current user: public

Query: PF13175.1; A9A6W0_METM6/4-391; AAA ATPase domain, from PfamA26U

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .
5 4.000e-42gi|429189980|gb|EKY30792.1| hypothetical protein HMPREF0185_00052 [Brevundimonas diminuta 470-4]  clstr ali  23  64..........................................................................................................................................................DAEIVAKTSEKAWAEAAKPVLATLRVALATADAELSETQEAYVISLEDRAEAIPKDEDAHAAARNLPVFLYLDDYPEIELSRQQHGGTTDADRNFQKLCKVAGLDPELFQSNDQETRAQLVNRAGAVVTTAIRERWKDRQLKVRFNLDAQHFDTLISDPNAIYDVEERSRGFQWFFAFYIVFXXXXXXXXXXILLLDEPGLYLHAKSQGDLLKHLED-DFVNQILYTTHSPFMV 319
9 8.000e-38gi|365901562|ref|ZP_09439399.1| conserved hypothetical protein [Bradyrhizobium sp. STM 3843]  clstr ali  29  1..............................................................................................................................................................................................................MSSYIFSQMLNARWPKFLYFDEYQMTGHENIEALMQRESDYPLLGLIRLARLKPELINPASTIELKSKLEGASNHLTRQVLRYWSQNR-HLRMTFDGTNIWGGVYDTRHQVTTESRSRGFVWFFSFLAWYSDVKQNDEPMILLLDEPGLTLHAKAQHDLLRYFEELKGTHQLIYTTHSPFMI 209
20 2.000e-31 GL0087671 [Lack both end] locus=scaffold71448_2:3:1037:-  ali  31  64........................................................................................................................................................................................................................KELLPKFIEIENYSKSKYTKKYLEDSTETKKMLNHLLSCINMNLDDLLKSNEADKLNFSEEFNEKLREEFNKFYTQDKVMINAKFENDSLNFAVKTTKKYMNFDERSNGLKWYLNMYIQIVSKTNSSENYIILIDEPGVYLHVNAQKEVLTLFEDLAKNNQIIYTTHSPFMI 246
29 1.000e-29gi|328542325|ref|YP_004302434.1| hypothetical protein SL003B_0705 [Polymorphum gilvum SL003B-26A1]  clstr ali  39  2.......................................................................................................................................................................................................................................................................................................KVRFDTDAEHINTFVSDPNATFDVEERSRGFQWFFSFYVTFAADTKGGEDAILLLDEPGLYLHAKSQRDLLNHFE-ADFKNQILYTTHSPFMV 99
30 2.000e-29gi|418047533|ref|ZP_12685621.1| hypothetical protein MycrhDRAFT_1143 [Mycobacterium rhodesiae JS60]  clstr ali  27  5.....................................................................................................................................................................................................................................DDRVLNTVYPISDQKPHPALGNLLRVAGVDLDLVESGDGSSRESYIEAANERLTDFFTQAWNQSSIAVRLKISESNLEVWLKETGVVTNIEERSDGLRTFVAL-ATFLASQHLAIPPILLIDEAESHLHLDAQADLVGVLLKQVDATQVFYSTHSPGCL 173
37 2.000e-28gi|324999264|ref|ZP_08120376.1| hypothetical protein PseP1_10886 [Pseudonocardia sp. P1]  clstr ali  26  63.......................................................................................................................................................................................................................IWNRAPAFILFSE-EDRSIRSSYDFDEQTPPAALENLAGMASLNLDLIAFGDIARRRTKIVQANKRMDEIFEASWRQSRLSVHFDVDGDKLRIELMENGADVTVDERSAGLRMFVAL-IAFLKIHGSSQPPILLIDEAENHLHIDAQADLVNMFASQEHAIKVIYSTHSPACL 241
71 1.000e-25gi|418057836|ref|ZP_12695821.1| hypothetical protein MetexDRAFT_0556 [Methylobacterium extorquens DSM 13060]  clstr ali  36  1............................................................................................................................................................................................................................................................................................................................MPFSERSAGFIWFFSFLVKFAQVSKRGGNQILLLDEPGLTLHGKAQADLLRYFDRLLPKHQVVFSTHSPFMV 73
75 2.000e-25 GL0137710 [Lack both end] locus=C18583919_1:1:537:+  ali  33  18............................................................................................................................................................................................................................................................................DDKFNFVEDFNNKLDKEFNKFYKQENVKLKVNFDTESLNFVVKTNNKYLDLSERSNGLKWYLNMYIQLIAKTQKYENYIVLLDEPGVYLHVNAQKEILKLFENFSNDNQIIYTTQLPTMI 143
86 6.000e-25gi|254438413|ref|ZP_05051907.1| hypothetical protein OA307_3283 [Octadecabacter antarcticus 307]  clstr ali  33  325...........................................................................................................................................................................................................................................................................KRTRSILLQSAGAKLTGRFSEWWKQGDYQFRFEADGNHFRIWVADARREVELEHRSTGLQWFLSFFLVFLHEAKEHDNCVLLLDEPGHSLHPLAQRDLSAFFEGLSENNQIIYTTHSPFLV 448
105 4.000e-24gi|254449841|ref|ZP_05063278.1| conserved hypothetical protein [Octadecabacter arcticus 238]  clstr ali  35  335........................................................................................................................................................................................................................................................................................KVTARFAEWWKQGDYQFRFEADGSHFRIWVADSRREVELEHRSTGLQWFLSFFLVFLHEAKEHDNCVLLLDEPGHSLHPLAQRDLSAFFEGLSQNNQIIYTTHSPFLV 445
118 1.000e-23gi|154244625|ref|YP_001415583.1| hypothetical protein Xaut_0674 [Xanthobacter autotrophicus Py2]  clstr ali  26  158.........................................................................................................................................................................................................................EKMPVFIYLDEYPELNLQRKGKSQLTPTDLNFEKMCKVAGLDPQELQQLEHETRNQLANRASAVITKEIRRLWKDRSLKVRFDTDADHINTFISDPNATYDLNERSRGFQWFFSFYVTFAADTAGGEDAILLLDEPGLYLHAKSQRDLLTHFDDDFSN-QIIYTTHSPFMV 345
133 3.000e-23gi|341615579|ref|ZP_08702448.1| ATP-dependent OLD family endonuclease [Citromicrobium sp. JLT1363]  clstr ali  29  56.........................................................................................................................................................................................................................................................KLLMQLANIEPEYIEAGENGHATALAESINQQLEKKFPKYWVQDRDQLRVTALESELVFTIRDRGTQYTFDERSAGLKYFLSYFIQATHIPDPTRPEILLMDEPDAYLSAEAQQDLLKIFRNFAEPDQVVYVTHSPFLL 212
153 2.000e-22Oral.Meta pmar_c_6_60 Prevotella marshii DSM 16973 [17329 - 18225] ABC superfamily ATP binding cassette transporter ABC proteins  ali  14  29......................................................................................................................................KYADYIEQIEIESLWSGRKHVVWNLDRQVNVLSGVNGVGKSTILNKVVKGLSTSGEITYEPARGVHLKVYPADAERIRYDVIRSFDKPLINADTITKMNLSLATELDWQIFQLQRKYLDYQVNMGNRIITALQSGNPDTASEQRISEPKRKFQDMLDNLFAETGKTIVRSENEIQFMQMGETLMPYQLSSGEKQMLVIL--LTVLVEDSLPYVLFMDEPEVSLHVDWQQRLIDLIIDLNPNVQIILTTHSPAVI 281
156 2.000e-22gi|317054720|ref|YP_004103188.1| hypothetical protein pAMI7_p09 [Paracoccus aminophilus]  clstr ali  27  285....................................................................................................................................................................................................................................FSFVKLEAKEILELGRDFKEVNGQNREPTADEIAEIAEQKRTRSILLQSAGATLTTRFRDWWKQGDYRFRFEADGNHFRIWVADDRTEVELENRSTGLQWFLSFYLVFLVERQDHKKAVLLLDEPGVSLHPLAQRDLSAFFESLSKTNQIIYTSHSPFLV 447
175 8.000e-22 GL0041319 [Complete] locus=C3061608_1:1307:2152:+  ali  17  112..........................................................................................................................................................................................................................................TELDWQLYLLQRRYLDYQVNLGNHMIELLTAGGPEAGQRAAQLA--QGKTEFQDMVDSLFGETGKKIDRKSNEIVLLQQGERLSPYVLSSGEKQMLIIL--LTVLTENKEPYVLLMDEPEISLHVEWQQRLIALIRQLNPRVQIVLTTHSPAMI 261
194 2.000e-21gi|359788126|ref|ZP_09291108.1| hypothetical protein MAXJ12_02231 [Mesorhizobium alhagi CCNWXJ12-2]  clstr ali  34  1..................................................................................................................................................................................................................................................................................MQSAGTKLTSKFKDWWKQGDYRFRFEADGDHFRIWVSDDREEVELEGRSTGLQWFLSFYLVFLVESEEHKDAFLLLDEPGLSLHPLAQKNLSSFFVNLATTNQIIFTTHSPFLV 117
197 2.000e-21 GL0013483 [Lack 5`-end] locus=scaffold88183_1:1:903:+  ali  35  1...................................................................................................................................................................................................................................................................................................TNKINLLFDMDNGIINFVVEDDGTSITLSERSDGLKWYISMFLQLYSSKKTHKYSLILLDEPGTSLHVIAQKKLLELLMQ-KGDYQIIYTTHSPFMI 101
209 4.000e-21gi|357060536|ref|ZP_09121304.1| hypothetical protein HMPREF9332_00861 [Prevotella sp. oral taxon 302 str. F0323]  clstr ali  16  2......................................................................................................................................KYANYIRRIDIPSLWSGHKHIVWELNNILSGRNGEGKSTILNRLIQHLREELSPADTSTGLTMEFAPSDATGIRYDIIRSFDRQLVKSDHLEQLTDVHVATELDWQLYLLQRRYLDYQVNVGNRMIELLTSGDPDARKKATDAAI--IKTRFLDIVDDLFSETGKKIDRKSNELQFSQYGEVLQPYVLSSGEKQVLVIL--LTALTEDQQPYVLFMDEPEASLHFEWQKRLVGLIRELNPNAQIVLTTHSPAVI 259
239 1.000e-20gi|398844747|ref|ZP_10601803.1| hypothetical protein PMI38_01155 [Pseudomonas sp. GM84]  clstr ali  22  33.............................................................................................................................................SKSLYELAPALITWLDTVYTKVDEKNADEESKDECDYALQYAKFMEYLDANKPTFVLYSNYFRVKPLLHLANLAERIRTNVLQDAYDYGNICLLNLLGFSAKELSDLGRAEEPASNTTELDKYREKLDRRAYQLNSASVELTQQIVKVWNQEVSKLRISADGQYLKVVVEDSGVEVELDQRSEGFQWLVSFFIVFFSEAKKHANTVLLLDEPGVSLHALKQREFRRTISQLAEDNQTIYSTHSPFMV 292
279 1.000e-19gi|260911229|ref|ZP_05917831.1| conserved hypothetical protein [Prevotella sp. oral taxon 472 str. F0295]  clstr ali  12  2.....................................................................................................................................EKYADYIKEIEIDSLWSGTRHIVWRLHKQVNVLSGVNGMGKSTILNRVVKCLPKGGDTNQNHVKGVHITMEPEDATCIRYDIIRSFDRPLLNAEIIAKLGLNITTELDFQLYQLQRRYLDYQVDIGNRIIHALQSGADAARVAQAHNEPKRMFQDMIDRLFAETGKTIIRTENEVRFSQIGETLQPYQLSSGEKQLLV--VLLTVLVEDRLPFVLFMDEPEVSMHIEWQKQLIDLILQLNPNVQIILTTHSPAVI 255
280 1.000e-19 GL0040511 [Lack 5`-end] locus=scaffold31381_1:82:513:-  ali  23  20..........................................................................................................................................................................................................................................................................................KTLFQDLIDDLFKDTGTTIVRTENEIRFTQLGEMLVPYQLSSGEKQMLAIL--LTVLVEDQQNYVLFMDEPEVSMHIEWQQRLIDLILQLNPNVQIILTTHSPAVV 123
290 2.000e-19 GL0081571 [Complete] locus=scaffold61000_2:608:1981:-  ali  19  176..............................................................................................................................................................................................................FLNYGTNRLVLDVPLRIRKKHSFSKRTALERALENRLDFRTFFEWFRNQEDFENEQ------KSIKRDWDYRDPALECVRKAALSMLDDAEEIKVRRNPLRMVVIRNDKEYRVDQLSDGEKCTLALLGDIARRVAMANPGIVLIDELDLHMHPAWQRKILSVLRKLFPNIQFLITTHSPQIL 360
292 2.000e-19gi|335436303|ref|ZP_08559101.1| hypothetical protein HLRTI_04387 [Halorhabdus tiamatea SARL4B]  clstr ali  24  100.........................................................................................................................................................................................................DLLRTLSNIDSPPNRIEDLPNIV--DQSKINLADSEYDLRADEDNPVLRGLFALNNINLEDYSSLDSPEFRKSLDTAVEQLSLYLNWFWETDSYRFEYELHEGTITLKLAEDETPPTPEQRSDGMRWIITFLLTIIAQQSGGRQTLVTLDDPGIHLHPEAEKQLFRAFFNVTNQAQIIYTTHSPALI 304
298 3.000e-19gi|126665992|ref|ZP_01736972.1| ATPase [Marinobacter sp. ELB17]  clstr ali  16  92.............................................................................................................................................................NLAKVRKGYSKKDLASVLISASEAAKRIQGAITENVGDVNIPLFAYYPVNRAVLDIPLRIREKHQFELLSAYEESLTSGANFRTFFEWFREREDLENEHRKYRDDLIKPDDFQFPDPQLAAVRRALEIFMPDFT------ELTVRRNPLRMEVLKKGRRLTVNQLSDGEKCLMAMVGDLARRLAIANPGIVMIDEIDLHLHPKWQRLVVPRLMEVFQNCQFLISTHSPHVI 325
312 5.000e-19 GL0025353 [Lack 5`-end] locus=scaffold45211_3:439:873:-  ali  20  13..........................................................................................................................................................................................................................................................................DAREKATALASAKQRFQDMVDDLFSETGKKIDRTSNEIRFEQI----GETLLPHQLSSGEKQMLVIL--LTVLIEDRQSYALFMDEPEVSLHVEWQQRLIGLIRELNPHAQIVLSTHSPAVI 128
321 9.000e-19 GL0014364 [Lack 5`-end] locus=scaffold3806_2:318:722:-  ali  23  14..........................................................................................................................................................................................................................................................................................KTRFQDLMDELFSETGKSIIRKSNEIQFVQDGDILTPYQLSSGEKQMLVIL--LTVLVQDNEHCTLFMDEPEISLHVEWQQKLISLIRKLNPNVQIVLTTHSPAVI 117
324 9.000e-19 GL0190773 unmapped_[Lack_5`-end]_[mRNA]_locus=C220014979_1:1:489:+  ali  18  1................................................................................................................................................................................................................................................LFQLQRKYLDYQVNIGNRMIQLLQSGEPDAAAKA--QALSQPKKLFQDIIDDLFKETGKKIVRDANEICFSQIGEKLLPYQLSAGEKQMLTIM--LTVLVEDGQPYVLFMDEPEISLHFEWQKQLINLVLRLNPNVQMIMTTHSPAVV 144
328 1.000e-18 GL0125175 [Complete] locus=scaffold74688_20:3:1313:+  ali  15  107.............................................................................................................................................................ETLSLRKDYIKAKPGKAPRVIPYKDLYDSFVEKFTATYLSEGSENNMPIFVNYGTNRSVLDIPLRIRTNHEFSQLAALERASENELDFRSFFEWFRNQEDIENETKTETKNFDYEDVS------LGCVRTAVCSMLDNVSDLKVKRSPLRMTVKKNGLEMRVDNLSDGEKCTLALFGDLARRIALANPSIVLIDEIELHMHPSWQRKILGALKSTFPNIQFIITTHSPQVI 340
339 1.000e-18gi|326385841|ref|ZP_08207469.1| ATP-dependent OLD family endonuclease [Novosphingobium nitrogenifigens DSM 19370]  clstr ali  20  3LKTAHIQNYRSIRDTGVFEIEAGK-TILVGPNEAGKTAVLQALQQINPPKGIRDYPRAKYNDISPVATVTFTLDEDDLAALPESMRGI--------------TGYSYTRYISNNGSHFL---IGAPALPTVGAIRKDAVRLAAHVDGRTPVAEGAAPSTAQVLNSLLQEWRDELSSELSGALKQWVDALADDSEDARIDRLLAAFSIAGDRNAALLQKRIPVFVLFSNY--FRVRPLIHLGLL................................................................................................................................................. 249
375 4.000e-18 GL0124896 [Lack both end] locus=C3325494_1:1:699:-  ali  30  1....................................................................................................................................................................................................................................................................KLAKITDNREKNSILSEIEKHLNNKLTEDWEKNKLKIKLDVNNNQLNIQIKENDRFFDVVDRSKGFLWFYNFIMKVRFNAKANKDTIFLLDEPGSYLHLNAQDKLCSNLKKISEDGIVIYCTHSHHLL 144
376 4.000e-18gi|406901810|gb|EKD44380.1| hypothetical protein ACD_71C00156G0001 [uncultured bacterium (gcode 4)]  clstr ali  31  1...........................................................................................................................................................................................................................................................METILNVFFSRIARTETLQRGTIVDEHNKKLSANFSKVFKQSEVSISYAIDGEEFIFFSVQDGEPLPLRLRSKGLIWFLSFWLVL--ESMKDQNRVILIDEPDNSLHVNAQSDLLNVLDEIAQTYQIIYATHSPFLI 163