current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: PF06476.10; Q4K4I5_PSEF5/15-124; Protein of unknown function (DUF1090 topsan), from PfamA30U

Results of FFAS03 search in PfamA30U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110
# Score Template Links and tools%idFirst LMSAPLLAAEQAPELTGCAAKRQAIMNQIEQAKAHGNSNQQAGLERALSEVTAHCTDASLKKERENKVLEAKHEVSRRQADLEKAMKKGDSEKINKRKDKLAESRKELQQLast
1 -53.100PF06476.10; Q4K4I5_PSEF5/15-124; Protein of unknown function (DUF1090 topsan)  ali  100  1LMSAPLLAAEQAPELTGCAAKRQAIMNQIEQAKAHGNSNQQAGLERALSEVTAHCTDASLKKERENKVLEAKHEVSRRQADLEKAMKKGDSEKINKRKDKLAESRKELQQ 110
2 -8.810PF04420.12; GET1_EMENI/6-166; CHD5-like protein  ali follow..  14  37.............................................................YQTAQEQTKLKREVVQLKRDMNNTSSQDEFAKWAKLRRRHDKALSEYEA 85
3 -8.790PF15290.4; M3ZY07_XIPMA/184-491; Golgi-localised syntaxin-1-binding clamp  ali follow..  10  72..................EVAIRHLKTKLMESENK--ENEIQEFKSQLCRMREDWIEEE-RVEAQLSLKEARKEIRQLRQVVETMKNS-KDKGIQKYFIDINIQNRKLES 168
4 -8.780PF16785.3; Q2Y713_NITMU/1-110; Small metal-binding protein  ali follow..  12  10IGVLGVLLAPPAIADHHAAQAIEHAAMAKAHGEDGHAKVLLKHAEESLTHAQA----------AEKQHAEQHKHMTDSIKELKQAIEHAKAGHADVATKHVDEALMHMRK 109
5 -8.740PF12761.5; T0KEV9_COLGC/191-387; Actin cytoskeleton-regulatory complex protein END3  ali follow..  16  109..................DEKMARIEAGVEQKKGGKRDSKPALVKRELEQLLDYKRKELRELEEGSGKAKGGASLKSVSEDLQTVRE-----QVEGLESHLSSRQQVLEQ 195
6 -8.600PF17060.3; MPS2_ZYGRC/12-339; Monopolar spindle protein 2  ali follow..  147..................DRELIQLTRKLSDYKD-----KYEFVQRQFSFYKDHGESPRRNSSESEQLNLEQNASTKHEFIISELKR-----KLQEQTLAISNLKEQLQR 228
7 -8.500PF09424.8; Q7MP01_VIBVY/4-146; Yqey-like protein  ali follow..  11  2......................EQLKEEQKLAMKAKDKQRLGTIRLALSAIKQREVDEQITLNDDDILAVLTKMVKQRRDSVTQFEAAGRQDLADAEKAEITVLEEFMPQ 89
8 -8.370PF05266.12; D7M2D2_ARALL/378-551; Protein of unknown function (DUF724 topsan)  ali follow..  16  50....................TFSCLLEQVKALQHDENISSFISLSNSFTELETHGFNVQVAQLRINKLLTLRGMQSKKLDELNGAKKV--ESVKAENERKILELQRLNEE 141
9 -7.800PF04778.10; D1J7J0_MYCHP/834-990; LMP repeated region  ali follow..  12  4..............................................................TLSAKLTDKDNTIQQAKTELEKEVQKANQAIKSNNTASMQSAKSSLDA 51
10 -7.790PF04111.10; W1QBV0_OGAPD/127-441; Autophagy protein Apg6  ali follow..  13  3.................CSTLIDELKQQFEQMTKEKDTQFLKKLTAQSGPNRKK------AQDSLSELALLKEEETKLLEELEKAEKEEEQQQLVEVEQELEDLENQEKE 97

FFAS is supported by the NIH grant R01-GM087218-01
1 1 6 5 6 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Jaroszewski L, Rychlewski L, Zhang B, Godzik A. Fold prediction by a hierarchy of sequence, threading, and modeling methods. Protein Sci. 1998 Jun;7(6):1431-40.