current user: public

anford Burnham Prebys Medical Discovery Institute
Please be advised that due to the planned maintenance our websites might be temporarily unavailable on December 17-18, 2018. We apologise for the inconvenience that this may cause.

Query: PF02253.13; M1FBT8_9ALTE/121-381; Phospholipase A1, from PfamA30U

Results of FFAS03 search in PfamA30U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260
# Score Template Links and tools%idFirst LDRYLEAEEALFSFSGSFIRHRPNYILPVTWSDHPNQAPTSPRLGVTGYDYDLKQEEAKYQISFKVPLFTGLMDKRTTLWFGYTQKSFWQLYNQDESAPFRETNYEPELFLRYQPDWNIGPGRLDTLYVGINHQSNGQAEPRSRSWNRIVGMGTYTYKRWLFMVKPWIRLPEGSTDDNNDIESYLGHGSYHAVYKLTEDRTFSLKLLNNLRISDNRTSVEFGYSFPIGEAIKGFVHYYNGYGESLIDYNERIQRVGVGIMLLast
1 -119.000PF02253.13; M1FBT8_9ALTE/121-381; Phospholipase A1  ali  100  1LDRYLEAEEALFSFSGSFIRHRPNYILPVTWSDHPNQAPTSPRLGVTGYDYDLKQEEAKYQISFKVPLFTGLMDKRTTLWFGYTQKSFWQLYNQDESAPFRETNYEPELFLRYQPDWNIGPGRLDTLYVGINHQSNGQAEPRSRSWNRIVGMGTYTYKRWLFMVKPWIRLPEGSTDDNNDIESYLGHGSYHAVYKLTEDRTFSLKLLNNLRISDNRTSVEFGYSFPIGEAIKGFVHYYNGYGESLIDYNERIQRVGVGIML 261
2 -7.220PF06727.9; G4SX63_META2/42-373; Protein of unknown function (DUF1207 topsan)  ali follow..  15  79......................PSGHLFKPLLADPRWAHFSAAYRNYQNDNFDGKDIGSVSFGETIPFYRNFGETSAQWETGIQASVFSDFNLGAESTDLVNTDFIASLYSSMRVG---------SAFGRIYHQSSHLGDRVNLSYEGVDLRLSYEPFGVRIYGGGGGLFHREPDDLKIWSAQY-WRMEFADMRPIIAVDLKNFEENKWNTDVSARAGVEFENLQVLGRKLQLLVEYFNGYSPSGQFYNDKVEYVGIGAHY 330
3 -6.920PF13474.4; Q12PU2_SHEDO/77-185; SnoaL-like domain  ali follow..  12  4LLNQLHESAMSADWDTYFDLYHPDAAFIGTDATERWNMVHFRRYASPTQGWRYDLQARHLLQIEDVVVFDEQLYSPEYGISRGTTTKGWKIAQYHLSFPI................................................................................................................................................................. 108
4 -6.610PF07080.9; G0A5W1_METMM/8-137; Protein of unknown function (DUF1348 topsan)  ali follow..  14  11................................................................KVRMAEDAWNSRDRVVQVYTENTIWRPVGRKQVHAFLQRKWAKEL--DYRLIKELWATTGNRIAVRFAYEWRDDAG----DWFRSYGNENWEFNEFGLMQRRYASIND......................................................................................... 119
5 -6.440PF05634.9; I1MQ97_SOYBN/64-263; APO RNA-binding  ali follow..  11.....................LPQNEDLPPILPKNKKKPYPIPFKEIKQAGREDRKLAHMGIEKPLEPPKNGLLVPDLVPVAYEVFDAWKLLIEGLAQPAHGCSECSEVHV------AQTGHHIRDCSGTNGRQRRSS-----HAWVKGSV------NDILVPIESYHLFDPFGRRIKHDTRFEYDRIPAVV..................................................................... 169
6 -6.440PF07143.9; Q89VP5_BRADU/62-235; CrtC N-terminal lipocalin domain  ali follow..  13  2......................................................................................EWWYLTANIVDSSGAACGLQWTLFQAAQPGPQGEGWANQQIWMAHAAVTRADTHRFSELFSR-IGQAGVEAKPFTAWIDDWEMKGLERTDDRTLAPLTLKASGTNFSYALTLEADRAVVLQGDGGFSRKSERGQASYYYSARGTLTIDDKPVDVSGQAWMDREWSS......... 174
7 -5.840PF08877.8; Q6MDY9_PARUW/26-147; MepB protein  ali follow..  13  13...................................................EINQRRIKFRVGKITPTKTGQF------------VTFWKRSSKGLILPYAFDD-PFDLFVVNVCTANRFGQFVFPKSILYEKAIISKNEGEGKRAIRVYPSWDQANNLQAKKTQAW.............................................................................................. 115
8 -5.730PF09411.8; A9IIE7_BORPD/46-180; Lipid A 3-O-deacylase (PagL)  ali follow..  14  66.............................................................................EAGIGATAFTHTKFADERISTAF---QFGDHIGMGFLVT------PHNRLGLRYSHFSNASIKRPNPGLDVLQLTYTYQ......................................................................................................... 135
9 -5.710PF00387.17; G7P2D3_MACFA/393-508; Phosphatidylinositol-specific phospholipase C, Y domain  ali follow..  13  30..............................................................SFSETKAKRLIKEAGNEFVQHNTWQLSRVYPS--GLRTDSSNYNPQELWNAGCQMVAMNMQTAGLEMDICFRQNGGCGYVLK..................................................................................................................... 112
10 -5.620PF06178.11; Q8ZQ33_SALTY/16-230; Oligogalacturonate-specific porin protein (KdgM)  ali follow..  1...............FSSYLQAATLDYRHEYADRTRINKDRIAIIEKLPNGIGFYVDASVKSGGVDGEQDKHLSDLVANAIELGVSYNYKVTDNFVLQP-DTSIYKPYLRGQYNFDSGVY-----AGRYRYDYARKTANYSDDEKTNRFDTYIGYVFDELKLEYNFTWMDSDQIKFDN----------------------------------KKTNYEHNVALAWKLNKSFTPYVEVGNVAVRNNTDERQTRYRVGLQYHF 215

FFAS is supported by the NIH grant R01-GM087218-01
1 2 0 3 2 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Jaroszewski L, Li W, Godzik A. In search for more accurate alignments in the twilight zone. Protein Sci. 2002 Jul;11(7):1702-13.