current user: public

Query: PF13175.4; I1YS32_PREI7/1-378; AAA ATPase domain, from PfamA30U

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .
321 2.000e-61gi|496383182|ref|WP_009092172.1| ATP-dependent endonuclease [Elizabethkingia anophelis]  clstr ali  19  1MYIANIKLINFRNFENSNIEFNDVNVIIGHNNA