current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: PF06745.11; O29463_ARCFU/20-274; KaiC, from PfamA30U

Results of FFAS03 search in PfamA30U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .
# Score Template Links and tools%idFirst IPTGTKLDELFYKVEKEGDRYVRKPLGGIPHLAVMNITGVPDTGKSLLAEQFAITQAGSGYRVLYVTVESPANFLYTAMKERSEAMGVDFTKVESNVVVIDASESDELRENPKALMETMAYAIKEKKVTNTIIDSITGLYEHKEMMARQIVRQFFNFMKKYRQTGIFVSQKRSAQASESAEAAGGLAVAHIVDGTIVLDKKLIESRWDVSLYGLPLGSILRTIRIDGCRIAPHDSRVWVFEISEIGTIEIIAPLSLast
1 -99.100PF06745.11; O29463_ARCFU/20-274; KaiC  ali  100  1IPTGTKLDELFYKVEKEGDRYVRKPLGGIPHLAVMNITGVPDTGKSLLAEQFAITQAGSGYRVLYVTVESPANFLYTAMKERSEAMGVDFTKVESNVVVIDASESDELRENPKALMETMAYAIKEKKVTNTIIDSITGLYEHKEMMARQIVRQFFNFMKKYRQTGIFVSQKRSAQASESAEAAGGLAVAHIVDGTIVLDKKLIESRWDVSLYGLPLGSILRTIRIDGCRIAPHDSRVWVFEISEIGTIEIIAPLS 255
2 -47.500PF07088.9; GVPD1_HALSA/23-536; GvpD gas vesicle protein  ali follow..  15  1....................LSQFFMGD--AGETLLINGAPGTGKTLFTIRGL-DVLDRDSDVLYVSTRVDQETVHEMYFADHSSLD-ILDLFQDPFELPLDVDVPFEKLDLDSLLEWIQEINAATTQLTIAFDSWELIYEDDPPDIKTVTNQLAVLAREENIRLMLVTETAAPS-----------SLEYIVDGVVTLQVKEDDR-----------GRTRRDLRLDKLRGVRIGNRLQPFTLADGQFQVITP... 215
3 -27.500PF05625.9; W5J4H7_ANODA/9-373; PAXNEB protein  ali follow..  10  8..ARLSLHSGQSIVSSGNPSLDHIFGGGFPVGSIIGLEDKYGNYARVLAKYFLAEGLVNDHALLLASLEEDPEQLMRKLPTPVEEKSFDLTKAIDPTTLIGKDSGPFESSHFASLLSCIHRKAREQNVLRICLHSVGS--RGFSKDFVHFLTVLKAIVRNTLSVCFITMPYHLFHHLEDSYLCA---LTNLCDYSFGLEAFVGQAEEQANPLFKEYHGL---LNIGKITALN-ETRDLAFKLKRSKFVI...... 329
4 -26.800PF08423.9; W1Q8L5_OGAPD/106-359; Rad51  ali follow..  16  10....HQRRSELICLTTGSKQLDTLLGGGIETGAITEVFGEFRTGKSQLCHTLAVTCQLPIDKCLYIDTEGT-----IRLVAIARRFGLDENETLDNVAYARAYNADHQL----QLLHQAASMMTESRFSLLIVDSIMALYRTDQMHVAKFMRTLQRLADEFGIAVVITNQVVAQ----------DGGAIFNPDPKKPIGGNIVAHSSTTRLYFKKAKGANRICKIYDSPCLAESETV--FALGQGGV........ 251
5 -19.400PF00154.19; RECA_ACIAD/7-268; recA bacterial DNA recombination protein  ali follow..  14  20MRLGDNTVQAVEAVSTGSLTLDIALGGGLPKGRIVEIYGPESSGKTTMTLQAIAQCQKAGGTCAFIDAEHALDPQ------YARKLGVDIDNLL------------SQPDHGEQALEIADMLVRSGAIDLIVVDSVAALTPKAEIEMSQALRKITGNAKRSNCMVIFINQIRMK--GSPETTTGGNALKFYASVRLDIRRIG-----QVKEGDEIIGSETK-VKVVKNKMAPPFREAIFQILYGKGV........ 261
6 -19.300PF13481.4; B2JV40_BURP8/220-401; AAA domain  ali follow..  15  16.................QPIIDDLVDDVIPAHAVGAVWGASAAAKSFLVLDLAAALTEEPVPVLLVSLEGNNG-LPRRYLAWEKHNGRPVP---ARLHTLTQGFSLLDPRDTDDLCEAIETC--GITGGVVFIDPFALATENSSADMGRAGAALNTLRERTGCTVIAVHHTGKKQE............................................................................... 182
7 -17.900PF09807.7; H2RXC0_TAKRU/2-258; Elongation complex protein 6  ali follow..  1.................FTELNSILN-DSFTQGEFILVTDRQSDASFLIHHFLCFYLRARCKVLFLGLVQSLNHYSSVSQR----LGVSLAQAKDKGQLIFLEGLKDSAAGLRSLYQFVRSRLSGAGPPVLLVDDVSVLLSVSAGAVLDFSHYCRATVCSRLKGNVVMLTRCDGEEQEDEGDDEGPELTHQCSIALHVQGLPTGFCRDIH------GQVEVCWRQKQTDGQCTPSKLFQYKVHD........... 257
8 -15.600PF05621.9; S6B007_9PROT/25-277; Bacterial TniB protein  ali follow..  13  14...........QQAESILDELEALYK---VRPQGRLVVGRSLMGKSTLFDEFLRR--GDAAIIPIVSVQYPDTAKEGIYPEILASLNARIPA----------------NTKAPELRRATVELLRQVGMRVLLIDEIHNLLEGSANSQRKGLNSIKYLMNELHRPVITAGTIEALNAIRTDEQISS-----------RLTPLPLVRFKDDDAFQELLQCFELMLPLRKPSYLGDPELSSVIYQHTFGIVGRVAEV. 234
9 -15.400PF13401.4; B2UJB3_RALPJ/42-210; AAA domain  ali follow..  12  3..............................QESILLVCGPTGAGKTTLAKFMVENAHSQSHPAIYVQAPASGESWRLFYQRILNQLGDDLDSPKVAYGVDSLSPRGTSGNSLAALRTAVERGLRARQVQFMVIDEAAHIFRQRNSKLEVQLDTLKSLVNECGTQIVLVG...................................................................................... 161
10 -15.300PF04665.10; Q6TUP8_YMTV5/6-246; Poxvirus A32 protein  ali follow..  11  16..................................IALVGGSGSGKTAYLLSLFNTFVEKYRHIFLFTPVYNS----------------EYDSYIWPDHVNRVTTYEELDYSLITTKQKIEKYVKKQGNDKLILDDMG-----DKQIRSSCLLDFLNHGRHLNTSIILLCQTYKHVPVNGRTSITHFCCCNVSD.............................................................. 159
11 -14.900PF13479.4; F5YIK8_TREPZ/11-202; AAA domain  ali follow..  10  5..................................CALFGPSGSGKTMTALRMAKGIADTGVPFAVIDTEARSASK------YADRIPFDVDDLDG--------------KTVDHYIAAM-NECVKAGYKVLVIDSLSHAWRELTAKVNPKQKRFIDAILNFPGHIIATMRSKTEPEKMGLAPEQGKGIEYEFDLLMEL-------------------DQKHQATVTKDR.......................... 191
12 -14.300PF01637.16; A8M939_CALMQ/15-228; ATPase domain predominantly from Archaea  ali follow..  10  8.................IRQIEKLAEKG--TWNPVVIYGPEGCGKSAFLKQAVEVLGEYDYSVVKVSPLEDESNEKLRYSE-------ELRGLFRDIMTRIPTPFNDASALIDIAISLLYDVVRRRIRRKLLADDVFQAIGLDKA--ELLVKRLLNMIEERIVVIVATSEGVTWGRIGRHRWAEIMAMWNMPEGFGKLYNALPGPKPPFEEVWRWTGGNPKALEML............................. 214
13 -14.000PF03796.13; M4NCG5_9GAMM/198-453; DnaB-like helicase C terminal domain  ali follow..  14  2.............VSTGFTDLDRLT-SGLQPSDLIIVAARPSMGKTAFALNIAEAALGGKKAVVVFSMEMSSSQLAFRLISSVGRIH-DWPRVSNAIALLSEAKIDTPGLSPVELRSRARRLHREHGLGLIVIDYLQLMQVPGNKENREISRSLKGLAKELNVPVIALSQLNADKRPMMSDLRESGAIEQDADVIMFIYRDEYYNKESPDKGVAE-------IIIGKQRN......................... 237
14 -12.600PF01695.15; Y4IQ_RHISN/60-238; IstB-like ATP binding protein  ali follow..  16  45............................LAKGANILLFGPPGGGKSHLAAAIGLALIENGWRVLFTRTTD----------------------------LVQKLQVARRELQLESAIAKLD------KFDLLILDDLAYVTKDQAET--SVLFELISARYERRSIMITANQPFGEWNRVFPDPA----TLAAVDRLV........................................................... 173
15 -11.700PF01580.16; SFTA_BACSU/595-787; FtsK/SpoIIIE family  ali follow..  11  20.............AALGLDISGNPVVIDLKKMPHGLIAGATGSGKSVCINTILVSLLYKAELAPYNKIPHLVSPVITDAKAATAALKWVVEEMERRYELFAHSGVRDIDRFNQLTAEH--QMGEKLPYLVVIIDELADLMMVAPNDVEESIARIAQKARACGIHLLVATQRPS.................................................................................. 192
16 -11.400PF07652.12; Q32ZD8_9FLAV/1675-1822; Flavivirus DEAD domain  ali follow..  1............................FKKKQLIVLDPHPGAGKTRVLPEFIRQAVERRLWTLAL---APTRVVAAEMAEALNGLPVRYLTPAVIQQHTGKEIVDLMCHAT--FTMRLLSGGRVPNYNMFIMDEAHFT----DPSSIAARGYISTKVDMGEASAVFMTATPPGSR............................................................................... 140
17 -10.800PF10483.7; C0NHJ4_AJECG/16-346; Elongator subunit Iki1  ali follow..  2....................ISKLLSLRDSTSPLTLLLDSLEQPATPLIKEYIRRAKLSKVHVIFVSFETLTR---DGIDTFILARRNSLADIAKE-----------VVSAASSPLLPYPSAATASNKSLVIIDSVNPMIDRKSDA--NKEVNPAAYLRSTSLIVVYHQDIPACLQKQTLYTPTTLSLTYLATTIFTVH........................................................ 180
18 -10.800PF05707.10; Q79YX7_VIBPA/2-255; Zonular occludens toxin (Zot)  ali follow..  14  1................................ATSFRYGHGGSYKSACAVWFDLLPALREGRICITNIH------MQPLEVIEQRLGEKFPDTAR---LIRISSRNPEGFELWKYFFCWAPI------AFILIDECQQIFSVNAGFKMA.......................................................................................................... 104
19 -10.700PF13671.4; B2JHT3_BURP8/20-178; AAA domain  ali follow..  15  1.................................LVFICGHAGTGKTTLAKRLIGPMKATGEACCLLDKDTLYGVYSAAAIGALTGDPNDRDS--------PLFLQHFRDPEYRGLFDTAAENLRL---IGVIAVG........................................................................................................................ 93
20 -10.500PF01443.16; RDRP_TMV/829-1085; Viral (Superfamily 1) RNA helicase  ali follow..  11  1..................................VLVDGVPGCGKTKE----ILSRVNFDEDLILVPGKQAAEMIRRRANSSGIIVATKDNVKTVDSFMMNFGKSTRCQFKR------------------LFIDEGLMLHTGC----------VNFLVAMSLCEIAYV....................................................................................... 102
21 -10.300PF02399.13; OBP_VZVD/13-828; Origin of replication binding protein  ali follow..  13  47..............................TRPVTVVRAPMGSGKTTALLEWLQHALKADISVLVVS---CRRSFTQTLIQRFNDAGLSGFVTYLTSE--YIMGFKRLIVQLESLHRVSSEAIDSY--DVLILDEIGQLYSPTMRRLSAVDSLLYRLLNRCSQIIAMDATVNSQFIDLISGLRGDENIHTIVC.............................................................. 207
22 -10.200PF07931.10; Q98FG2_RHILO/59-238; Chloramphenicol phosphotransferase-like protein  ali follow..  13  1...............................ARIVLLNGVGSAGKSSIARALQ---TITAAPFLHVQMDSFLEMLPDALQDHADGFSYETVRQD-----GKPAVVIRAGPVGERTLRGMRHAIAAMAGQDLIVDDVLC---------NGELSDCVDLLSAFDFHLVGV....................................................................................... 122
23 -10.200PF03029.15; O01426_CAEEL/6-251; Conserved hypothetical ATP binding protein  ali follow..  14  1....................................VIGAPGAGKSTFCAGLTDIFSQTKRPFLTINLDPANDTMAYAPDVNITEM-ITVNDVMDRLGLGPNGALKYCIETLGANCNWLLQKIEANHKKYLIIDCPGQLELYKSEGELWKVIRFLEKSGVRLCALHLADS..................................................................................... 133
24 -10.200PF09848.7; A1A222_BIFAA/236-699; Uncharacterized conserved protein (DUF2075 topsan)  ali follow..  10  1...............................SRLIFVQGVAGTGKTVLLSHLFYRIATEMDINGRINDEDDEDILETDSSLKISKERRKAYILVNHNQQMHVYNQIASKLGLQKHFGEVALKPSQFKADVVLVDEAHLLLTQGDQGYSGK--MLHDLLRRAKVVIAVFDP..................................................................................... 159
25 -10.000PF09140.9; Q9A6C9_CAUCR/5-268; ATPase MipZ  ali follow..  3.................................IVVGNEKGGAGKSTIAVHLVTALLYGGAKVAVIDLDLRQRTSARFFENRRAWLDNKKIELPEPLALLSDNDVALAERPEEEQVAGFEAAFARAMAE-ILIDGDSAITRMAHGRADLVVTPMNDSFVDFDMLGLTKPSLYSLTVWEGRKQRALSGQRQAMDWVVLRNRLATTEARNRKRLEDRLNALAKRVGFRIGPGLRDRVIYR--ELFPFGLTIA..... 231
26 -9.990PF10236.7; Q755C9_ASHGO/113-434; Mitochondrial ribosomal death-associated protein 3  ali follow..  12  3.............TREATGQLLERLSGT--EHQRVILTGQPGVGKSTLLAQAQVAAFEKGSVIINISLKSNKKSVLSSVATRESASKRVTRLVPGKNTLYDLLSMKTTPAARGMLFQAVIDELVAQSPVYLTVDNFSRILSEPLSAYKD.......................................................................................................... 185
27 -9.780PF16575.3; G0MKR2_CAEBE/121-307; mRNA cleavage and polyadenylation factor CLP1 P-loop  ali follow..  13  1......................................GPADVGKSTVSRIICNYSVRQGRTPLFVDLDSVPGTVAAVLLQKTADVIDSFERNSPLVLNFGHTNPSANLSLYETLFKELASTINEAKIGGMIINTCGWVDGEG-------YKCLVKAASAFEVDVVIVLDHERLYSDLSKELPEFVRLTHVSGGVEQRTPQMRAIMRGENIHRYFYG...................................... 187
28 -9.700PF10923.6; B0C6J3_ACAM1/7-410; P-loop Domain of unknown function (DUF2791 topsan)  ali follow..  11  13LQAGVVPRKGQHLIQVGRAEIERIAEGG---AAIRFIIGEYGSGKTFFINLTRTIALEKKLVTAHADLTPDRTELMANLSTRTKPDGGALPSVVERFVTSAMTEGRDRKVNPEDIIRERLAHLSEFVGGYDFSEVIAAYWRGHDSGDDALKANAVRWLRGEFSTKTEARSALGVRTIVDDTNVYDQ-LKLFADGFMICELVNLYKLSNTQARKSNYEQILRILN............................... 263
29 -9.500PF13500.4; B1XHZ8_SYNP2/6-216; AAA domain  ali follow..  13  2................................HIVVASTEPYSGKSAVLLGLVQSLKQKGISVAYSEQNGRFTRIEDDLRFLGEAFGLKETEVRSPVLFLDEATVAQRGQDQTDYPQKLKDDLGAIASDITFIEAPKSLWEGSLFNLSA-----GEIAATLGAKILLVIPYHHKLLVDSLLTIYRFLGDRLMGVVI........................................................... 171
30 -9.410PF12846.5; Q833R2_ENTFA/443-804; AAA-like domain  ali follow..  10  10....................ASQGVKGSVTNALAAAFLGSLGGGKSFSNNLLVYYAVLFGGQAVIVDPKGERGGWKENLPEIADEININLTSKPENQGLLDPYVIMKKKKDSESLAIDILTFLTVTQSDQRGLLQVINELRKENSPVAENIADHIESFTDYDFAHLLFSDGSITQSISLDKQLNIIQVADLV............................................................... 201
31 -9.400PF05729.10; G3V6C0_RAT/441-610; NACHT domain  ali follow..  13  1.................................VVAVLGKAGQGKSHWARTVSHIWAQGQLPQYDFVFYVPCQCL--DRPGDTYHLRDLLCPPNLQPLAMDDEVIDHIVRQPDRVL--ILDAFEELEAQDSLLHGPCGPLSPEPCSLRGLLAGLFQRKLLRGCTLLLTARPRGR................................................................................. 138
32 -9.380PF03266.13; NTPTH_METAC/3-167; NTPase  ali follow..  14  2..................................IAVTGSPGVGKSTVVAKTAEKLAEKPGFKI-------GGIRTAEIRKEGHREGFSIRDLATGKTGILSHRLGKYHVNLDDLERIGANAVRNLACDLVVIDEIGPMELISQSFVSAVEEVL..................................................................................................... 121
33 -9.290PF08433.8; O46079_DROME/1-293; Chromatin associated protein KTI12  ali follow..  13  2................................PLVVITGLPASGKSTRARQLRDHFVERGRKVHLISENEAVPKA------------------------FGKNSHTGDSQKEKVVRSDLKSEASRHQEDLVILDAGNYIK-----GYRYELYCMSKVSRTTQCTVFTCIPQEE.................................................................................. 116
34 -9.080PF02374.13; ASNA_HUMAN/37-340; Anion-transporting ATPase  ali follow..  12  2................................KWIFVGGKGGVGKTTCSCSLAVQLSKGRESVLIISTD-PAHNISDAFDQKFSKVPTKVKGY-DNLFAMEIDPSLGVAELPDEFYAEVMRLVKGMNFSVVVFDTATLRLLNFPTIVERGLGRLMQIKNQIS............................................................................................. 162
35 -9.040PF02572.13; R5BPN3_9FIRM/40-219; ATP:corrinoid adenosyltransferase BtuR/CobO/CobP  ali follow..  15  2..............................RGLILVNTGD-GKGKTTASLGVALRAVGNGYRVLILQF-EALQKAGMPIEIRPMGKGFVFHNKETS------ADLQAHRAAADNAWQMLTEEVMSDKWDLIIFDEINYAVKFGLLPVEQVVDLLKT--KPERLHVVLTGRDAKPE------------IVAMADTVTEMRVVK..................................................... 165

FFAS is supported by the NIH grant R01-GM087218-01
1 1 3 7 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Lesley SA, Kuhn P, Godzik A., Deacon AM, Mathews I, Kreusch A, Spraggon G, Klock HE, McMullan D, Shin T, Vincent J, Robb A, Brinen LS, Miller MD, McPhillips TM, Miller MA, Scheibe D, Canaves JM, Guda C, Jaroszewski L, Selby TL, Elsliger MA, Wooley J, Taylor SS, Hodgson KO, Wilson IA, Schultz PG, Stevens RC. Structural genomics of the Thermotoga maritima proteome implemented in a high-throughput structure determination pipeline. Proc Natl Acad Sci U S A. 2002 Sep 3;99(18):11664-9. Epub 2002 Aug 22.