current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: PF04077.10; B3PET8_CELJU/9-96; DsrH like protein, from PfamA30U

Results of FFAS03 search in PfamA30U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .
3 -5.550PF14993.4; NPS_MOUSE/24-88; Neuropeptide S precursor protein  ali follow..  16  7.............KVPGKPDYFLILLSSCPARLEGSDRLAFLKPI---------LEKTSMKRSFRNGVGSGAKKTSF........... 61
4 -5.460PF00271.29; Q9ZCQ0_RICPR/221-329; Helicase conserved C-terminal domain  ali follow..  12  39.......................HKAEAIHGDLSQSQRERVILSFRKLNHRI-MVATDVAARGLDIPHTQHVINYDLPMCPE...... 96
5 -5.410PF09710.8; Q73QM8_TREDE/4-414; Treponema clustered lipoprotein (Trep_dent_lipo)  ali follow..  13  130....KDGEFCYCKYKAPTQNGGILDYQVTYKWYNIEQMYLPLSYDLLSETNMVKINDELIENQVHGSLYGMENDEKKDEMIKLFEDYE 213
6 -5.380PF01497.16; D9QEM0_CORP2/95-325; Periplasmic binding protein  ali follow..  43.................NVEAVLNLRPSLVIVDHSIGPRDAIDQIRAAGVTTVVMEPTRTIDSVSEDIKNLGGVVGLND......... 104
7 -5.290PF15610.4; C7PNW9_CHIPD/2-265; PRTase ComF-like  ali follow..  10  135.................AGKTLIFTDDIRITGSHELIIRNLLKKFGLSNDAYYLYYAQLQNQDIHPNIENKLNYYSVHSLQSLEA... 202
8 -5.180PF00573.20; RL4_DESPS/21-208; Ribosomal protein L4/L1 family  ali follow..  16  93.......AVSMALSARFQEGNLIVLDNFIMDAIKTKEFASTMKTLELANALIVMDDASKSCRNVHGYRILPAEGLNVYDILL...... 171
9 -5.160PF11899.6; D5SMH6_PLAL2/6-396; Protein of unknown function (DUF3419 topsan)  ali follow..  16  20...WEDPRLDRVALELTSNDRVVVITSA-----------NALDYALAGAGHVHAVDMNLRQNALLELKQAGIRKLDYEDFFQI..... 90

FFAS is supported by the NIH grant R01-GM087218-01
1 1 1 6 2 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Damiano JS, Stehlik C, Pio F, Godzik A., Reed JC. CLAN, a novel human CED-4-like gene. Genomics. 2001 Jul;75(1-3):77-83.