topsan)  ali follow..  14  19EPELRKQALASIETKAFHCEGGSILSLLAGEKMEECIRFIVAYQTISDYLDNTSLDPLDFRALHESMPAALSIDADVSNYYRHRQEQDDGGYLHDLVRTDVLKKVMHYDKIVPFLHELAGYYCDLQVHKHVHAREWFKQFSACSGSTLGIFCLVAYAFTETFHEEMAKQ-IQGLHILLDYFIDQEEGDLNFCFYY---------PNQSVLLERLCHFIEEADRHVNQLFHRLIHRGLLGLY......................................... 291
10 -5.310PF06926.9; Q9CIB6_LACLA/128-222; Putative replisome organiser protein C-terminus  ali follow..  17  1.................................................................................................................................NSLLSKFLDTFINFSSKNRSKRAVATAEFIKL-PSFQREQAVIGAMNYIQSYKNEHPD............................................................................................... 57

FFAS is supported by the NIH grant R01-GM087218-01
1 1 9 1 0 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7.