current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: PF04665.10; Q6TUP8_YMTV5/6-246; Poxvirus A32 protein, from PfamA30U

Results of FFAS03 search in PfamA30U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240
# Score Template Links and tools%idFirst EKHFYRKSLLKHPFRIALVGGSGSGKTAYLLSLFNTFVEKYRHIFLFTPVYNSEYDSYIWPDHVNRVTTYEELDYSLITTKQKIEKYVKKQGNDKTTEMFLLILDDMGDKQIRSSCLLDFLNHGRHLNTSIILLCQTYKHVPVNGRTSITHFCCCNVSDSDIENMLRSMSITGSKKDLLKSVSLMRSVSVNKRRVIIIEDSVFSEGEQRVCYDTADDDVIKNNVNFSILLKQFSHMKKQLPLast
1 -88.700PF04665.10; Q6TUP8_YMTV5/6-246; Poxvirus A32 protein  ali  100  1EKHFYRKSLLKHPFRIALVGGSGSGKTAYLLSLFNTFVEKYRHIFLFTPVYNSEYDSYIWPDHVNRVTTYEELDYSLITTKQKIEKYVKKQGNDKTTEMFLLILDDMGDKQIRSSCLLDFLNHGRHLNTSIILLCQTYKHVPVNGRTSITHFCCCNVSDSDIENMLRSMSITGSKKDLLKSVSLMRSVSVNKRRVIIIEDSVFSEGEQRVCYDTADDDVIKNNVNFSILLKQFSHMKKQLP 241
2 -20.300PF01580.16; SFTA_BACSU/595-787; FtsK/SpoIIIE family  ali follow..  12  35.........LKKMPHGLIAGATGSGKSVCINTILVSLLSEVKVLLIDPKMVELAPYNKIPHLVSPVITDAKAATAALKWVVEEMERRTAEHQMGEKLPYLVVIIDELADLMMVEESIARIAQKARACGIHLLVATQRPS...................................................................................................... 192
3 -19.300PF01637.16; A8M939_CALMQ/15-228; ATPase domain predominantly from Archaea  ali follow..  3DREVAIRQIEKLAEKVVIYGPEGCGKSAFLKQAVEVLGEYDYSVVKVSPLEDESNEKLRYSEELRGLTRIPTPFNDASALIDIAISLLYDVVRRRIRRKIALLADDVKAELLVKRLLNMIEYSSVDYERIVVIVATSEGVTWGRIGRHAEIMAMWNMPREGFGKLYNALPGPKPPFEEV.............................................................. 200
4 -18.000PF03266.13; NTPTH_METAC/3-167; NTPase  ali follow..  10  1..............RIAVTGSPGVGKSTVVAKTAEKLAEKPGFKIGGIRTAEIRKEGHREGFSIRDLATGKTGILSHVKGSGDDLERIGANAVRNALACDLVVIDEIGPMELISQSFVSAVEEVLESDKPVLAVLHHSSRLAQRFRKGFEVLTVDKGNRDELPEKI........................................................................... 164
5 -17.800PF05707.10; Q79YX7_VIBPA/2-255; Zonular occludens toxin (Zot)  ali follow..  11  4................FRYGHGGSYKSAAVWFDLLPALREGRICITIHGMQPLEVIEQRLGEKFPDTARLIRISSRNPEGFELWKYFFCWAPIGA-----FILIDECQQRIIYPENFNNAFMEHRHYNWDIVLLTPDFAQIPKELKGVAELAKQHKGKDG................................................................................. 206
6 -16.700PF12846.5; Q833R2_ENTFA/443-804; AAA-like domain  ali follow..  10  19..........TNALAAAFLGSLGGGKSFSNNLLVYYAVLFGGQAVIVDPKGEKAIRTVTQSDQRGLLQVINELRKENSPVAENIADHIESFTDSNREIFKIVDLDEFLQVAQGKTLSNKLVRAGRAMNAGVYFVTQNSDDLDERLKNNIGLKFAFRSTDIHEIKKTLEFFGLDQEDESNQKR-----RDLENGQCLMQD.......................................... 341
7 -15.900PF01443.16; RDRP_TMV/829-1085; Viral (Superfamily 1) RNA helicase  ali follow..  13  1...............VLVDGVPGCGKTKEILSRVNF-----DEDLILVPGKQA-------AEMIRRRANSSGIIVATKDNVKTVDSFMMNFGKSTRCQFKRLFIDEGL--MLHTGCVNFLVAMSLCEIAYVY............................................................................................................. 103
8 -15.600PF06414.10; Q8P580_XANCP/35-230; Zeta toxin  ali follow..  14  2DAALETKTSFEHPKAIILAGQPGSGKGSLARAADVELGRDVVLI-------DPDELRNAHPEVSALRNAHPYTWSGYTH--SDASQWADELLQVTIEGKKNLIFDTLSNGQWSAELIKDLQSRGYDVEVRAMAAHKLESEHGVDSR............................................................................................... 139
9 -15.300PF06745.11; O29463_ARCFU/20-274; KaiC  ali follow..  11  35...............MNITGVPDTGKSLLAEQFAITQAGSGYRVLYVTVESPADFTKVESNVVVIDASESDELRENPKALMETMAYAIKEKKVTN------TIIDSITKEMMARQIVRQFFNFMKKYRQTGIFVSQKRSAQASESAEAAGGLAVAHIVD.................................................................................. 193
10 -15.000PF05621.9; S6B007_9PROT/25-277; Bacterial TniB protein  ali follow..  13  33..........VRPQGRLVVGRSLMGKSTLFDEFLRRHPADDDGIPIVSVQYPDTAKEGIYPEILASLNARIPANTKAPELRRATVELLRQVGMR------VLLIDEIGSANSQRKGLNSIKYLMNELHRPVITAALNAIRTDEQISSRLTPLPLVRFKDDD................................................................................ 190
11 -14.900PF07652.12; Q32ZD8_9FLAV/1675-1822; Flavivirus DEAD domain  ali follow..  13  1.........FKKKQLIVLDPHPGAGKTRVLPEFIRQAVERRLWTLALAPTR-AEALNGLPVRYLTPAVIQQHTGKEIVDLMCHATFTMRLLSGGRVPNYNMFIMDEAHFTDPSSIAARGYISTVDMGEASAVFMTATP....................................................................................................... 136
12 -14.800PF07088.9; GVPD1_HALSA/23-536; GvpD gas vesicle protein  ali follow..  12  13...............LLINGAPGTGKTLFTIRGLDVLDRDSDVLYVSTRVDQETVHEMYILDLFQDPFELPLDVDVPFEKLDLDSLLEWIQEINAATTQLTIAFDSWEDPPDIKTVTNQLAVLAREENIRLMLVTETAA--PSSLEYIVDGVVTLQVKEDDRGRTRRDL........................................................................ 186
13 -14.700PF13401.4; B2UJB3_RALPJ/42-210; AAA domain  ali follow..  10  2..........SQESILLVCGPTGAGKTTLAKFMVENAHSQSHAVQAPASGETKFSWRLFYQRILNQLGDDLDSPKVAYGVDSLSGRLVRPRGTSGNSLAAFMVIDEAQRNSKLEVQLDTLKSLVNECGTQIVLV........................................................................................................... 160
14 -14.200PF00910.20; A7M6L1_9SECO/473-576; RNA helicase  ali follow..  14  1...............VYAYGESRTGKTLVVDKLITDFQNHFGL--VYSRNPIDQYWSGY-------------------------------------RRQPIVSIDDFGAVTCDPSMEAQMIPKGMMFDSKFIFCSSNL....................................................................................................... 104
15 -13.500PF07728.12; Q82S33_NITEU/475-632; AAA domain (dynein-related subfamily)  ali follow..  10  1..............NLILQGPPGTGKTWLAKRLAFALMGQKDDSKVRAVQFHPNL------SYEDFVRGWRPTGEGKLSLADGVFMEAIKAASKDPSSKFVVVIEEI-NRGNPAQIFGELLTRTPNEALELCYPDADGKRRPVHIPENLYVVGTMNIADRSLALV............................................................................ 150
16 -13.400PF13479.4; F5YIK8_TREPZ/11-202; AAA domain  ali follow..  13  3.............LRCALFGPSGSGKTMTALRMAKGIADTMGVPFAVIDTEARSASKYADRIPFDVDDLDGKTVDHYIAAMNECVKAGYK----------VLVIDSLSHAWRELTDEVDRIAQSSVSKNTF-VNPKQKRFIDAILNFPGHIIATMRSKTE................................................................................. 143
17 -13.300PF05729.10; G3V6C0_RAT/441-610; NACHT domain  ali follow..  11  2...............VAVLGKAGQGKSHWARTVSHIWAQQYDFVFYVPCQCLDRPGDTYHLRDLLCPPNLQPLAMDDEVIDHIVRQ-----------DRVLLILDAFPEPCSLRGLLAGLFQRKLLRGCTLLLTARPRGRLAQSLSKADAIFEVPSFSTKQAQIYMRHYF....................................................................... 168
18 -13.200PF13671.4; B2JHT3_BURP8/20-178; AAA domain  ali follow..  12  2...............VFICGHAGTGKTTLAKRLIGPLMKA-EACCLLDKDTLYGVYSAAAIGALTGDPNDRDSPLFLQHFRDPEYRGLFDTAAENLRLGIGVIAVGPLSREVRERRLFDHVWLGVPKDAKISVV--WVSTSEETARERIA........................................................................................... 135
19 -13.200PF13604.4; Q3L956_RHOE4/579-769; AAA domain  ali follow..  15  5DQIAMIEHFLTAKTKVVAVGAAGAGKTTAAKVVARAWEQTNGKVIALGPSAKA-------------ADVLGAEIDVEGRTIADILTRDQHGLATGIEKGDLLLVDEAG--MASARNLADLTRIATQSGAVVRLL........................................................................................................... 124
20 -13.100PF08303.9; Q6CK12_KLULA/389-554; tRNA ligase kinase domain  ali follow..  14  2...............LVTIATIGCGKSTVSLTLNELFPESWGLV------------------------VNDNITSNKTDYIKSALQLFKDGKQ-------FVLADKNNHQFRERAAVFEWINQYRNCNLQVIALCFVDEVSPEMRALTIDRVMKRGDNHQSIK.............................................................................. 124
21 -12.900PF13481.4; B2JV40_BURP8/220-401; AAA domain  ali follow..  18IIDDLVDDVIPAHAVGAVWGASAAAKSFLVLDLAAALTEEPVPVLLVSLEGNNGLPRRYLAWEKHNGRPVPARLHTLTQGFSLLDDDLCEAIETCGITGGVVFIDEENSSADMGRAGAALNTLRERTGCTVIAVHHT........................................................................................................ 177
22 -12.800PF07931.10; Q98FG2_RHILO/59-238; Chloramphenicol phosphotransferase-like protein  ali follow..  11  4...............VLLNGVGSAGKSSIARALQTITAAPFLHVFLEMLPDALQDHADGFSYETVRQDGKPAVVIRAGPVGERTLRGMRHAIAAMAGQGNDLIVDDVLCNGELSDCVDLL----SAFDFHLVGVMAPLEVLEAREARRAD........................................................................................... 138
23 -12.700PF01695.15; Y4IQ_RHISN/60-238; IstB-like ATP binding protein  ali follow..  16  40....AGDSWLAKGANILLFGPPGGGKSHLAAAIGLALIENGWRVLFTRTT------------------------DLVQKLQVARRELQLESAIAKLDKFDLLILDDLAYVTKDQAETSVLFESARYERRSIMITANQPFG..................................................................................................... 153
24 -12.500PF02456.13; PKG1_ADEG1/61-425; Adenovirus IVa2 protein  ali follow..  12  72HGQLPSINMGKQPIIGVIYGPTGSGKSHLLRALISCLDPIPETVIFITPEKNMIPPIEQTTSTFRPEFMEMTYEEATAPEHLNIDHPDNIYVKVSKRGPVAIIMDECMDKLCSGSSVSVLFRSAHCTAFYIFVVLHNMAPRTPTLKVNAKMHILSCHIPQFQFARFLYAFAHNISKDLVVLLKAYFSQQNQRFSWVMYTPDPVSESFRWCSIDQQYSIIPLNVNIQERFLKTAKSIIK... 349
25 -12.500PF08433.8; O46079_DROME/1-293; Chromatin associated protein KTI12  ali follow..  12  4...............VVITGLPASGKSTRARQLRDHFVERGRKVHLISEN-----------EAVPKAGFGKNSHTGDSQKEKVVRSDLKSEASRHLNQEDLVILDAGNYIKGYR---YELYCMSKVSRTTQCTVCQRYEEPQSNNRWDSPLVVVLPKDTLDMEAIYKALYESQPLPPNQSTYNAPLGTTNYLFEL-IIKEILGAVKIKAFGQLRIPGSRNPVKVATSMNALQLNRLRQKF. 266
26 -12.200PF10412.7; A4XE63_NOVAD/225-611; Type IV secretion-system coupling protein DNA-binding domain  ali follow..  10  17..............HTIMIGSTGTGKTTQMRDMIAQMRVRQDRAVVFDLTGALEEVHELLRNTIAEPLTAPVAARMAESVRAVLNTNAQARLPRTRSLRTWFFFDEV-HALHRLPAIEDGLQTARGFGGAFVLGIHSFAKLAQNLASLARTKLILAAADRDTAEHCSDYIGHREVRMMDEAYSYGYSNIRDAATI.............................................. 348
27 -12.100PF13245.4; B1YJE6_EXIS2/332-475; AAA domain  ali follow..  18  14...............MVLTGGPGTGKTTVIKGILHALQEIHDWPLEKSQVKSGEVYPYVLVRAAKRLSEATDVPAMTIHRLLKYDGTNFQLDEDQPIAGKVLIIDESS---MIDIYLLSSLLRAVPNGMKILFV........................................................................................................... 133
28 -11.900PF09439.8; SRPB_YEAST/36-221; Signal recognition particle receptor beta subunit  ali follow..  15  1..........SYQPSIIIAGPQNSGKTSLLTLLTTDSVRP----TVVSQEPLSAADYDGSGVTLVDFPGHVKLRYKLSDYLKTRAKFVKG---------LIFMVDSTVDPKKLTTTAEFLVESSCENGIDILIACNKPSKIKDALESEIQKV......................................................................................... 143
29 -11.700PF05894.10; B3VMQ2_BPPH2/1-331; Podovirus DNA encapsidation protein (Gp16)  ali follow..  4SLFYNPQKMLSYDRILFVIGARGIGKSYAMKVINRFIKYGEQFIYVRRYKPELAKVSNYFNDVAQEFPDHELVVKGRRFYIDGKLSVWQSEKSNAYPNVSTIVFDEFIREKDNSNYIPNMDTVFRNRERVRCICLSNAVSVVNPYFLFFNLVPDVNKRFNVYDDALIEIPDSLDFSSERRKTRFGRLIDGTEYGEMSLDNQFIGDSQVFI............................... 231
30 -11.500PF12775.5; DYH17_HUMAN/2402-2673; P-loop containing dynein motor region D3  ali follow..  23..RYFMDLLMEKSWPVMLVGNAGTGKSVLMGDKLESLNTDNYLVQAVP------------------FNFYTTSAMLQGVLEKPLEKKSGRNYGPPGTKKLVYFIDDMNMPEVDKTLIRQHMDHRHWYDVACMNPTSGSFTIDSRLQRHFCVFAVSFPGQEALTTIYNTI........................................................................ 192
31 -11.400PF01935.15; A3DEJ1_CLOTH/136-414; Domain of unknown function DUF87 topsan  ali follow..  16  19..YLDVNKLVTE--HLAVLAMTGSGKSYTVGRIIERLVAEMNTVVVFDVHGE............................................................................................................................................................................................. 67
32 -11.400PF13521.4; A4CIV1_ROBBH/14-173; AAA domain  ali follow..  10  1..............KVVLFGPESTGKTTLARELARHY--------------GEPWVPEYAREYLQEKWDRVQQTCAPEDLLPIARGQMRLENIGAREASRLLICDDLLETKVYSETY-QAAALANDYDLYFLTDID----EADDLRDK............................................................................................. 128
33 -11.100PF16575.3; G0MKR2_CAEBE/121-307; mRNA cleavage and polyadenylation factor CLP1 P-loop  ali follow..  1...................GPADVGKSTVSRIICNYSVRQGRTPLFVDLDVGQNNIS-----NFGHTNPSANLSLYETLFKELASTINQQILVNDEAKIGGMIINTCG-DGEGYKCLVKAASAFEVDVVIVLDHERLYSDLSKELPEFVRLTHVPKSGGVEQRT............................................................................. 169
34 -10.900PF04310.10; MUKB_ECOLI/2-227; MukB N-terminal  ali follow..  13  15.NGFFARTFDLDELVTTLSGGNGAGKSTTMAAFVTALIPDLTLLHFRNTTEAGA........................................................................................................................................................................................... 67
35 -10.800PF09848.7; A1A222_BIFAA/236-699; Uncharacterized conserved protein (DUF2075 topsan)  ali follow..  12  4...............IFVQGVAGTGKTVLLSHLFYRIATEMDIILVNHNQQMHVYNQIASKLGLQKHFGEVALKSQFINRFSEKTTSNRAIADKPRGKADVVLVDEADQGYSGKNMLHDLLRRAK---VVIAVFDPNQILQTSQRWSEEDQDMLFPQQAES................................................................................ 184
36 -10.700PF10649.7; H0PT62_9RHOO/9-167; Protein of unknown function (DUF2478 topsan)  ali follow..  2...............AAIVYRPTDHIEPVLEQAAQRLAERGVRLGGILQHDLPTCIEDPCGMELEDLASGERFALSQEL-PNALAHAAVAIRRALESGVELVFVNKFGAQEASGSGLRSEMAMAVSSGTPVITAVGE........................................................................................................ 132
37 -10.700PF00004.27; LON_BRECH/351-493; ATPase family associated with various cellular activities (AAA)  ali follow..  12  1...............LCLVGPPGVGKTSLARSVARALGREFVRISLGGVRDEAEIRTYVGALPGRIIQGMKQAGTINPVFLLDEIDKLASDFRGDPASALLEVLDPNQNDKFSDHYIEETYDLTN---VMFITTANSLDTIPRPLLDRMEVISI....................................................................................... 140
38 -10.600PF05673.11; Q0K6N5_CUPNH/29-287; Protein of unknown function (DUF815 topsan)  ali follow..  19  60..............NVLLTGARGTGKSSLIKACLNAFVRDGLRLV--------------------------EVDKDDLGDLGDIVELVAQRPE-----RFVIFCDDLSFEEGESKSLKSALVAAQSDNVLIYATSNRRHLLPEYMKDNETY.......................................................................................... 170
39 -10.600PF14532.4; C6X8G9_METGS/136-273; Sigma-54 interaction domain  ali follow..  11  9ELRQRLEQIAGVKSPLLLIGEQGSGAELCAKFL-------------------------------------HNPDTPWLSLTDYEQLATAPLDILEQVQEGMLFIPEVADSKNQQKGLQLLLARADKYGARVVCVTAK--SLPQLVVAG............................................................................................. 118
40 -10.600PF13238.4; Q5ZL96_CHICK/5-160; AAA domain  ali follow..  11  1...............IGIGGVTNGGKTTLTRRLM----QALPNCSVVHQDD-SALDMEAMMSTINAWIKNPVKFERSHGINNTLDAQISPDREGRDEAVHILIVEGFL--LYTYRPLIDVF------HHRYFLSIPYEECKRRRSSRNYT........................................................................................... 142
41 -10.500PF07015.9; Q1M9M0_RHIL3/1-231; VirC1 protein  ali follow..  12  4...............VTCCSFKGAGKTTALMGLCSALAADGKTIALFEADENRPLSKWKENAT----RRNAWDPLCEIFITDELPLLEVAYEEAAGRGFDYCLVEELNNTVIASSNLLLIPTMLTPLDADEALTFRYIIELLIGENLAIPAAILRQRVPANRL.............................................................................. 155
42 -10.400PF03215.13; RAD24_YEAST/58-575; Rad17 cell cycle checkpoint protein  ali follow..  11  48...............LLLSGPSGCSKSTVIKELSKIL-----VPKYRQNSNGTSFRSTPNEHKVTEFRGDCIVND--LPQMESFSEFLKGARYLVMSNLSLILIEDLDTRRRFQQLILQWLYSSEPLLPPLVICITE........................................................................................................ 168
43 -10.400PF03029.15; O01426_CAEEL/6-251; Conserved hypothetical ATP binding protein  ali follow..  12  1.................VIGAPGAGKSTFCAGLTDIFSQTKRPFLTINLDPANDTMAYAPDVNITEMITVNDVMDRLKYCIETLGANCN-LQKIEANHKKYLIIDELYKSEGELWKVIRFLEK-RLCALHLAFISVALSTLATMVTMEMPQVNCLSKAD.................................................................................. 168
44 -10.200PF02399.13; OBP_VZVD/13-828; Origin of replication binding protein  ali follow..  12  36PVKLIKPGMSQTRPVTVVRAPMGSGKTTALLEWLQHALKADISVLVVSCRRSQTLIQRFNDAGLSGFVTYLTSETYIMGFKRLI-ESLHRVSSEAIDSYDVLILDEVRRLSAVDSLLYRLLNRCSQIIAMDATVNSQFIDLISGLRGDENIHTIVCT.................................................................................... 208
45 -9.990PF01926.21; DER_CHLCV/3-119; 50S ribosome-binding GTPase  ali follow..  12  1..............RIAILGRPNVGKSSLFNRMCKRSLAIVNSQ---EGTTRDRLYGEIRGWSVPVQVIDTGGVDKDSEDHFQKHIYKQALAGANEADILLLVVDIRCGITEQDAELAKMLLPLNKPLILVA............................................................................................................. 115
46 -9.990PF02223.15; KTHY_BACSU/8-199; Thymidylate kinase  ali follow..  1.................FEGPEGAGKTTVLQEIKNILTAEGLQVMATREPGGIDIAEQIREVILNENNILMDPKTEALLYAAARRQHLVEKVKPALEQGFIVLCDRFIDSSLAYQSINEFAIGDMMPHVTVYFSIDPEEGLKRIYANGSREKNRLDLEKLDFHTKVQE......................................................................... 163
47 -9.930PF04670.10; Q9VHJ4_DROME/4-230; Gtr1/RagA G protein conserved region  ali follow..  13  1..............KVLLMGKSGSGKTSMRSIIFANYIARDTTRLGATIDVEHSHVRFLGNLVLNLWDCGGQEGFMKQYFAQQRDNIFRNVEV------LIYVFD--VESQEIERDIHYYQSCLEALEAKIFCLVHKMDLVPEGLRESVFTERMEDLIKLSKPGNVTCFRTSIWDETLYKAWSSIVTMLIPNVAAL............................................. 179
48 -9.810PF13173.4; F9Z5R0_ODOSD/18-152; AAA domain  ali follow..  18  4...............LILNGARQVGKTWLLHEF----KLEYKKEAYVVCRKNNLARQLFSQD---------------FNVDRILRGLRAMTSVDITPGDTLIILDEIQDIPEALESLKYFKEEVPEYHI................................................................................................................ 99
49 -9.800PF00931.20; LOV1A_ARATH/43-337; NB-ARC domain  ali follow..  13  21...............VSISGMGGIGKTTLARQVVQRHFDGFAWVFVSQQFTQKHVWQRIWQELQPQNGDISHMDE---------HILQGKLFKLLETGRYLVVLDDVWKEED--DRIKAVFPRKRGWK---MLLTSRNEGVGIHADPKSFGFKTRILTPEESWKLCEK......................................................................... 165
50 -9.640PF06431.9; Q8JUD5_POVJC/266-682; Polyomavirus large T antigen C-terminus  ali follow..  13  158...............WLFKGPIDSGKTTLAAALLDLCGGKSLNVNMPLERSNFELGVGI--------------------------------------DQFMVVFEDIKGTGAESRNLDCLYLDGKHQNFPPGIVTMNEYSVPRTLQARFVRQIDFRPKAYLRKSL............................................................................ 293
51 -9.490PF00437.18; A6T4U8_KLEP7/120-386; Type II/IV secretion system protein  ali follow..  13  132...............ILVTGPTGSGKSTTLYAALSRLDARERNIMTIEDPVEYEL------EGIGQTQVNAKVEMTFARGLRAILRQDPD----------VVLVGEIRDGETAQIAVQASLT---HLVLSTLHTNSALGAISRLQDMGVEPFLLSTSLLAVMSQRL........................................................................... 264
52 -9.390PF13555.4; Q0A6A1_ALKEH/19-80; P-loop containing region of AAA domain  ali follow..  28  27................LLTGDIGSGKSTLVDAITTLL............................................................................................................................................................................................................ 47
53 -9.340PF00485.16; KPPR_SYNY3/10-192; Phosphoribulokinase / Uridine kinase family  ali follow..  10  2...............IGVAGDSGCGKSTFLRRLTDLFGEEFMTVICLDDYHSLDRQGRKAAGVTALDPRANNFDLMYEQIKTLKSGQSLLDPPEKVEPNKVVVIEGLH--PLYDERVRELV------DFGVYLDISEEVKINWKIQRDM------AERGHTYEDILASINARKPDFTAY.............................................................. 162
54 -9.290PF00265.16; KITH_MYXVL/6-176; Thymidine kinase  ali follow..  11  5................LIIGPMFAGKSTELIRLVKRYQIARYKCLVVKYEKDARYGNGVRTH------DNTCISAVPTASLDDVESISEHVE--------VIGIDEGQFFPNIVSFCERMANAGKVLIVAAL............................................................................................................. 106
55 -9.220PF13476.4; Q6C910_YARLI/6-233; AAA domain  ali follow..  11  8.RSFDNTERETITFNTLIVGQNGSGKTTIIECLRYATTGDLPPHSKGGAFIHDPKICGEKEVLGQVKLAFTNVNGIQMICTRTMQVLVKKNTRQFKTLEGQLMASNNGERTTVSTRCAELLGVSKSILDYVIFCHQEESLWPLS-------------EPAVLKKRFDEIFEALKFTKALDSIKSLRKEKNVEIKLQTQTTEYLKADKDRADKAAEKANLLLERIE................ 228
56 -9.180PF00308.16; DNAA_STRCO/317-535; Bacterial dnaA protein  ali follow..  16  37...............LFIYGESGLGKTHLLHAIGHYARSLYPGTRVRYVSSEE-----------------------TNEFINSIRDGKGDSFRKRYREMDILLVDDLADKESTQEEFFHTFNTLHNANKQIVLSSKQLVTLEDRLRNRFEWGLITDVQPPELETRI........................................................................... 172
57 -9.080PF10236.7; Q755C9_ASHGO/113-434; Mitochondrial ribosomal death-associated protein 3  ali follow..  13  17..........TEHQRVILTGQPGVGKSTLLAQAQVAAFEK-GSVIINISHPELFLNG---RNDFRHDTTGEQEQYTQPMYLKKLLTKILKSNKKSVLSSVALTQERVTRLVPGKNTLYDLLSMKTTPA----ARGMLFQAVIDELVAQSAVPVYLTVDNFS................................................................................ 173
58 -9.030PF04275.12; F8W4R0_DANRE/22-132; Phosphomevalonate kinase  ali follow..  12  1.................FSGKRKSGKDYVTDLIQKRLTAEICCILRLSAPLKEQYAKDHYEELMGSGQYKESYRADMIHWGEMKRQEDSGRLAIKHATQPVWIISDC...................................................................................................................................... 96

FFAS is supported by the NIH grant R01-GM087218-01
1 1 6 6 5 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Godzik A. VISSA: a program to visualize structural features from structure sequence alignment. Bioinformatics. 2006 Apr 1;22(7):887-8. Epub 2006 Jan 24.