current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: PF08423.9; W1Q8L5_OGAPD/106-359; Rad51, from PfamA30U

Results of FFAS03 search in PfamA30U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250
# Score Template Links and tools%idFirst LGFTTATEFHQRRSELICLTTGSKQLDTLLGGGIETGAITEVFGEFRTGKSQLCHTLAVTCQLPIDNGGGEGKCLYIDTEGTFRPIRLVAIARRFGLDENETLDNVAYARAYNADHQLQLLHQAASMMTESRFSLLIVDSIMALYRTDYSGRGELSARQMHVAKFMRTLQRLADEFGIAVVITNQVVAQVDGGAIFNPDPKKPIGGNIVAHSSTTRLYFKKAKGANRICKIYDSPCLAESETVFALGQGGVIDPLast
1 -120.000PF08423.9; W1Q8L5_OGAPD/106-359; Rad51  ali  100  1LGFTTATEFHQRRSELICLTTGSKQLDTLLGGGIETGAITEVFGEFRTGKSQLCHTLAVTCQLPIDNGGGEGKCLYIDTEGTFRPIRLVAIARRFGLDENETLDNVAYARAYNADHQLQLLHQAASMMTESRFSLLIVDSIMALYRTDYSGRGELSARQMHVAKFMRTLQRLADEFGIAVVITNQVVAQVDGGAIFNPDPKKPIGGNIVAHSSTTRLYFKKAKGANRICKIYDSPCLAESETVFALGQGGVIDP 254
2 -26.800PF06745.11; O29463_ARCFU/20-274; KaiC  ali follow..  16  5.........TKLDELFYKVEKEGDRYVRKPLGGIPHLAVMNITGVPDTGKSLLAEQFAITQAGSGY------RVLYVTVESP---TAMKERSEAMGVDFTKVESNVVVIDASESDELRALMETMAYAIKEKKVTNTIIDSITGLYEHK----------EMMARQIVRQFFNFMKKYRQTGIFVSQKRSA-GLAVAHIVDGTIVLDKKLIESRWDVSLYGLPLGSILRTIRIDGCRIAPHDSRVFEISEIGT... 247
3 -24.400PF00154.19; RECA_ACIAD/7-268; recA bacterial DNA recombination protein  ali follow..  25  25..........NTVQAVEAVSTGSLTLDIALGGGLPKGRIVEIYGPESSGKTTMTLQAIAQCQ-------AGGTCAFIDAEHALDP----QYARKLGVDIDNLL-------VSQPDHGEQALEIADMLVRSGAIDLIVVDSVAALTKAEIEGESHMGLQARLMSQALRKITGNAKRSNCMVIFINQIRMKIG---VMFGSPETTTGGNALKFYASVRLDIR------RIGQVKEGDEIIGSETKVKVVKNKMAPP 247
4 -20.700PF13481.4; B2JV40_BURP8/220-401; AAA domain  ali follow..  18  17.......................PIIDDLVDDVIPAHAVGAVWGASAAAKSFLVLDLAAALTECRSFFGHDVPVLLVSLEGNNLPRRYLAWEKHNGRPVPARLHTLTQGFSLLDPRDTDDLCEAIET-CGITGGVVFIDPFALAT----IGLEENSSAD--MGRAGAALNTLRERTGCTVIAVHHTGKKQE............................................................... 182
5 -14.300PF07088.9; GVPD1_HALSA/23-536; GvpD gas vesicle protein  ali follow..  17  1.........................LSQFFMGD--AGETLLINGAPGTGKTLFTIRGLDVLD--------DSDVLYVSTRVDQETVHEMYFADHSSLDTTAILDLFQDPFELPLDVDVSLLEWIQEINAATTQLTIAFDSWELIYEY-----AVRHDDPPDIKTVTNQLAVLAREENIRLMLVTETAAP--SSLEYIVDGVVTLQVKEDDRGRTRRLRLDKLRGVR----------IGNRLQPFTLADGQFQ.. 211
6 -13.500PF13479.4; F5YIK8_TREPZ/11-202; AAA domain  ali follow..  12  7.........................................LFGPSGSGKTMTALRMAKGIA-----DTMGVPFAVIDTEARYADRIPFDVDDLDGKTVDHYIAAM-------------------NECVKAGYKVLVIDSLSHAWRAQSSVSKNTFSPWAKVNPKQKRFIDAILNFPGHIIATMRSKTEWVIGEGKGGKVAPEKMG................................................ 160
7 -13.200PF16834.3; J8PMJ6_SACAR/9-204; Shu complex component Csm2, DNA-binding  ali follow..  6..................................................SPTKGDLCHFIKENLSNEHIITQLFFIDATGSFPLSHFQKLVPPNLPENVKMYENIRINTCLDLEELSTITVKILQILSMNKINILYINGLEVMCR-NSQFKSSPQRSHELTRDILLKLRVMGNDENIRTVLEFPKEQ.................................................................. 159
8 -13.000PF13401.4; B2UJB3_RALPJ/42-210; AAA domain  ali follow..  14  2..................................SQESILLVCGPTGAGKTTLAKFMAIYVQAPASGETK--------SWRLFYQRILNQLGDKVAYGVDSLSGRLVRPRGTSGNSLAALRTAVERGLRARQVQFMVIDEAAHIFRD--------TQRNSKLEVQLDTLKSLVNECGTQIVLVG...................................................................... 161
9 -10.400PF05621.9; S6B007_9PROT/25-277; Bacterial TniB protein  ali follow..  17  40.........................................VVGRSLMGKSTLFDEFLRRHPADDDGDAAIIPIVSVQYPDTAKEGIYPEILASLN------------ARIPANTKAPELRRATVELLRQVGMRVLLIDEIHNL----------LEGSANSQRKGLNSIKYLMNELHRPVITAG...................................................................... 160
10 -9.820PF03796.13; M4NCG5_9GAMM/198-453; DnaB-like helicase C terminal domain  ali follow..  18  2..................VSTGFTDLDRLT-SGLQPSDLIIVAARPSMGKTAFALNIALGGKKAVVVFSMEMSSSQLAFRLISSVGRIHQQHLRNGDLQEEDWPRVSNAIALLSEAKIFIDDTPGLSPVELRSRLIVID-----YLQLMQVPGNKENRATEISEISRSLKGLAKELNVPVIALSQLNRSLEQ.............................................................. 185
11 -9.770PF02283.14; Q89Q74_BRADU/14-176; Cobinamide kinase / cobinamide phosphate guanyltransferase  ali follow..  14  3.........................................ITGGARSGKSRRAETRTQAF---------PGRPVYIATAEALDAEMEDRIAKHRA------------RRGADWIEREVPLDLVQALVETEGGGARLVDCLTLWLSNLLHSERDWSREVTHLAEVLPRVIMVTNEVGLGIVPDNALARTYRDAAGIMNQTFAGVADEVEFVVAGLPMKL................................... 163
12 -9.610PF01637.16; A8M939_CALMQ/15-228; ATPase domain predominantly from Archaea  ali follow..  13  1........FTDREVAIRQIEKLAEK---------GTWNPVVIYGPEGCGKSAFLKQAVEVLG------EYDYSVVKVSPLEDESNEKLSEELRGLFRDIMTRIPTPFNDASALIDIAISLLYDVVRRRIRRKI-ALLADDVFQAIGLD--------KAELLVKRLLNMIEYSSVDYERIVVIV....................................................................... 153

FFAS is supported by the NIH grant R01-GM087218-01
1 2 0 2 1 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Godzik A. cd-hit: a fast program for clustering and comparing large sets of protein or nucleotide sequences. Bioinformatics. 2006 May 26;