current user: public



Announcement: our server is upgraded to a faster system. If you experience any issues during this period please let us know.

PF13175
Query: PF13175.1; A9A6W0_METM6/4-391; AAA ATPase domain, from PfamA26U

Results of PSI-BLAST search in nr85s
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .
# E-value Template Links and tools%idFirst LTKFRIKNYKSIKDSGDVYLSPDNITILAGMNESGKTSVLEALEDFNVGKTVRESAKPICGNLDPEISLFFKLNVEELEKISKDISNIYLSNDFSKNIELEVKKVGSTYFLENNDIYSCLEDYNIGIINTLVEIENEINTLSKNIDVIFPTEFNSVEEFRKIMDQKIKDGKSKITDDFNEKIKTQLNALFDEAQKYTLYFLDIDKTLINYIENVVKKEYIPNFIIFKTYKDSKIPNIIPFANLETDEFIKDLQKVSNLDINLIKSTDRQRKKNHHGAININLQEDYSKYWTQSESNLEITWDNNNVEFWVKEDNTSYTPEQRSKGKQWHLAFYIRITARSKEGKNNILLIDEPGLFLHAQAQEDIINKLEDASKTMSIIYTTHSPYLLLast
1 6.000e-54gi|409399895|ref|ZP_11250103.1| hypothetical protein MXAZACID_03851 [Acidocella sp. MX-AZ02]  clstr ali  21  3LSEYTVREFRSIWDSGPIRVD-GQTTCLVGKNEAGKTTLLTALYRTNPIIPA---------------DAVFDETYDYPKREVEDYRFAVENEDRDAAVVVE-----CLYELDAEDAEAVTSIFGPQVLQGNTFTRK---TYYGKANSRFCLVTDDSAARKHLADAGAADWNTFAAALDAAEATGAVNGLKELVAKVR------QNGLSHYIFNSLIWPRAPKFLYFDEYGQANLNALIARENADSDYPLLGLINLARLDHKLVETKNTTKLKNKLEGAGNHLTNRIVKYWSQNR-HIQMRFDRQGINVWGEVYDTVHPLRTRSRGFVWFFSFLAWYEDIKRQKQNVILLLDEPGLSLHGRAQADLLKYFEAELSAHQLIYTTHSPFMI 396
2 3.000e-44gi|365901166|ref|ZP_09439019.1| hypothetical protein BRAO3843_720021 [Bradyrhizobium sp. STM 3843]  clstr ali  25  2.............DSGWIDIN-NNITAFVGQNEAGKSNLFEALYRINPFAPEEDWPVDDWGNKDPSCEARFALDNDEIEELYKSAALQPSSSEPSPDGQGEVG-----------------------------EQDAKIRELASELTLIGSRSYNAGPTF---------AVPAKHSSDFD---AAKVDAWAKEHAPRFVLIQDYGMSGARIELNQLRSKNVPWHQLSNEEQTIKI--VLDLAKVNIDEF---LAKGGTPEGRTIRSFDKR-------AASSYLSKQFRELWTQKKVNFHIEIDGTTLNIFAEDDGMPVRLHRRSSGFRWHVSFAWKFTHASRQYRGCILLLEEPGIHLHYSGQRDLLEVFQRLADKNTVLYTTHLASMV 337
3 7.000e-44gi|227822791|ref|YP_002826763.1| hypothetical protein NGR_c22500 [Sinorhizobium fredii NGR234]  clstr ali  20  17...FRVQNFRNILDSG--WIEANRITAFVGQNEAGKSNLFEALYVLN----------PIIPDIEYSVDEDWPVDRWEGRKDAEGEPVCEARFELNAAEIASLFSAARVPIPAPADGEDPVPEPQLPTDASLN---------LTKWYGYKTEHKAVGYPEGALDPAKVAEWATKNVPKFVYIRDYEMSGAQVELDQLYQRLTNVG----------GKRHQLSN-------EDQTVLIILDLANIDLKDFIE---KGKTAEGRTNRSFDKR-------SASKYLTKQFSELWRQKEVEFDIEIDGPTLNIFAEDANIGMPVHRRSTGFRWYVSFAWKFTHATKDFKNCVLLLEEPGVHLHFTGQRDLLTVFDRLSANNTILYTTHLASMV 356
4 2.000e-42gi|239817025|ref|YP_002945935.1| hypothetical protein Vapar_4055 [Variovorax paradoxus S110]  clstr ali  20  3LASFQITNFRSINDSG--SIDTSQITAILGRNDSGKSNLLRALHSLNPADFPRHRRLEECQGDTPVVATRWALEDSERAELVQKVRHVTAGRGYGTARWSGLEGLGDLSLDVSDIKAKVRKIVPAVKAAAEKLADDARAMLEQAADAFDAAMILSPDYIR------WSAGAVAVLQSLRKAMAAADAELSDKQEQMLAELEEMARAIANDTPALARADKLPRFVYVDEYPALPGRQNIAEHDAPGQRNFEKLCKAAGLDPELLEKNDQATRNQLANRAGSVVTAEIRRLWKDRELKVRFNLDGPYMDTLVSDPNVEVNLDERSRGFQWFFSFYVTFFADTKGAGDAILLLDEPGLHLHARSQADLLAHFEQDFAN-QIVYTTHSPFMV 418
5 4.000e-42gi|429189980|gb|EKY30792.1| hypothetical protein HMPREF0185_00052 [Brevundimonas diminuta 470-4]  clstr ali  23  64..........................................................................................................................................................DAEIVAKTSEKAWAEAAKPVLATLRVALATADAELSETQEAYVISLEDRAEAIPKDEDAHAAARNLPVFLYLDDYPEIELSRQQHGGTTDADRNFQKLCKVAGLDPELFQSNDQETRAQLVNRAGAVVTTAIRERWKDRQLKVRFNLDAQHFDTLISDPNAIYDVEERSRGFQWFFAFYIVFXXXXXXXXXXILLLDEPGLYLHAKSQGDLLKHLED-DFVNQILYTTHSPFMV 319
6 1.000e-39gi|398812833|ref|ZP_10571546.1| hypothetical protein PMI12_05667 [Variovorax sp. CF313]  clstr ali  21  3LASFQITNFRSINDSGLID-STQQITAVLGRNDSGKSNLLRALHSLNPADFPRHRRLEECTGETPVVFARWSLDESEQAELAGIVRHVTXXXXXXXXXXXXLEGLNALSLDVSDIKGKVRKIVPXXXXXXXXXXXXXXXTLEQEADTFDAAMIMSPDYIK------WSAGAVXXXXXXXXXXXXXGAELSDKQEQMLAELEDMALSISNDTPALARAEKLPRFIYVDEYPALPGRQNITLAQQSFGKLCKVAGLDPQQLQDLLEKNDQATRNQLANRAGSVVTAEVRRLWKDRALKVRFNLDGQYLDTLVSDPNVEVNLDERSRGFQWFFSFYIAFFADTKGGRDAVLLLDEPGLHLHPHSQADLLAHFEKDFGN-QIIYTTHSPFMV 421
7 1.000e-39gi|329114045|ref|ZP_08242809.1| Hypothetical protein APO_0819 [Acetobacter pomorum DM001]  clstr ali  21  3LTGFRVTNFRSVVDSG--WITASAVNALIGVNESGKSNLLLPLWKLNPARDTSDYPKTQYASIKDFIEAEFLAEKAEIAELTTEMERCRVTRSFSGDYCVSFPDCKVVRTSEPSVLRSTLENARRELRNEVAFKAALLRAIDDAIATLETKDHVTFEAVSEVSDQIINALSTF--TDHGGSLRQRYTELIEEVEEIKAGLDSTPPEDVDGVSDLIIRG-MPKFVYYSNYRARTLRTLFSFVRLKPEEILELGQEVEMTGKATTDEAEKRERTILLHSAGADLTRKFAQWWKQGDYVFDFQADGDHFRIWVSDSRRKVELEDRSTGLQWFLCFYLVFLVESEGAHSGVLLLDEPGLSLHPLAQRDLFKFFEGLSATNQIFYTTHSPFLV 445
8 8.000e-39Oral.Meta HOMD bdim_c_26_79 Brevundimonas diminuta ATCC 11568 [21282 - 23321] ATP-dependent OLD family endonuclease  ali  24  14LKTAHIQNYRSVCDTGVFDVETAK-TILVGPNEAGKTAVLQALQQVNPPEGVKRLD--ALRDYPRSKYNDITTGKVDPKKVPVATVTFTLNEDDLAAAPASMRGISGYTFTRYIANNGTHSLIGAPPSPTVGAIRKDAVRLAAHVDTVAEGEVPSTEQTDKI-NLLLKDWRDEFSDELSVALKKWVNGLVDESEDERINRLSAAFSVVPDQNEALKEKRIPVFVLFSNYFRVRLADRLSSNILDDDQYLSNLGKATEPQANQPQALKEYRRKYQLNAASVQLTNEIRSVWKPSATRLRLDADGQYLKVVVEDEGVEIELDQRSEGFQWLVSFFVVFFAESADHKNAILLLDEPGMSLHALKQREFRETITKLAAKNQTIYTTHSPFLV 443
9 8.000e-38gi|365901562|ref|ZP_09439399.1| conserved hypothetical protein [Bradyrhizobium sp. STM 3843]  clstr ali  29  1..............................................................................................................................................................................................................MSSYIFSQMLNARWPKFLYFDEYQMTGHENIEALMQRESDYPLLGLIRLARLKPELINPASTIELKSKLEGASNHLTRQVLRYWSQNR-HLRMTFDGTNIWGGVYDTRHQVTTESRSRGFVWFFSFLAWYSDVKQNDEPMILLLDEPGLTLHAKAQHDLLRYFEELKGTHQLIYTTHSPFMI 209
10 7.000e-37gi|82701278|ref|YP_410844.1| ATP-dependent OLD family endonuclease [Nitrosospira multiformis ATCC 25196]  clstr ali  23  80LTRFLVTNFRSVENSG--WIEVDSVTALIGVNESGKTNLLVPLWKLNPAVG----------------------------------GEIVPASDYPKKQFGPVRQAPESFHFITAEFEAGELGEELCGKLEISSEEASLIAVKRYFNGDYSISFPRREELGEIRRSSGEEAED--------VVDTVIHSLPKFVYYSEFGNLDSEIYLPHVVQNLQRTDLGPR----EAAKSRTLRVLFKFVGLEPGEILELGRDFPRRKGRRREPTVEEIREIAMKKRERSITEKFRNWWKQGDYKFRFEADGSHFRIWVSDDREEVELESRSTGLQWFLSFYLVFLVESGEHQNAVLLLDEPGLSLHPLAQRNLFAFFDSLAKVNKILYTTHSPFLL 431
11 1.000e-34gi|159904958|ref|YP_001548620.1| ATP-dependent OLD family endonuclease [Methanococcus maripaludis C6]  clstr ali  100  4LTKFRIKNYKSIKDSGDVYLSPDNITILAGMNESGKTSVLEALEDFNVGKTVRESAKPICGNLDPEISLFFKLNVEELEKISKDISNIYLSNDFSKNIELEVKKVGSTYFLENNDIYSCLEDYNIGIINTLVEIENEINTLSKNIDVIFPTEFNSVEEFRKIMDQKIKDGKSKITDDFNEKIKTQLNALFDEAQKYTLYFLDIDKTLINYIENVVKKEYIPNFIIFKTYKDSKIPNIIPFANLETDEFIKDLQKVSNLDINLIKSTDRQRKKNHHGAININLQEDYSKYWTQSESNLEITWDNNNVEFWVKEDNTSYTPEQRSKGKQWHLAFYIRITARSKEGKNNILLIDEPGLFLHAQAQEDIINKLEDASKTMSIIYTTHSPYLL 391
12 3.000e-34gi|148254737|ref|YP_001239322.1| hypothetical protein BBta_3314 [Bradyrhizobium sp. BTAi1]  clstr ali  21  3LKWFHVRDFQSVRDSGRITV--SDITCLVGKNEAGKSALLKALYRLNPVIPA---------------DGSFDVTNDYPRMEVEDYRH-----DVETGKRAVAQPIEACYELDADEISAIADVFGPDCVSTISFVKNYENAIAYKFTV------DDRKGFEHLISKADLSAQTRAALKGVELTPDALTPVLQSQEQTTTLEDIKQNGLMGHIYNRLLSSRQPKFLYFDEYYQMTHENIDALINRENSNQLKLIRLARLKLPELINPASTIELKNKLEGASNHLSRQVLKYWSQNK-HLRMSFDNIWGGVFDSRHQVTTELGSRSRGFVWFFSFLAWYSDVKKGAEPMILLLDEPGLTLHAKAQHDLLRYFEELKGSHQLIYSTHSPFMV 396
13 4.000e-33gi|88856071|ref|ZP_01130732.1| hypothetical protein A20C1_12752 [marine actinobacterium PHSC20C1]  clstr ali  21  3LDRIQIFGYRRMVDA-SAYVGRKTV-ALVGPNEAGKSSVLSALRLFPPLSFSRATRGQARDATDDVVILSLALTAEQLS-ILKGMPLSVLPTHYTLHKQIDFPEVDPAIRKKAADGWPKLAAVLEVGIDSGADDADAQTADLDSVGRHFLPGVYEEEVFKRVHGRIVGMPFDKQAKKVQSAIA---------AFEEYFRIGRPDLNLRSLIRAELKITD-PVFAMFDRERDIEAEYEIAGADTESSVALANLLALAGLSLTSIRQNLPDALEQLVNDANDRLSEYFASKWSQESVAVGLKVDGDVLRVFVKDVRPGINITERSDGLRMFVAL-ATFLARQEFATPPILLIDEAEQHLHLNAQGDLVRMLQELEQIQQVLYTTHSPGCL 398
14 5.000e-33gi|377561536|ref|ZP_09790981.1| hypothetical protein GOOTI_202_00020 [Gordonia otitidis NBRC 100426]  clstr ali  20  4.ESATVSNFRCVIDSGRFQVEPDK-TILVGINEAGKTALLKALQHASPTDDTAAIDWLFDAPASMVDDIRRK-NLDPAALAVARVVMRPEEKDLAGLSLPDGSDDIRFVMTVWMSNKRTYTVTGLPAAPTIGGSEKTILRLTSAMAKQSDEEAKQVA--KAILDWKDAQSSDSISGDVAAELKKHLDALFAEGSAAETHWDSLSETLKKALALDKIGKHLPPFVYYSSYFNLQLLKFLGFTARELSDMASEAPEKGHNYENDVNVQNQYERKRALQTAGARLTEEIRRVWNDDSLTIRLDVDGQYLQTLVEDEGIPVELDQRSEGFRWLVSFFVVFHAQARDDRDAILLLDEPGLSLHALKQQEFRKTVSRLAEGNQIIYTTHSPFMV 435
15 9.000e-33gi|419924167|ref|ZP_14442063.1| hypothetical protein EC54115_14082 [Escherichia coli 541-15]  clstr ali  15  3LKSVAVKNFRCY--AQEVSVEFDDLTTFVGRNDIGKSTILEALEIFFNNSVV-----------SIEKGDACIHSGQDNVEITCEFIDLPHSLTLDSGAETTLQEEFLLTGTGSLKIRKLFNCSNKKPAAEIFVIANHPAAAGFQNLLELKEKELQARVKELGLDVSLKGNPGMRKAIWAASADLQLTETLLPVSKAKEDTKRIWEQIESWLPMFALFQSDRSSRDSDDEVQSPMKAAITAALAEVQDDIARIQLRVQQKAEEIARNTHEALKTIEPGLARELTPEF---------TPPTPAKWQGLFSVGLNTDGGIPLNKRGSGVRRLVLVSFFKAEKSSNRRSIIYAIEEPETSQHPNYQRILIESFKSLSAGCQVILTTHSP... 372
16 1.000e-32Oral.Meta HOMD NCBIAAYI_c_1_5 Actinomyces odontolyticus DSM 43331, ATCC 17982 [379 - 2286] ORF  ali  20  3LVHASIQRYRSIGEPTEFDVEPD-VTALVGKNESGKTAVLQSLYK-----------------SNPVDRAKFDPDLDFPTHRTREIAKG-----------ATVKVTDLTYELDGDDIAAIEASLCPGVLDDKRVVVAAGFRFNRTNWSISVNREKVLNSLRDSLDLPAADKTKVEGASTIDGLVEILQRLESDTPTATATLEKIKDSDPVLAAIDILSKRRPKFVYFGDYDKVSIPRLISHRDERGEEALLALLSMAEVELEDFSSPDHEHLIRQMENAWNTISDEVFDYWSQNELQVRLQVIATQVRVENRRHRVTVPFDERSRGFVWFFSFLAYFSKEEESTQPLILLLDEPGLSLHATAQHDLLRFINELAARHQVIFTTHSPFMI 391
17 1.000e-32gi|418964354|ref|ZP_13516166.1| hypothetical protein HMPREF1043_0315 [Streptococcus anginosus CCUG 39159]  clstr ali  19  3LKRVQVRDYRSVNDSGEFEVEHDK-TILVGINEAGKTCLLTAIEQINAPKSRPDYPRERDESDVEVVVATFVLDDDDRGAITAVAPGFGDIDGYTFARKLDNNAWHRINGGPEAKQFREVEEDLARARKALARVEGLDEDLLVRFDAAKASFAPSTVDEAEELDAVLAEATVEIDEDNRAAALKVIEGRLPKFVYYSTYFQVRPRINLKSLAAREAAGDVEDDVDFGNLCLLKIAELAELADGAPNKDSYRYSSEQYEAALKAYQDKLDDRGHRLNAASVSLTQQIREVWGDEQVTLRFNADGHYLKVSVVDDGVEVELDQRSEGFRWLVSFFVVFRAQSEDLKDAILLLDEPGLSLHALKQQQFRYTVGKLAGTNQVIYTTHSPFMV 433
18 9.000e-32gi|332283844|ref|YP_004415755.1| ATP-dependent OLD family endonuclease [Pusillimonas sp. T7-7]  clstr ali  15  22LESVSIKNFRCYREETTVSMV--DLTTFVGKNDIGKSSILEALEIFFNNEAVK-----------IEQGDANIYSGSPLVSITCEFSDLPSKLSLDAGAETTLTAEFLLSVEGTLKIQKVFDCGKRTPSVEVYILANHPTAAGVADLLDLKEKDLQKLVKDQKLDTALKGNPGMRQALWAATKDLELKEVALPVTKPKEDSKRIWDQLESYLPMYALFQSDRSSRDSDGEVQNPMKAAVAAAIAEVQDDINRIQEKVREKAELIAKITHEALKTIDPNLAKELTPQF---------VPPTAAKWTGLFSVGMDTDDGIPLNKRGSGVRRLVLVAFFKAEAERRLKSIIYAIEEPETAQHPNNQRILIESFKTLAPGCQILLTTHSP... 391
19 1.000e-31gi|104782596|ref|YP_609094.1| hypothetical protein PSEEN3569 [Pseudomonas entomophila L48]  clstr ali  16  3LKTIAIKNFRCY--SEKVTIPIEDLTTIIGKNDIGKSSILEALEIFFNNETI-----------TIEQGDANISSEDKSVEICCEFENLPTPISLDSGAETSLSEEYLLSSEGTLKIQKIFNCNNKKVTEEIFIIAQHPSTKGFENLLELKEKDLQARIKELKLDTPLKGNPGMRKALWAAAGDLQLSETAIPTGKAKEDTKRIWEQIEIHLPLFALFQSDRSSRDSDTEVQSPMKAAISAAIAEVQDDIANIQKKVQEKAEEIAHRTHEALKTLDINLANELTPEFSA---------PSPAKWTGLFSIGLNTDSGIPLNKRGSGVRRLVLVSFFKAEAERRLKSGIYAIEEPETAQHPNNQRLLIESFKSLSPGCQVILTTHSP... 372
20 2.000e-31METAHIT V1 GL0087671 [Lack both end] locus=scaffold71448_2:3:1037:-  ali  31  64........................................................................................................................................................................................................................KELLPKFIEIENYSKSKYTKKYLEDSTETKKMLNHLLSCINMNLDDLLKSNEADKLNFSEEFNEKLREEFNKFYTQDKVMINAKFENDSLNFAVKTTKKYMNFDERSNGLKWYLNMYIQIVSKTNSSENYIILIDEPGVYLHVNAQKEVLTLFEDLAKNNQIIYTTHSPFMI 246
21 2.000e-30Oral.Meta HOMD ehor_c_43_11 Enterobacter hormaechei ATCC 49162 [8232 - 10133] ATP/GTP-binding protein  ali  15  29LRKLKLKNFRGYRNSTEIIIDES-MTGIVGRNDFGKSTLLEALAIFFETEGMKADKNDMNCFSLREGDGRF--------EIACEFDDLPDFIMIDDRVQTTLASEHLLNEDGNFEIVKTFKATTSGKPE-----QTCIRCIHPDEEPLRNLLGMKISELKAVGKEVEKNVADKRTASLWRQAIREAAAPYTCSEIM----LDVDKEFGTDTKSLWGKILDLLPTYAIFKADRESSDGDSEAKNPLQQAVKDAQAALQDKITALENEIQDSVLDVAQRTLDKLREMAPELASELTPRFKEKPKWTFNFTLDGENG--IPINKRGSGIRRLILLNFFRAEAEKNPRNVIYAIEEPETSQHPNYQMMLMKALLALAPHRQIIVTTHVPAL. 401
22 2.000e-30gi|285019397|ref|YP_003377108.1| hypothetical protein XALc_2636 [Xanthomonas albilineans GPE PC73]  clstr ali  13  3LSAVILENFRGY--SQRTRIEIDDLTAFIGKNDAGKSTILEALDIFFNDGKPERGD-------------ACVHSTDTMIRIGCAFASLPTEIVLDAAAHTSLAAEHLLNEKGELEIIKEWDSSAKTPKESVFAIAMHPTN--ADATDLLTLKNSDLKARVKKLGIDESTVSLAINGSMRQAIREACHPLTLERKSLPLDKEDAKKVWEQ------LRPQLPMYALFRSDRPSQDGD--EEVQSPLKFAITQALKELADDLKKIEDAVRLRAEDVAKRTLAKLNEMDGRLASELKPFFKADPKWDVFKFGLVGDND-IPINKRGSGVRRLILLNFFRAEAERRRTEVIYAIEEPETSQHPDNQRLLVQALKELAENTQVLVTSHTP... 368
23 2.000e-30gi|422300163|ref|ZP_16387696.1| hypothetical protein Pav631_4313 [Pseudomonas avellanae BPIC 631]  clstr ali  14  72ISKMTLVNYRNFSNTTLKF--QRGVNTIIGENGSGKSNILRAIRLLLDDTMVRAAYRLEESDFCRSLGEWRGHWIIISVEFEEISADEAVQALFLFEDGPLAKATYNLIFRPKKEIRLKLAALGDFDDEELTEIRNAITIDDYETVFTGRSSANFSDPSVYRSIVGDFDVCSFSAETEFPEIGAKVPGFLSVTKEVSLTFIQALRDVVAEFHNNRTNPLFALLKSKSGEIDPVSMLPITQMVRDLNASIEGLED--------VQSVRNHIRETIKDAAGETYSPASLSIKSDLPDEAEKLFQSLRLFVGEADDGYDGGIHELSLGGANLIYLTLKLLEFKYQREKNFLLIEEPEAHIHTHIQKTLFDRISY--SDAQIIYTTHSTHI. 455
24 3.000e-30gi|254234488|ref|ZP_04927811.1| hypothetical protein PACG_00346 [Pseudomonas aeruginosa C3719]  clstr ali  14  3LKTIKLSHFRGYRTTTVIPIDVA-MTGIVGRNDYGKSTVLEALAIFFDSVDIKPDKSD--------MNCFSLAEGHDQFEIACEFDDLPDALVLDENAQTSLSQEYLLNASGALE---VVKTFKASSGKQDGTAIRCQHPSDKALSGLLSLKMADLKKLGEQLGIAERVVDQRVASQWRQAIRDATGDI--SCQETLLDVGKGLSTEGKSIWEKIES-LLPTFALFKADRESSDGD--AEAKNPLQQAVKEAQALLQAQISELERQIQSSVLDVAERTLDKLREMAPELANELTPRFKEKPKWSFNFTLEGENG--IPINKRGSGVRRLILLNFFRAEAEKNPRNVIYAIEEPETSQHPNYQMMLMKALLDLSNNRQIIVTTHVPAL. 377
25 3.000e-30gi|124268178|ref|YP_001022182.1| ATP-dependent OLD family endonuclease [Methylibium petroleiphilum PM1]  clstr ali  14  3LKSVAIKNFRCYR--EEATVQLDELTTFVGKNDIGKSSVLEALEIFFNNDVVK-----------IEAGDANVYSGDSRLSITCEFSDLPASLTLDAGAVTTLADEHLLTADGTLKIQKIYDCKTKTPSVEVFLVAHHPTA---------DGVAGLLDLKEKELQALIKAKGLAVQLKGNPGMRKALWDAEADLKIAEVTLALTKPKEDSKRIWEQLESHLPMFALFQSDRSSRDSD--GEVQTPMKAAVAAAIAEVQDEIDLIQKRVKEKAEEIAQSTHKALKAIDPNLAKELTPQFTTTAKWTGLFSVNMDTDDGIPLNKRGSGVRRLVLVSFFRMASGGNTRSIIYAIEEPETAQHPNNQKILIESFKALASGYQVLLTTHSP... 373
26 7.000e-30METAHIT MH0062 GL0039467 [Lack 3`-end] locus=scaffold19910_3:2:994:-  ali  20  2.....................ESQITRIVGKNESGKTALLEALAKSNY--------------------------FEDNADFQFDKDLDYPRSELTKVRTENPRVLTCEYELSDEDVKSVEDVFAEGIISKQRFYDNTRTTTGVSTDKDWLISAFGVGEQGKELIHAATDYPSLVSVVSENNSLPGMNEIKAELEKIKKGANGWTNPLEGYIYKTYISPAIPKLWYFSDY--FSLPCRINLSDFEEYKIAKALFELSGLQISDIQESNFEAFKAQLEATSNSITDEMFEYWTTNR-NLEIRFEIENIRIYNSKHRVTLPLKNRSKGFLWFFSFLVWFSKIQGDKNSKYILL...................................... 331
27 9.000e-30gi|424666552|ref|ZP_18103578.1| hypothetical protein A1OC_00105 [Stenotrophomonas maltophilia Ab55555]  clstr ali  14  3LEAISITNFRCYGDE--IRVELDDLTTFVGRNDIGKSAILEALEIFFNADVVAM-----------EQGDAHVHSVDKTVSITCEFSELPPTLTLDAGADTTLADEYLLTLDGRLKIRKTYDCTSKKPSAEVLVLAFHPTAANYD---------NLLELKEKELQKRVKDLGLAVALKGNPGMRRALWAAAGDLKLQEVAIAVGKSKEDVKRIWDQIEPHLPMFALFQSDRSSRDSDS--EVQSPMKAAVAAAIAEVQDDIARIQTKVREKAEEIAKNTHRALTTIDPNLASELTPEFSTAAKWQGLFSLGLNTDDGIPLNKRGSGVRRLVLVSFFKAEAERRKRSIIYAIEEPETAQHPSNQRILIDSFKVLSPGCQVVLTTHSP... 372
28 1.000e-29gi|319795357|ref|YP_004156997.1| hypothetical protein Varpa_4724 [Variovorax paradoxus EPS]  clstr ali  21  3LASFQITNFRSINDSG--PIDSTQITAILGRNDSGKSNLLRALHSLNPADFPRHRRLEECQGDTPVVSTRWALDDNERAELKSDVRHVTAGRGYAATRWTGLEGLGELSLDVSDIKGKVRKIVPXXXXXXXXXXXXXRATLEQEADAFDAAMIPSPDYIR------WSEGAVKALQALRRAMAAADAELSDKQEQMLVELEDMAHAIANDTPKQWVLEKLPRFVYVDEYPALPGRQNIADEQRSFEKLCKVAGLDPQQLQELLEKNDQATRNQLVNRAGSVVTSEIRRVWKDRELKVRFNLDGPYMDTLVSDPNVEVNLDERSRGFQWFFSFYITFFADTRGAGDAILLLDEPGLHLHAHSQADLLAHFEHDFGN-QIVYTTHSPFMV 418
29 1.000e-29gi|328542325|ref|YP_004302434.1| hypothetical protein SL003B_0705 [Polymorphum gilvum SL003B-26A1]  clstr ali  39  2.......................................................................................................................................................................................................................................................................................................KVRFDTDAEHINTFVSDPNATFDVEERSRGFQWFFSFYVTFAADTKGGEDAILLLDEPGLYLHAKSQRDLLNHFE-ADFKNQILYTTHSPFMV 99
30 2.000e-29gi|418047533|ref|ZP_12685621.1| hypothetical protein MycrhDRAFT_1143 [Mycobacterium rhodesiae JS60]  clstr ali  27  5.....................................................................................................................................................................................................................................DDRVLNTVYPISDQKPHPALGNLLRVAGVDLDLVESGDGSSRESYIEAANERLTDFFTQAWNQSSIAVRLKISESNLEVWLKETGVVTNIEERSDGLRTFVAL-ATFLASQHLAIPPILLIDEAESHLHLDAQADLVGVLLKQVDATQVFYSTHSPGCL 173
31 6.000e-29gi|395010391|ref|ZP_10393774.1| hypothetical protein PMI14_06705 [Acidovorax sp. CF316]  clstr ali  19  3LTKVRVQNYRSVEDSGEFEI--GDLTCLVGKNEAGKTALLSAMRGLKPSQPFEFDE-------------------------PIDYPRRFSTRFDDRHEDGTAEVIRTWWRLEAADIAAVERRFGAGVLKGDT-FQAHFGFRYDDDNRIWVIEIDSAKVLENMLTKHALDAPERNVLHGVVDADKALTGLAERTPKQEALLQDIKKCRDSSFSKDVLSARQPKFFFTSHFERMSGMVSIQKLQQDKQNFLAFLEYAGTTLEELLEADRRETLKATCEAASNEITEEIFQFWSQNNLEVVIDIDSGKIRIKNNNHKATLPLSERSAGFVWFFSFLAQFLRKTPGNGNAIILLDEPGLTLHGKAQGDLLRYIVELLPDHQVIFTTHSPFMV 395
32 9.000e-29gi|381150619|ref|ZP_09862488.1| hypothetical protein Metal_0623 [Methylomicrobium album BG8]  clstr ali  21  3LESFRVWNYRSINDSG--EIAVSRITSLLGRNESGKSNLLRALHSLNPIDFPRHRRLEECKEDTPVLSTTWILDDDDKETLLEEIFKVIIDRSYGINRTVSFPELKSIHFDDALIKNXXXXXXXXXXXXXQKHENTSLDTAADAFEAAASETWATQAAVAAKSLRTALAGVDAELTDKQEEMLSELEDLANSIASDKDALQNAKSWVISSIPKFIYLEEYPEYQDISTFLQRKSQNQKNEADKNFEKLCKVAGLNPERLQEHLSQNDHETRNQLANRASAVVTAEIKRLWKDRPLKIRFNLDAQHLETIISDYDVEVNLNERSRGFQWFFAFYITFSADTDRAENAVLLLDEPGLYLHARSQSDLLRHFEDDFSN-QIIYTTHSPFMV 417
33 1.000e-28gi|395652508|ref|ZP_10440358.1| SMC domain-containing protein [Pseudomonas extremaustralis 14-3 substr. 14-3b]  clstr ali  13  3ISKLSVVNYRNFANTTLVL--SKGVNTIIGENGSGKTNLFRAIRLLLDDNMVRAAFKLDESDFHRGLEQWRGHWIIISLEFDEIGPDEAIQALFLIGDAAVGRATYNLIFRPKKEVRLKLASLDDGDLAGLAAIRQAITIADYETLFTGRSEANFGNEVVYKSLVGDFDNCVFSGEVDDPRIGSRLPVFLSVSQEVSFTFIQALRDVVAEFHNNRTNPLLTLLKSKSGEIAPATMAPIVAQVLALNNSIEALED--------VQTVRTDIRDTIKDAAGETYSPSSLSIKSDLSDEADKLFQSLKLFVGESAEGYEGGIHELSLGGANLIFLTLKLLEFKYQKAHNFLVIEEPEAHIHTHIQKTLFDRI--AYDDTQIIYSTHSTHI. 386
34 1.000e-28METAHIT MH0017 GL0031622 [Complete] locus=scaffold40842_1:5489:7039:-  ali  14  10IKNFKIRNFRGYK--GEVTIDFDNFTAFVGKNDIGKSSVLEALDIFFNDG-----------------KGIVKQDKDDINKQALAEGDTDIVITACFEELPERIVIDATNETSLAEELLLNEEGQLEIEKRYPNAGSAKVFIRAYHPTNAQCNGLLQKTDKDLRKIIDDNGIACDDRTRNAVMRRAIWEHYRDDWQLGLTEIDVTKGETKSIWDKLQK-YLPVYSLFQSDRKNTDSDSEVQDPLQEAVKQILSEERLQEELAAIAMEVERKLEEVSSRTLEKLREMSPEVANSLNPVISSLKWSDVFKKVSISGDEGIPVNKRGSGVKRLILLNFFRAEAENANASIIYAIEEPETSQHTENQKKLIEALLELSNSTQVIITTHSANVV 387
35 1.000e-28METAHIT MH0026 GL0012358 [Complete] locus=scaffold39635_2:5675:7327:+  ali  14  38IKNVAIKNFRGYSDE--INSDFEDLTAFVGKNDIGKSTILEALDMFFNDG-----------------KGVTKLDKADLNVESKARQETDISIRVCFTDLPEKIVIDTTNETSLSAEYLLNSDGLLEVVKRYPNAGTPKVFICAMHPTNPECADLLTKKDSDLRKIIETRDIPCEDKTRNAAMRTAIWSYYGDDLQVNSVELDVTKGDAKPIWEKLQK-YLPVYSLFQADRKNSDSDSEVQDPLHAAVKEILQDEGISQTLDHVAEIVEGKLQEVATRTLEKLREMSPDIANTLSPVISSLKWADVFKAVTISGDESIPINKRGSGSKRLILLNFFRAEVERRKDGIIYAIEEPETSQHSENQKKLINALITLSSNVQVIITTHSAVLV 415
36 2.000e-28gi|284038985|ref|YP_003388915.1| hypothetical protein Slin_4129 [Spirosoma linguale DSM 74]  clstr ali  22  5LQSFRVTNFRSIVDSGEIRI--NDCTCLVGTNESGKTNLLIALQKLNPSNRKEYITFDTNSGKEPFIRATFRLDEAIYDVNFPDSFLGQYPNKYIHALLSTFYDQYLTSDLITRDKEEITQDLREFIERLIYDVYNLISQLDEFITVKYSRRQTFRLFVDEQLKTPLENIARLLTNKRIVLTPEQQRLFIDQLPRFVYYTDYGNLDAEIYLPHVIQNSSRQDLGFKERAKVRTLKVLFDFVQLKPEEILELGSEISQTKVITRDSENKKKREVILQAASARLTKAFQEWWRQGNYRFRFQADGNHFRIWVSDEKEEIELDGRSKGLQWFFSFFLTFAEQANGHSNCILLLDEPGLSLHPIAQQDLLTFLHSLSPNNQLIYTTHSPFLI 463
37 2.000e-28gi|324999264|ref|ZP_08120376.1| hypothetical protein PseP1_10886 [Pseudonocardia sp. P1]  clstr ali  26  63.......................................................................................................................................................................................................................IWNRAPAFILFSE-EDRSIRSSYDFDEQTPPAALENLAGMASLNLDLIAFGDIARRRTKIVQANKRMDEIFEASWRQSRLSVHFDVDGDKLRIELMENGADVTVDERSAGLRMFVAL-IAFLKIHGSSQPPILLIDEAENHLHIDAQADLVNMFASQEHAIKVIYSTHSPACL 241
38 3.000e-28gi|398878929|ref|ZP_10634033.1| putative ATP-dependent endonuclease of the OLD family [Pseudomonas sp. GM67]  clstr ali  14  3LKSVKLTHFRGYRHTTLIPID-EAMTGIVGRNDYGKSTILEALAIFFET--------DGAKPDKSDMNCFSLAEGADQFEIACEFDGLPDRMVLDENAETTLTDEFLLNADGVLEIVKSFKASTGKLDRTAIRCQHPADAQLATLLSLKMVDLKKLGEQRGVAESVADKRVAALWRKAIRTAAGQID-----CQETLLDVSKALSADNKSIWDKIEAQ-LPIFALFKADRESSDGD--AEAKNPLQQAVKEAQAELQEQISELEKKIETSVLDVANRTLEKLREMAPELANELTPRFKEKPKWSFSFTLDGENG--IPINKRGSGVRRLILLNFFRAEAEKSQRDVIYAIEEPETSQHPNYQMMLMKALLELSHNRQIILTTHVPAL. 376
39 3.000e-28gi|398990904|ref|ZP_10694067.1| hypothetical protein PMI23_04559 [Pseudomonas sp. GM24]  clstr ali  20  3LESFRVRNYRSINDSG--EIAVSRITALLGRNESGKSNLLRALHSLNPIDFPRHRRLEECTDDTPVLSTTWVLDDDDKEALLEEVSLVIVGRSYGSLRTVRFPELKAIVFDETDIKNXXXXXXXXXXXXXLKQETPSALDAAADAFEKVATATRLRDTWASQMVAAANALRTALAGADAELTDKQEETLSELEELADSIVFDKDAQQQAKFIYIDEYPELDGHQDIAAYIQRKSQGQLEDADRNFEKLCKVAGLNPDELQKLHGQNDHETRNQLANRASAVVTGEIKRLWKDRALKIRFNLDGPHIDTIISDYDVEVNLNDRSRGFQWFFAFYITFSADTDHAENAVLLLDEPGLYLHAKSQSDLLHHLEVDFSN-QILYSTHSPFMV 418
40 4.000e-28gi|322420367|ref|YP_004199590.1| hypothetical protein GM18_2870 [Geobacter sp. M18]  clstr ali  18  3LIKVRVQNYRSVEDSEEFDI--GNLTCLVGKNEAGKTALLSALRALRPSKSQSFELDEIIDYPRRFSTRFDDRHPDGQAEVVRAWWSLDQTDKDRVEQRFGQGVLKSDVFQEHYGFRYDDKTRLWDIDVDEAKCLEHLVNKHALDATERNVLHGVKDGKGADKALSALTQRTPKQDVLLQDIKQNRQSRFVLGVIDVLSAKQPCFFYTSHFERMSGIVSLNKLQEDQQNQSVYIGDKI---------FLSFLEYAGTTLEELTKADRRESLKAKCEAASNEITEEIFQFWSQNNALEVVIEIDTDIRIRNTNHKATLPLSERSAGFVWFFSFLAQFKQLKKTECNAIILLDEPGLTLHGKAQGDLLRYIVELLPDHQVIFTTHSPFMI 395
41 7.000e-28gi|377561943|ref|ZP_09791366.1| hypothetical protein GOOTI_224_00050 [Gordonia otitidis NBRC 100426]  clstr ali  18  43................EIDIDPE-VTAIVGANESGKSHLIGATMRALSGADISSGDF-------CRYSQLYSVEVGEIR--SPDFGAEFVL----------------TAQDDVDALRAAGVKLALDDRVTLLRMGAGDNMLIQKGHPPAPLDASTLAGLQAVLPKPFQLETRARIPDVIS-----FDALLDRKPGLLSRRRDRFKFDDNLRSGGISS--WPQLINGIAGVADPAENPVELEDTSVAKLLLNVARISPSKFSELECAIRDGKEGQVGALIEQMNRNFRRWWRQDRDELRLAPREREVAFTIRDKGTDYSFSERSRGLTYFLGYYVQLRAHERSTHTEVLLMDEPDAYLSSAAQADLLRVLDEFARTDQVIYVTHSPFLI 403
42 8.000e-28gi|402772993|ref|YP_006592530.1| ATP-dependent OLD family endonuclease [Methylocystis sp. SC2]  clstr ali  24  3LTGFQVKNFRSVVDSG--WIETDGVTALVGVNESGKTNLLLPLWKLNPA---QEGELKPTSDYPKANYGAVRANPSEFQFITAEFDIVRVSRNFDEEYSISFPKHQQVRSRKASDIRSLIEGAISEIEATKPELLKALATLNAEIIVDEIGAAEIAELLSILKKSNPSSPASTSYARLAEELAEIAEKINAPAPSDVEGVLDYVIERIPRFVYYSNYGNLDSEIYLPHVVDNLKRTDLGAREAAKARTLRVLFSFVRLKPQEILEEKKRERTILLNSAGTDLTKRFKDWWKQGDYTFEFQADGNHFRIWVSDAREKVELEDRSTGLQWFLSFYLVFLVESKDHENAILLLDEPGLSLHPLAQRDLSAFFENLSATNQILYTTHSPFLV 444
43 9.000e-28gi|149204084|ref|ZP_01881052.1| hypothetical protein RTM1035_11200 [Roseovarius sp. TM1035]  clstr ali  18  3LKTVRIDHFKHVLDSTEVAIQP-DITCLVGKNESGKSAFLEALRRLKPAQGAASFSSPTQYPAWLEKRHRREAKAKGRDLDEKSPINATFTLESEDIAAVEARFGEAVLLSETFTIRRKYTNKYAGVFEVDEAKAVVNLLAQIELPTALEPLNSCETFSALRAKVASLSPDGGEESAITLALAEVTKATNELLPDDTTLWQSVWLVLFARVPQFFY--FSEYSSLPSTVPIRELLEADEDKLEDDEQTALALLQLAEFEKDHLLDADYETRKRELQNVANELGEQVLDYWTTNNNGQTTVIDELHIRMWDDQHKLSLRFDERSSGFRWFFSFLTAFSRYEFDDTPIIILLDEPGLGLHATAQRDFLRFIEELSQRCQVIYTTHSPFMI 404
44 1.000e-27gi|152983368|ref|YP_001354853.1| hypothetical protein mma_3163 [Janthinobacterium sp. Marseille]  clstr ali  20  3LRSFRVTNFRSIIDTGWVNFSTDGITILVGQNESGKTSILEALSKTFNNQDEITSDDLRIGADLPAVKIQVELDEGELNEELKEFDSAEVDVFKRACKEHAGKITVRFGWKKNDETTEGFIATVGLEEGSFTSTFDLLMKTHSEKKAQEAFVISTIQSLASNLVAAGEGGVRNESAEKDSSHTKSVAISHFDIALAIYNIAPTATLFDSVSGLLPKTVDIDEKNQLVGDGAIAAQNFLKIADLQLDTLIKSDLRSRTHLINRANQQISSDFATFWSQTIGRKDQLLQCEMEVYGTDTPEKVGKSYLVFWISDGLTRLYPHQRSQGVRWFVSFYLQLKASEKLKSKRLFLLDEPGANLHSKAQGDVLKLINQLSKDIPIVYSTHSPHMI 391
45 1.000e-27gi|372489464|ref|YP_005029029.1| hypothetical protein Dsui_2850 [Dechlorosoma suillum PS]  clstr ali  18  3LKSFRVRNYRSINDSG--EIMASRITALLGRNESGKSNLLRALHSLNPISGFEALKPIKDFPRHKRLEECWILDDDDKEALLEVIPRVVIERKYGKTRTVDFPELKAIPFNEADTKSKVKKIAAAVRAAAQKQEAPAVLDAAADAYETASSATRVRDTWASQAAAAAKVLRDTELTDKQDEKLSELEELADNIVGDKEAQQRARNWAVGAIPKFIEYPELDGHQDIAAYVQRKSQSQLNLSDNNFEKLCKVAGFNPEELHKLHGQNDYETRNQLANRASAVVTGEIKRLWKDRPLKIRFNLDAHHLDTIISDPDVEVNLNDRSRGFQWFFAFYITFSADTDHAENAVLLLDEPGLYLHAKSQSDLLHHLEVDFSN-QILYSTHSPFMV 418
46 1.000e-27gi|422018667|ref|ZP_16365223.1| SMC domain-containing protein [Providencia alcalifaciens Dmel2]  clstr ali  13  3ISKLTLVNYRNFKNTSLQF--HKGVNTIIGENGSGKSNILRAIRLLLDDTMVRAAYRLDESDFSRSLGQWQGHWIIISMEFEEITTDESVQALFLVDDGPIHKATYNLIFRPKKEIRLKLASLGTFEDEQLSEIRDAITIDDYETIFTGRSWADFSNPAVYKSIVGDFDICDFSPETEFPEIGAKVPGFLSVTKEVSLTFIQALRDVVSEFHNNRTNPLLTLLKSKSGEINPATMEPITEMVRELNTSIEGLED--------VQSVRNHIRETIKDAAGETYSPASLSIKSDLPEESDKLFQSLRLFVGESEEGYEGAIHELSLGGANLIYLTLKLLEFKYQREKNFLLIEEPEAHIHTHIQKTLFDRI--TYSDAQIIYTTHSTHI. 386
47 1.000e-27METAHIT MH0014 GL0131241 [Lack 5`-end] locus=scaffold76311_11:2:1570:+  ali  14  12IKSITIKNFRSYAAETTIHF--DDFTAFVGRNDIGKSTVLEALDIFFYDG-----------------KGLVKLDKNDVNVSERAGDKTDISISVCFCNLPATIIIDATNETTLQDEHLLNKDGLLEITKRFPNGGSPKISICAMHPTNPDCCDLLSKKDSDLKKLIKAKSIPCDDYARNASMRTAIWQYYAEDLRIEPVEIDVTKGDTKSIWDKLQKS-LPLYSLFQSDRKNSDTDSEVQDPLREAVKEILCDEALRSTLDEVAATVETKLQDVASRTLEKLREMNPDVANTLSPIIDALKWADVFKSVSIAGDESIPINKRGSGTKRLILLNFFRAEVERRQTEAIYAIEEPETSQHSENQKRLIQALSELAKNVQVIITTHSATIV 389
48 1.000e-27gi|240147291|ref|ZP_04745892.1| conserved hypothetical protein [Roseburia intestinalis L1-82]  clstr ali  14  3IESIKIKNFRSYKEETI--IRFDNLTVLVGRNDIGKSTILEALDIFFNDGG-----------------GIIKIDKSDLNIQAARNGDSETVISVCFSELPESIIIDSAVQTTLADEYMLNADGLLEVVKKYKNGGKASVFIHAKHPMNPDCKDLLLKKNAELKSIIKGMGIECENQRINTTMRRAIWEHYEGSLDLQDMEIDVSKEDAKKIWDKL-SSYMPVYSLFQSDRKNSDGDSEVQDPLKEAVKQIINDEELQQTLASVAEVVETKLKEVSSRTLEKLREMDPAVANSLNPVIDKLKWADVFKAVSISGDEDIPINKRGSGVKRLVLLNFFRAEAERDSTGIIYAIEEPETSQHSNNQRVLIKALKELAQNTQILLTTHSPVIV 380
49 2.000e-27gi|307128827|ref|YP_003880843.1| ATP-binding protein [Dickeya dadantii 3937]  clstr ali  15  26IKQFRLHNVGRFTSLDALIDYPSNVTVLVGNNGAGKTSILQALATSLSWLVARVRSEKGSGSGINEGTITNGHTSAAIEVMAQDTP----------PLSGHAADNDAEYHWTLAKTRSGKKGQHTSQLNAVSALADHYRSALTQNEQSSLPLIAFYPVERSVLDIPLKIKNKHHFQQVDGYDNALNQGVDFRRFFEWFREREDIENENDGVVLTNLFESNPEGVLKVFEDIEDADYRVDKLEIFDWAGLSEEFKKLNNALKLMQEVQDKAKDPQLNAVRSAITAFMPGFSNLKV------RRKPRLHMSVDKNGEAFNVLQLSQGEKSLMALVGDIARRLAIMNPTIVLIDEVDMHLHPSWQRSIIERLTTTFPHCQFILTTHSPLVI 410
50 2.000e-27gi|20803919|emb|CAD31497.1| HYPOTHETICAL PROTEIN [Mesorhizobium loti R7A]  clstr ali  21  3LKKARITNYRSVKDSGSIELEPNK-TILVGPNEAGKSALLKALQQINPGDYNDITSKRLKPEDIKVAVAHFELEDDDKKAIESEFHSATYVCWRNLDNSWGHELQGVPEKPTIEDLKKDLARLAAHVDSRQKDGEPQPSKELEGILAGYKDKNYYIQGEVATKLIDWLEKHYPLVDEDDEKEEDRYTRLLGHCKYADRLKTTRTALRTKLPVFVLFSNYFRVRPLIHLDHLATRVEQNLLDDAQYDYGNQCLLKLKDTDAQKKYRDQLDNRAYQLNAASVRLTDQIVKVWNPNPSRLRITADGQYLKVVVEDGGVEIELDQRSEGFQWLVSFFVVFFSETEDKHNAILLLDEPGMSLHALKQRDFRNTISMLSESNQTVYTTHSPFLV 430
51 5.000e-27gi|296123944|ref|YP_003631722.1| SMC domain-containing protein [Planctomyces limnophilus DSM 3776]  clstr ali  15  3ISQVRIQNFRSFRDETVHF---DNYTCFVGSNGSGKSTILMALNVFFRNSSSSVTDVVNLGAEDFHHRDTSKPIVITLTFTCLTAEAIDDLGLYYRQGQLTISAKAIWNEKTSYAEVRQFGQRMVMEDFSPYFKADEEGKKAAELKQIYDDIQKTYSELPNATTGPSRVAALRAYEESHPELCSLI-----ESAHQFFGFTKGSNLLSKYIQWVYIPAVKEASTEQEEGSKTALGQLFQRSIRTKVSFKESIARLRNGLEKQYRELLDSEKSALDELSGNIQERLREWANPNANLQLSWYFDPNKTVVVQEEDNFIGEVARLGHGMQRLVALLHELAMGGGESGPTLILMEEPELYQHPSQAMHIADVLQELSENSQVMISTHSPYFV 397
52 1.000e-26gi|408373944|ref|ZP_11171636.1| hypothetical protein A11A3_07653 [Alcanivorax hongdengensis A-11-3]  clstr ali  17  3LTKVQVTNFRSVEDSGEFHV--GALTCLVGKNEAGKTAILNAIQGIAPSDDDYEYDKTRDYPR-RYLSKFQERHPKEVSPVAQSWWQLEDDDTEALEDLLGADVLESNEIIITSHIGRGNTWTIRVNEKECISKLQARHGLNVKDKGDLKQVKTVKDALTTLKGLPERTEAQTALMQAIEKFRDGSPVL---AAIDLLNERKPTFFYTSHFERMSGEISLNQLAEDKKHGKISSGDKI---------FLDFLEYAGTTIEELRDAAKHEELVAQCEGASNDITDEIFEFWSQNDLAIKIEINEGKIRIENKHHRVTVPLSERSAGFVWFFSFLAQFKQLKKSAGKAIILLDEPGLTLHGKAQSDLLRYIEEILPEHQVIYTTHSPFMV 391
53 1.000e-26gi|269836261|ref|YP_003318489.1| hypothetical protein Sthe_0228 [Sphaerobacter thermophilus DSM 20745]  clstr ali  20  3LTSFRVQYFRNIIDSTTVEVQP-DITCLVGKNESGKSALLEALY-MLNPAYPAAFDQSEHYPRWIWADDRKRGVVDAVVPITASFELEQDDLRAVEDRFGPEVLSGSTFEVSKTYSGAVVAKCHANEQAIVTNTLNRLN--------VGSATRKRLRSCHDFDALLTKLAQLSNVDDLSEEEKSDLRRIKEEISKVPGSGRTVHDAVAD-----LLRHRMPLFFYFSEYSILEGRIDLADLNSSSKQTARALLKLAGTDLNALRDDNYEIRKAELEAVSNHLTRQVFQYWKELSVNLDLDKRYLDVRVHDRRYGYTNNFGQRSSGFQWXXXXXXXXXXXXHSDEKVIVLLDEPALGLHGRAQHDFLRFIEELAPKVQVLYTTHSPFMV 400
54 2.000e-26gi|188535876|ref|YP_001905936.1| Predicted ATP-dependent endonuclease of the OLD family [Erwinia tasmaniensis Et1/99]  clstr ali  16  3LKKIKLTNFRGYRNTIEIPVD-EAMTGIVGRNDFGKSTILEALAIFF--------EIDGIKADKNDMNCFSMANGDTHFEISCEFDDLPPVILIDERVSTTLASEHLLNSHECFEIVKTFKATTTGKPDKTYIRCQHPVN--EPLNNLLGMKISELKAIGKDVEQKVEDKRTASLWRQAIRDA----AMPYECAEILLDVDKGLGTETKSIWGRIL-EQLPTFALFKADRESSDGD--SEAKNPLQQAVKDAQAALQGKISALEQEIQDSVLDVAGRTLDKLREMAPELANELTPRFKEKPKWTFNFTLDGENG--IPINKRGSGVRRLILLNFFRAEAEKAPRNVIYAIEEPETSQHPNYQIMLMKALLLLSPNRQIIVTTHVPAL. 375
55 2.000e-26gi|423410010|ref|ZP_17387158.1| hypothetical protein ICY_04694 [Bacillus cereus BAG2X1-3]  clstr ali  14  3LHSLQIQGLRKHMDTSIHF---ADTTFLIGRNNIGKSTVFKALEYLLSDVRK---LEDNDFASILNQEQTANEILTDKITLTAEFRDCPPEAKSWRGIKGRIFLYDTTNYPGESGLKIFYRKTFERGENVVIEMKQCKRTIKECFTKTLEDYIKSGLDEQIIIELFKGEDIHKNLVKTQQTKLMELDELYDIDDTTEEWVKNPGGIVGNVLSRLPRFLLIPAQDKVDELSSTNLVKTLNSLFDEVREASPNFKEAQKYLNLLQLELDPSDETSSFGSMMKELNHILSDVFPQIRLMAEPNLSDANRVIKPQFDDVNTPIENQGTGVIRSAAFAMLRYRNMREARSLIIAFEEPEIYLHPNAAHQLRDTIYELAPNNQIICTTHSPFMI 399
56 3.000e-26METAHIT MH0020 GL0009249 [Complete] locus=scaffold46291_1:476:2035:+  ali  14  3LTTLKLKNFRGYRGETV--VGFDDLTAFVGKNDVGKSTILEALDIFFNDKNS-----------------VAKIEKGDINKQSQQDGDTDICISACFSELPERIVIDSSNETSFSAEYLLNESSELEIVKKYPNGGTAKVYVRANHPKNPMCCDLLSKTNAELKKLLNEQHIDCDDRTKNACIRTAIWRHYSDDLQLEPTEIELSKGDGKSIKEKVLSQ-LPAYALFQADRKNCDGDSEIQDPLKVATKTIMQSPEVADKLAEVANLVRSQLRDVAQRTLDKLREMDQDVANSLTPVIDTLKWWDVFKSVTITGDNDIPINKRGSGVRRLILLSFDRAREATDNQSIIYAIEEPETSQHAHNQQVLINSLKEISPGVQVILTTHSGFVV 379
57 3.000e-26gi|383457187|ref|YP_005371176.1| ATPase [Corallococcus coralloides DSM 2259]  clstr ali  16  4LTSIQVTNLFGYLNHEINLEEERGITILHGANGTGKTTILRAIEQLSRSIPQFLMNVNFKNIKLSFHDKSSMVVRKDDKQLTIDLYQGGKQTNTVNTKSIYPKHGFDLLPRYIHEIETYNLELSRIVSRQSTNIPPWLTLFWKNFECTLIEEQRLLRIIEERKRGLFKRVVEDYADALRAKFKDALSAYAEHSQQLDRTFPRRVIEALESAPPPPDALTARLERIEKRRQELHSAGLIEKETALTWFDYQKLSRGEVATTLSVYAADTESKLNKFDEIHKKITTFENLINSHLTHKTARLSKDSGLEFTISNTGAKLDPASLSSGEQHMLVLFFELIF-GRFQPGHLVLIDEPELSLHPAWQLRFIDDLEKVINKVDFILATHSPQII 419
58 4.000e-26gi|149174335|ref|ZP_01852962.1| hypothetical protein PM8797T_03274 [Planctomyces maris DSM 8797]  clstr ali  19  3LISAQITNFRSITDSGIFSIDP-KVTCLVGKNESGKTAILQALEKINPLDSSHREFRSLDFPRARLTEFRTRQDEEEDVHSVTTFWKLDDSDVKAVEEIVGEGVLKSREIKISRGYYNSTYWIFNQDEKKGFENLLDESSLEEKDSIRLTGSIKKAKEYILSKSKTAEEGGGEIRSKREEELLETINDYYGTKASSWQAIVDVLHERLPKMVYFGNYMTMPGQISIEDLNKEEPNKVFLALLSLINKTPEDLVEIGEFEQAELEAASSSLTREIFNYWTQNRNLRVQFRFEQGMPNDPAPFNSGYVMRTRIENGVTTSFDDRSTGFVWFFSFLVWFSVRKNYGKNLIILLDEPGLSLHAKAQADLLRYIEERLKEFQVTFTTHSPFMI 403
59 4.000e-26gi|383766763|ref|YP_005445744.1| hypothetical protein PSMK_16880 [Phycisphaera mikurensis NBRC 102666]  clstr ali  22  64.....................EKEITTIVGANESGKSQLLRAIEIALSGDGIKHEDF-------CRYSPFFSAKTGMMAKVEMHNANELEAQYFGKKQEASSTRSGRIYFFTGQDLYRAGEDGFEEVKLDAKKAASFRKLLPRTIRLREQAELPDTLSVRFLVDGEAEQVPSRLTRESRRLIEAEG----EGAKLALAAYDASKKTSPAAAIPAAVKNLVDAIQYEERSKEADMRLARDLLLKAAGIDAKAFGEVMRS----VEGNKEGYADGVMSTINRELDEDFPNVWAQDKDRIELSLRETDLAFVIRDRGTTYSFDERSSGLKHFLAYYAQLTHVNPDGRPEVLLMDEPDAYLSASAQQDLLKILDDFSPKMQVLMVTHSPYLI 434
60 4.000e-26gi|326332586|ref|ZP_08198854.1| hypothetical protein NBCG_04030 [Nocardioidaceae bacterium Broad-1]  clstr ali  17  4.SRVEITGFRRLARTGTSI--DGPLTAFVGFNEAGKTTLLDALTWFTDGGAISRIDYNRSRGTTKVVKVFYELDADDQTLF---------ASIPMDHRPTSLVLYRDTDGDRFRELIPSPTRPXXXXXXXLERLAVAKVRLARQLEEAVDEEAEDVNDWIDTLETALTNPDSEWSDASLRAVDGIIAWLGEVPTRRKQPRDAKLSNLLGTVSDLVKSERTPPFVLFNDRLLETSYEINPDQRASIHPAVTRLLALAKVDLDTLWVGDSTKRETLLEHGNQRLGAIFGQAWNQSKVAVRFNVNGSRLEVLVKETGDVTSISERSDGLKVFVALV-AFLEAGEHAVPPVLLIDEAETHLHYDAQADLVSALLKSVDTTQVFYTTHSP... 400
61 4.000e-26gi|311744623|ref|ZP_07718422.1| Kae1-associated kinase [Aeromicrobium marinum DSM 15272]  clstr ali  19  47.....................DSEVTAIVGANEAGKSQLLTAIKAALSGTPIERADF-------CRYSERYSAKTNEIRL--PEFGGTFTLEP----GEPNLDPSTGLADVREFTLYRPGSGAPFVVANNLR-IEMSPSAISA-----LVPLLPSFHELRTDLAIPNSVSIAELAGEERHRMHDR---------KQRTGLLAELSALAAPTAEAVAAKLVPRLVAAEDEASIEAE---SKRRAEFELARQLLVDAAGIDQSMFVELREAIRSGREGQVNSAIKENIQRWWTQDRDDLLVEAREQELAFTIRDRNSKYSFDERSQGLRFFLSYFVQLTARLKNVKADILLLDEPDAFLSSIGQQDLLRVLEDATPRSQVVYVTHSPFLI 400
62 6.000e-26gi|343509030|ref|ZP_08746325.1| hypothetical protein VIS19158_04286 [Vibrio scophthalmi LMG 19158]  clstr ali  14  3LISLTLENYRGYQERTT--IEVSDLTALIGKNDIGKTTLLDALGVFFNHKLCKFDATD----------KCVYSGEQDDVLIGCEFSNLPEQLILDERANTTLQNEFLLNERGNLELFRIFK-------KGKGNGEYAAWCVHPSAKDAKGILYKKNDQLKAIAERRSVNVEDQRVNALLRQGIYGSIEDLKLTPQMIPLKAEDGKSVWERI-----SSYLPHFALFRADRPSTDEE--AEVQDPMKAAVSNALSELDTELENIKQVVREKTLAVAADTISHLNDIDSKLASELIPEFKVEPNWGSIFKLSLIGNDGVHINKRGSGVRRLILISFERIKRDNSKKGVIYAIEEPETSQHPSYQQMLVDAFKELSEDCQVILTTHVPAL. 370
63 6.000e-26gi|323341753|ref|ZP_08081986.1| hypothetical protein HMPREF0357_10166 [Erysipelothrix rhusiopathiae ATCC 19414]  clstr ali  24  3IKEIEIENYKGITDKVRISIG-RKIVPIVGMNESGKTTIIEAIYAFDNGNDELNNGSHVNENKDAKISFHIKDNIVFIIYIEEQMEMIYLDVENHCNKIIDISKNNESYESQLVDIKEIIEESRAQKKGKLKEYRLSFDSNEASILTICLKKLETIKVFRNLTSQFLEIDEYVITRVF-PDGKKELS--YYTLENSNIPELEDKTYYDSVIDEIVKSVSLPQLIYIDEFSKPPKSRIQLNDKNDWYKIFNNVFKQVSLDITKMLDLEKNNQDMFLEDVSLTLSNTFKNAWKDDKENIKFKLDLNSIRIVEVKEGLSYSISERSKGFIWYYNFIMNIPSYKKNANCTIFLIDEPGAYLHSTAQTELLNNLVYQAVDNYIIYTTHSPALL 459
64 9.000e-26gi|239906972|ref|YP_002953713.1| hypothetical protein DMR_23360 [Desulfovibrio magneticus RS-1]  clstr ali  14  13LHSLCLRNFRRIKQATILF---GDTTFLIGPNNVGKSTVLAAIGCLLS---VSESLSEFDYNCEGEVCAEEIVDKCTECSIEAEFRNLPVEANSWRGFKGRLIRYETKNENDSGLSVVFRKSFSKSSKSCIREMKCYSRVKKSEFENIVKARDLIDRIDSELVEELFPELDKKLSKAQLEKLEEINDIWIVDDSGVSEWVNNPGGIHSVVISKLPLYIKIPAEHSALDQKSGELATFMNELFREIREASDNYGKAVKYLALLAEELNPEDQESEFSRMMDDLNGVINSVFPESKLHNDADKSLVPVFTINMSSNVKTPVAYQGTGMIRIFALLEWIHKRKGLSRPLIIGFEEPEIYLHPNAANQMRDTIYDLSGSSQIICTSHSPYMI 409
65 1.000e-25gi|88603058|ref|YP_503236.1| hypothetical protein Mhun_1796 [Methanospirillum hungatei JF-1]  clstr ali  21  3LAEFRVQNYKIIEDTGWVPV--QNLTTFVGKNESGKSAIFRALSKLNPSDGEGYDGLKEFPRQRYAAEIDEQRDIAAISELCNEVRSVEVTRHYTGTYSITYHPDVGVDLVTPPDLIYAIESAIEHIRNLIEGKGEELGRIKEGLLAFLEEQKGAIPVEGQVHKRHIADLINAIKSRANEPWQHDILDPVTEPMYRLVRQIEIFEGLMAA--NRYVIEHLPKFVYFDQYNVIESAIHIPTFNLDLDQLDRLGSHKNAVDDNPIIRRQVDERSILLSTASNLMTKKFEDWWGQRKIRFRYDIDGDYFRVWVSDDLDEIELEQRSAGLQYFFSFYLVFLVESGDAQDSILLLDEPGLQLHPTAQQQATRFFERISHQNQIFFSTHSPFMI 430
66 1.000e-25gi|385235314|ref|YP_005796654.1| hypothetical protein KVU_PA0023 [Ketogulonicigenium vulgare WSH-001]  clstr ali  12  3LHNVKIENFRLLQDVEIGFE--DRTTLIVGRNNSGKTSIAELFRRLLSEKTLTFRLEDFSLGCHEKFWNAFEAFSAGAEVSDVLDTLPVIRIIIDVSYDVDMPDLGAL---GDCIIDLNPDCTYGRLVLTFGPRPDATTFLFADLPAPEEDAENARSALFRALGARVSATYISILEAIDPNDPTNRKPLETKVLTAIIQGGFINAQRGLGDDTKRERDVLGKVVEILFQSALSDPT-----DPEKRTTAEQLKSAVEDIQSDLHSDFNVKLTSLLPTFELFGYPGLADLITETSFDVERLLSDHTKVRYVGKNGITLPETYNGLGVRNLVFMLLQLLRFFTAAGVHLIFIEEPEAHLHPQMQEVFIRQLTQLNDNVQFVVTTHSPHM. 400
67 1.000e-25Oral.Meta HOMD pdenta_c_4_17 Prevotella dentalis DSM 3688 [3804 - 4640] AAA ATPase  ali  13  6......................................................................................................................................KYADYIKQIEIESLWSGQKHVVWNLDRQVNILSGVNGVGKSTILNKVVKGLAAGGEFPSHMIKGVHLKVEPADAKWIRYDIIRSFDRPLMHSDAVTKMDLSLATELDWQLFQLQRKYLDYQVNVGNRIIEALQTCGTDAPLQQRLAEPKRKFQDFIDSLFADTGKTIIRTENEIRFSQLGETLVPYQLSSGEKQILAIL--LTVLVEDNQNYVLFMDEPEVSMHVEWQKQLIDLILALNPNVQVILTTHSPAVV 258
68 1.000e-25gi|424868034|ref|ZP_18291802.1| uncharacterized protein [Leptospirillum sp. Group II `C75`]  clstr ali  20  3LTKIHVTNFRSVEDSG--EFDLGQVLCLVGKNEAGKTAILQALAGLNP-----HPLTPVNYDLERDYPRRWLTEYDNRHKESDAMVVSTKWELSEGERKAIKEIIGDALLDEPVTIYRRYRDTQPQW--KLPIDYGKAIEILISGEKLSEEERQPLSEAKNSDDLRKALEDVKERSPKQQRLLDKLNG--FPGKNVIGLVTNILKGSLPQFLYSSHYDRMVGQIRLDTYNARKQGQQQPPLEPGERVFIDFLEYAGTSIEEITTATTYESLNARCEAASNHITEQLQEYWTQNNLGIEVRVTKAEQRVRNNLHKLTLPFSERSAGFIWFFSFLVKFAQVRKTGENLVLLLDEPGLTLHGKAQADLLRYIEKLSPNHQVVYSTHSPFMV 395
69 1.000e-25gi|400288476|ref|ZP_10790508.1| SMC domain-containing protein [Psychrobacter sp. PAMC 21119]  clstr ali  14  4.KRLHLQNYGRFDDLNIDFEKTGNVTVIVGNNGAGKSQILQALATGLSWFVEKLSDENADGVELTQSDIKNNKHLSSVKVCIEDFSSIEKNKKWVE------ENIQADWKIDATTEKKFRPATYGLRVNRLSKVIRSYIHKFKNNEEVSLPIFAYYSVDRNIRNMAVEVRDNHINNQFAAYDDALKKTVNFDSFFS-------WFREREDIENEKRANSAKSDENQDESALIKSLKSKFEYPIGEGGKTLTKEELDPFMLNFITEFRMSFFSQLNKVDDRLLSSVRKSIGFFTSFENVHIRRQGTPTMIVEKDGEELDVNQLSQGEKSLLALVGDIARRLALLNPSLVMIDEMDLHLHPKWQHDLIDKFVKTFPNVQFILTTHSPHVI 390
70 1.000e-25gi|345007705|ref|YP_004800251.1| hypothetical protein Strvi_9521 [Streptomyces violaceusniger Tu 4113]  clstr ali  18  19LTRVRSRLYRNIVDSGDVDIAP-DVTALVGKNESGKTAMLSSIYRFHPVYPEHSFALGQDYPRWRKVKDTRSGQITDAKPITCTFT------------------LDDEDLKAVADVLGPGVITGRSYARSISYDGNHVLDLSIDEGAALENLYNDEEVLRSALGTRSLGAALEQAEGLEAAEDSDYTAADIDLFARAARQRLADRGSAWRRAAQILRDREPKFFYFSSYQNLPGRIALTDLNGQEEQTARALLELASTTAGALSAEDFEDRKAELESVSNDITQQVFEYWKQNDLSVEIDLDKTTIRVKDRRHGFTNNFSARSTGFQWFFSFLAAFSEFENYPHGVVVLLDEPGLSLHGRAQADFLRFINELAPQAQVIYTTHSPFMV 414
71 1.000e-25gi|418057836|ref|ZP_12695821.1| hypothetical protein MetexDRAFT_0556 [Methylobacterium extorquens DSM 13060]  clstr ali  36  1............................................................................................................................................................................................................................................................................................................................MPFSERSAGFIWFFSFLVKFAQVSKRGGNQILLLDEPGLTLHGKAQADLLRYFDRLLPKHQVVFSTHSPFMV 73
72 2.000e-25gi|282878426|ref|ZP_06287212.1| conserved hypothetical protein [Prevotella buccalis ATCC 35310]  clstr ali  15  2......................................................................................................................................KYADYIERVEIDSLWSGRKHVAWNLDRQVNVLSGVNGVGKSTILNRVIKSLSEGGDFNSHLPKGVHITVSPADATAIRYDIIRSFDRPLMSSEMVAKVDISLATELDWQLFQLQRKYLDYQVNIGNRIIEVLQKGGADAAVEAQRVSANKKFQDMVDKLFAETGKTIVRTENEIRFMQMGEKLLPYQLSSGEKQILAIL--LTVLVEDRLPYVLLMDEPEVSLHVDWQEQLIDLILQLNPNVQIILTTHSPAVI 254
73 2.000e-25gi|376003592|ref|ZP_09781401.1| putative Chromosome segregation ATPase [Arthrospira sp. PCC 8005]  clstr ali  15  10IQRVILTNFGLFKNLEISLQNPSNITVFVGKNGAGKSSILTALATSLSWFTARLRTEKGSGNPIPENSILNSANFASIE--------IEVYDNNHPSENADISQIHHQFKWTLAKAQKGRKSPYNSNLNDCTRLANIYRDDLSDNDQTSLPLIAFYPVERVVLDMPLKIRTKHSFKQLDGY-------------------------------DNALNQGVDFRRFFEWFREREDTENESAIPQDFWNEIRPLLQTDSTVWQQLQQLNASAKDRQLTAVRTAISRFMPDLDNLRV------RRKPRLYMAIDKNGETLNVAQLSQGEKSLMVLVGDIARRLAMLNPGIVLIDEVDLHLHPSWQRSFCDRLIDTFPNCQFVLTTHSPLII 365
74 2.000e-25gi|381153795|ref|ZP_09865663.1| hypothetical protein Metal_4018 [Methylomicrobium album BG8]  clstr ali  19  3LKQFRVTNFRSVEDSG--WIEAEKVTALIGVNESGKTNLLLALDTMFGAIRNSAGDYHFIKADFWTGTLSGKIISEDDAKIVRVIRFFDGSYSVEFPGFHRQTSIPRTEIISQLEGCATNIKAGQALKQEKELQVRLVEELADIVSQVPADDELRVINLEAVKQKIDALIPEEIIGQLSDWLDEAFERISSPQPGDKEGVNELVVSAIPSFVYYSNYGNLDSEIYLPHVVENLKRDDLGSKEAAKARTLRVLFSFVQLQPEEILEEKKRTRSILLQSAGATLTQKFRDWWKQGNYRFRFEADGNHFRIWVADDRREVELENRSTGLQWFLSFYLVFLVESQDHKRSILLLDEPGMSLHPLAQRDLSAFFESLAGTNQILYTSHSPFLV 447
75 2.000e-25METAHIT MH0012 GL0137710 [Lack both end] locus=C18583919_1:1:537:+  ali  33  18............................................................................................................................................................................................................................................................................DDKFNFVEDFNNKLDKEFNKFYKQENVKLKVNFDTESLNFVVKTNNKYLDLSERSNGLKWYLNMYIQLIAKTQKYENYIVLLDEPGVYLHVNAQKEILKLFENFSNDNQIIYTTQLPTMI 143
76 3.000e-25gi|222156738|ref|YP_002556877.1| hypothetical protein LF82_317 [Escherichia coli LF82]  clstr ali  11  3IHQVEIKNFRLLADAELVLEE--QTTVIVGRNNSGKTSLSEIIRRFLADGSATFQLEDFSSSCYDRFCDALEALKEGMEDHLVRELIPAIELRLKFQYDPAQPQLGPLSPFVIDLDPACSEAQVVVRYELKDGHLTQFLESHTEMPLSREDRLAFLRILRERIPNNFCVKIWAEDPNDPDNRRELPPSALRGL--VKSGFINAQRGLDDVTSRESDVLAKTVENLFATASSASAGTADKQIADALKGAVQDIQTQIDTNFGNQLNSLIPAL-----ETFGYPGLGGQELHTETLLDVSKLLSNFTKVRYSGYSGIALPESYNGLGTRNLIFILLQLAAEVTEPGVHLIFIEEPEAHLHPQMQEVFIRQLAKIAQQVQFVVSTHSPHI. 399
77 3.000e-25gi|423603842|ref|ZP_17579735.1| hypothetical protein IIK_00423 [Bacillus cereus VD102]  clstr ali  14  3LHSLRIQGLRKHFDTTIHF---GASTFLIGKNNIGKSTVFKALEYLLTDIKKIDANDEFCSTLNNEKTDNEILADEII--LTAEFRDCPRESRGWKGLKGRVFTYDNSKCPNESGLRIFYRKTFGRGKNVKIEMKQLKRTIKACFISCKTLEEYIQNGLDEIIEQLENVDKQKRLTPTEKTQLAILDELYDIDEGVEEWFENPGGIAGVVLSRLPNFLLIPAQDKVDELSSGSLLKTLNNLFSDVRNESANFKEAQKYLNLLQEELDPTDETKEFGKMMKDLNKVLDDVFPQTRLISDANKSIKPVFEVKMSSNVNTPIENQGTGVIRSAVFAMLRYRNMQNNAPLIIGFEEPEIYLHPNAAHQLRDTIYELASNNQIVCTTHSPFMI 400
78 3.000e-25gi|313200887|ref|YP_004039545.1| ATP-dependent endonuclease [Methylovorus sp. MP688]  clstr ali  16  3LHSYRLRNFRRLKDAHIEL--ADDISIFVGSNNSGKTSATQAIHAFVTGGRDRFSLYDFSSSCWKAFDEAGGINLAEPVPDGLSLPSIELDLWF-EVAASDLYLVIPLLPSTAWEGTKVGIRVSLAARNPINLIQNYQEAKAKGREQELPPGSEYVPWPRSLTDYLQRELKSEYELRYFILDRTHFDENFREIGDYIPEELSGEPGGGTILKSLIHIDSLGAQRHLADPNPEAGGRSEDLSKRLSRFYKRNLNQRQDDHTALKALFDSEQLNIHLDGVFKPMLDRLAKLGYPGINNPRLKIMSVHYQIGDGEDIATLPDSYNGLGFKNLIYMVVEILDAQNRPPLHLIFVEEPEAHLHAQLQQVFIRNVLELLNGSQMVITTHSPHIL 419
79 3.000e-25gi|302335014|ref|YP_003800221.1| hypothetical protein Olsu_0209 [Olsenella uli DSM 7084]  clstr ali  15  3IRSVEITNFRGYASETEVAM--DDLTVFVGKNDIGKSSVLEALDIFFNDGKGAV------KFDKSDINVENQKGGDQEASIAVVFADLPDEIVIDTTAKTNLKDSYLLNGEDKLEIVKKYKGTGAPKV--------YIKALHPTNSGCCDLLLKKNADLKKLVKQYKLE--EEVDTKSNVSMRAALWSHFSDDLKLQEIEIDISKEDAKAIWSKL-STYMPVYSLFQADRENSDSDSEVQDPLKESVKEVLNDLALKEELDEVAQKVREKLQEVANRTVDKLKEVDPEVASSLDPVIESLKWADVFKNVSITGDGDIPINKRGSGTKRLILLSFFRAEAESETNGVIYAIEEPETAQHTENQKKLIEALQELSKGVQVILTTHSPYIV 381
80 4.000e-25gi|161521384|ref|YP_001584811.1| ATP-dependent OLD family endonuclease [Burkholderia multivorans ATCC 17616]  clstr ali  18  3IQSVRIKNFRTLKDVAIPF---DSVTTLIGPNGTGKSTVLRALDWFFNGRPGLLTERDCSFGASDEDIEVQVTFDDLTEKDRAELGKYAPEGTTTFTAWKRRSKDGAESISANSKSYPPFNDIRSKGSAGDKKVEYN--------------RLRESDPSLGLPPWSSVDAANQAMTTWEANHTDQLIDAPESLQTNFFGFNSGGKMSGLFDFVLVTADLRASEESLDG--KSSIIGRILERSVDRAAADEEIAKIVEESRAKQQSVYAEKFKAQLEEMTAQLNDVVSSYSTVSPAEVELKAPRTTFEVAVLDGTTETAVERQGHGFQRTLLILQLLAQSGAASAEGVIAIEEPELFQHPIQAQTFAKVLRSLSKRIQVTYATHSPYFL 384
81 5.000e-25METAHIT MH0002 GL0066573 [Complete] locus=scaffold59143_2:17:1552:+  ali  13  3IKSLTLQNFRRYSNA--VTIEFENLTAFVGKNDVGKSSILEALDIFFNDG-----------------RGCIKLDKDDINKIEASRGNNEVSIAVCFENLPDTVVIDATNETTLESEYLLNESCQLEIVKKYPNAGSAKVFIRAYHPTNPNCSDLLLKKDSDLRKILSSQSIACEDQTRNAVMRKAIWERYSDDLQLETIDIDVTKSDAKTIWDKLQK-YLPLYTLFQADRKNTDGDSEVQDPLKEAVKEILADESLAATLRSVADEVERKLKEVSSRTLEKLREMSPDVANSLNPVITNLKWTDVFKGVSITGDNDIPINKRGSGVKRLVLLNFFRAEQERNAPSIVYAIEEPETSQHTENQRKLIHAFLTLSENTQIIITTHSASIV 380
82 5.000e-25gi|365882147|ref|ZP_09421415.1| ATP-dependent endonuclease of the OLD family-like protein [Bradyrhizobium sp. ORS 375]  clstr ali  14  3LERICIRNFRLLRRFSIDLARNKTTTVLVGPNNSGKTSVMEALQLFVGAGGEPRRRFSIHDFAHVRRKDFAHIESKLTAIGSEEIKLLRRFAPSIRMELKFRYADETADLVVANELLMSLEVTSDVIAVRIEYAIDNARGLWVDFKARTDKTQTLFEFLAGNLQLYYKVKTYKISEDGSKAQALDSNEVLNRLIK--IDTISAQRHLDDEEATGAAKLSRLLHDHYNRYYKVEHAEGAKDIEDAIKSSSETLTGKYVGAFGRLTGRLKTFGYPQGHASPDLLIKAEMTAEKIYRDSTRIYYASEHTSIGGVVTKYELPEKYNGLGYKNLIFIVLQLLESMPKDKPHIIALEEPEAHLHPQMQSVFIREISRALEHTQVILSTHSSHMV 403
83 5.000e-25gi|423130254|ref|ZP_17117929.1| hypothetical protein HMPREF9714_01329 [Myroides odoratimimus CCUG 12901]  clstr ali  14  3LESLKLKNFRGY--SQEIIIPFSNLTAFIGKNDAGKSTVLEALEIFFNNKIIVCEREDLS-----------INADNNNIEISCVFNDFPEEIVIDAAASTTLAAEYLLNAENKLEIKKIFSATAAKPKEKIFIVCNHPSA----------ENANDLMDLKRAELRQRADDLGIVANTYNRNINSSIREAIWQHVGDLNLIPTELLIDKEDSKKIYNTLESYLPIYALFQSDRQSNDDDKEVTDPMKIAIQQALQELEVELDYIKNQVRNKAIETADRTLAKLKEMAPDLAEELIPEFRTDPKFDSQFKLTIKSEDNIPINKRGSGVRRLILLNFFRAEAEKRRLGNIYAFEEPETSQHPNHQKMLIRAFIELSPNTQIILTTHTPTL. 373
84 6.000e-25gi|402833283|ref|ZP_10881903.1| AAA domain protein [Selenomonas sp. CM52]  clstr ali  13  8...........IGKIKKADIELKGITVIAGENNTGKSTVGKALYCIFNSFYHLDEQIEEARRDRLRTAIARVLPGEYLVRSDARRIQLWLESKPIEYPTLEEYPEFRKILEKNIRVFTPGEAKVVDISDDDVHKIGEEVKRIRSISQKEIYQRILSQWLKREFSNEVNCLPFVDEESARLKLSIREDEMEAIIKNHQVIQISDLRSLQTQAIYIESPFAMDSLSLIEDEFHFLRRSSFELRRIGVADHKEHLL----GCLRNKKKKSGADQVMGEILADRRMDKILRKLSEACDGEIELGGDVRASFRYVGKAGVELNLANLSTGMKAFL-LIKQLLQNESLEMKGVLIMDEPEVHLHPEWQILFAEVIVLLQKDMHILLTTHSPYFL 381
85 6.000e-25gi|410478064|ref|YP_006765701.1| hypothetical protein LFML04_0504 [Leptospirillum ferriphilum ML-04]  clstr ali  21  3LTHFRITKYRNIQDSG--WIALENLTAIVGKNEAGKTALLKALHKFNPFTPEPYNMDREWPRGHRRDRDPNEVALADLTDQKFTDESITVAKNYAGQFEVHFSEGVFPDRLHPNDVDQICETLPEPHPQVGNAFAEVAQACRAEAKRLYEGRFSEFQDLPKKHKEQLQAAFTAGNPQTQRQRESEFVPSYDNALNAVLGRLNNQPSIHEKAHE-FVIDLIPTFIYMSDYRAFTGTALLDQVKQRKDQRKLSMEDDLDDEVMKGNSRDREQRQYDLDDASQSLTNLIEGRWKQRKYEIQFRADGQHFYTMVKDDQGLIPLEERSKGFQWFFSFDLLFMHESNGTKGCVILLDEPGLHLHPDAQTDLLNRMEAYAQENTLVYTTHLPFLL 418
86 6.000e-25gi|254438413|ref|ZP_05051907.1| hypothetical protein OA307_3283 [Octadecabacter antarcticus 307]  clstr ali  33  325...........................................................................................................................................................................................................................................................................KRTRSILLQSAGAKLTGRFSEWWKQGDYQFRFEADGNHFRIWVADARREVELEHRSTGLQWFLSFFLVFLHEAKEHDNCVLLLDEPGHSLHPLAQRDLSAFFEGLSENNQIIYTTHSPFLV 448
87 7.000e-25gi|241763538|ref|ZP_04761590.1| conserved hypothetical protein [Acidovorax delafieldii 2AN]  clstr ali  16  3LKHIAISNFKGI---QADNLSPESFTCLVGENNAGKSSVMQAIVFALNPKNIPSAHFYDSSQPVSFDFELSGVTEAHLARLSDEAKGKIAGLIVDEELALRVAYAPGESVSIQVKAQQPKEERYRSDIDAALSGKKGQAAIEEALWSAYPEFKAAYSEPLKLLGTAKAFVKEQVAKLPPEQFTSGYTAL------PSGISASISPLLPEPIYIPAVKNLNDDLKTSQSTSFGRLLGLLLEDMAEDLVHVNTALEKVNSLFNRVTIEGKAKVRDLESEVEGLLSANFPNVRVQLEIPPPELKTILNAAQIFIDDGSHDLIDNKGDGIKRSLTFALLQAYVNRQDKPLIFLFEEPELYLHPRSQRVLFNTLARISENYQVLVTTHSPLF. 401
88 8.000e-25gi|256396025|ref|YP_003117589.1| ATP-dependent OLD family endonuclease [Catenulispora acidiphila DSM 44928]  clstr ali  13  3LTSIKIKNFRLLEDIEVGIDEI--ATLIVGRNNSGKTSLVNVFDKFFGDEDCTFVLEDFIADIKQAHEWWAKAEHEEPADGIDPESDLHMTLQLTVTYDEKENLAALSGMILDLDEECRDVVIEAVLEADQPENFLAEYHTAASHQELFVEHRWLRSNFLKFFKTSFYAVSVRGNPPARRPIKKSVIDNVLSVQFIYAQNKLDDSGTDRTRNLSKSFEDFHRAHSEDAERNHNIDGIDAALLTASQRVDKSFAALFTPIFDDLNFGVGNIEPVRVPKVVTKF-----DATSVFRGSTRIEYPAETGDMALPEGHHGLGYSKLIFTIVRIVDFYETHRRAVPRPAIQLLFIEEPEAHLHPQMQEAFIANIRDFLRNVQVIVTTHSPHI. 401
89 9.000e-25gi|89897383|ref|YP_520870.1| hypothetical protein DSY4637 [Desulfitobacterium hafniense Y51]  clstr ali  14  41ISRLKIQNYRCFQDVEIEFSE--GLNVIIGENNCGKTTILKALQCFFKGSNTGSA----MGIDDFNKGITIGEKPPEITFVLTIQSSKHEKAQDKAVVASWLTKLVSPWEATLTYKFFLPEADQKRYVADIRCIQDDDDR-----------NSKKWAVLERHLKKYTPRIYGGNYESKNRADQEYLDKFHCEVLDALRDVESKMFTGRNALLKQVLNFFVDSDLIEKEETERETLQVQRNQTFESTSSSLVANMIERVSVSKIFELTEKTGAAVGGQPTLGGQLDESDVLSVLKL------------MIKKETGIEVPIVNNGMGYNNLIYISLLLSKFKNAKVFPMLLIEEPEAHLHPALQYSFLRFLKDEMDKRQIFITTHSTHI. 411
90 9.000e-25gi|340616299|ref|YP_004734752.1| hypothetical protein zobellia_287 [Zobellia galactanivorans]  clstr ali  14  3LETVKIKNFRGYKTETIVPI--SNLTAFIGKNDAGKSTILEALEIFFNNSLVNCEKGDLNT-----------TADNNKIEITCVFTDFPADLIIDTANPTTLQNEYLLNLQNKLEIKKVFAATAAKPKEKVYIICNHPS----------VDNGNDLLTLKKAELKQRAKALGIPTENYNGNVNSSIREAIRNSFENLELEETELLVDKEDTKKVYDTIKTYLPLYALFQSDRQSKDDDKEVSDPMKIAVQQALSELNTELEHIKEQVRIKAIDTANRTLNKLKEMSPDLANELIPEFKTEPKFDSQFKLTIKSEEDIPINKRGSGVRRLILLNFFRAEAERLRNQIIFAFEEPETSQHPDHQEMLIQAFMELSNNSQIILTTHTPAL. 373
91 1.000e-24gi|254489937|ref|ZP_05103132.1| hypothetical protein MDMS009_268 [Methylophaga thiooxidans DMS010]  clstr ali  12  3LKKLKVQNFRAYQTETEISF--SNMTGLIGRNDVGKTSILDALGIFFGHKLCKY----------EAGDKCVYAGENEDVIITCEFEELPQEIVLDATSVTSLDREYLLTDGGTLSLSKVFKKGKGSGAYMANCV----------HPSARNAKGILLKKNDELKSIAQSLGIAAEDNRSNVSLREAIYDAVGDLKLKEQSVALSKEDGKAILEQ--IQNHLPHFALFRADRPSTDEE--AEVQDPMKVAISQAIEDISPQLEDIKDQVKQRALTVANSTLSHLADLDPELAMSLTPDFKADPKWEGIFKLSLAGDDDIPINKRGSGVRRLVLISFERIKREYQDRGVIYAIEEPENSQHPDKQKLLVEAFSEMADKCQIVITTHVPAL. 370
92 1.000e-24gi|27817689|emb|CAD61116.1| hypothetical protein [Cupriavidus oxalaticus]  clstr ali  12  3ISKLGLVNYRNFANTK--LLFQKGINTIIGENGSGKTNLFRAIRLLLDDNMIRSAYRLDSTDFHRGLGKWQGHWIIISLEFEEISADEAIQALFRIDDEAVGKATYNLIFRPKKEIRLRLSQLDDGDHAGLATILNPVTLDDYETIFTGRSDADFNDEAFYKEVVGDFENAKFSEEIEFPAIGAKIPSVLSVSKEISFTYVQALRDVVSEFHNNRTNPLLSLLKGKSGDIDPVAFQFITDGVKALNDSIEALPD--------VQVVRSDIKDTIKDAAGEAYSPSSLSIKSDLPDEADKLFQSLKLFVGESGEGHEGPIHELSLGGANLIFLTLKLLEFKYQKAKNFLLIEEPEAHIHTHIQKTLFDRLQ--YDDTQIIYSTHSTHI. 386
93 2.000e-24gi|171911302|ref|ZP_02926772.1| ATP-dependent endonuclease of the OLD family-like protein [Verrucomicrobium spinosum DSM 4136]  clstr ali  12  3LETIEVRNFRLLRRLSIDLTKEKTTTILVGPNNSGKTSVMDALRLFAGVGSDALRITFHDLSQLRHRNLRWIETKLSRSKDAEEKIAVLKRFSPRMRLDLTFTYDESPDLVAATRLLMDLNPSTNKVRLRIEYALDNAKKLLDDFDNRQRKAQTLCEFLRDSFREYFKRTFFKISLNGQEELLEESGLLNTLLRIDIVPAQRHVDDDDNSRSAKLSKLLHDHYERYYKVDNAAGYQALENAVTESASDLTVKYSLAFGRLTKRLKSFGYPSGQTAPDLRVRAELSTETIYRD---NARIFYASEHAGKQGLKEKFELPEKYNGLGFKNLIYIVLQLESFGEKPRVHIIAVEEPEAHLHPQMQTVFISEISKVLENAQVLLSTHSSHMI 402
94 2.000e-24gi|288924611|ref|ZP_06418548.1| excinuclease ATPase subunit [Prevotella buccae D17]  clstr ali  13  3......................................................................................................................................KYADYIEQIEIDALWSGRRHVVWNLDRRVNILSGINGVGKSTILNKVVKGLSVGGEFPSHLQKGVRLRVFPADAKWIRYDIIRSFDRPLMNAETVTKLDLSLATELDWQLFQLQRKYLDYQVNIGNRIIDALQSNGEAADAAQRISAPKKLFQDMLDRLFAETGKKIIRTENEIRFSQIGETLLPYQLSSGEKQMLAIL--LTVLVEDCRPYVLFMDEPEVSLHVDWQKELIDLILQLNPNVQIILTTHSPAVI 255
95 2.000e-24gi|149925450|ref|ZP_01913714.1| hypothetical protein LMED105_04482 [Limnobacter sp. MED105]  clstr ali  19  4LVKAQVWKYKSIEDSTPVAL-ADDVTVLVGKNESGKTAFLEALYKALPLGAAGYDYVADYPRKDLVRYRPQHEAKNYQKVVQLTFRIEKELADTINKEVFGGAQIGSTFIRDTTIANTNTIGFHIDQKAALVAQQKPLSDLEHQDEVFGATSLADVLAKIEGLNLPTDNRLAKFAAQWRARAIKANGWGLVDGHIWQTYLLPALPKFLYFDDYKLLEGKINLPALQQREAAKQLTDADETAQGLLQLAGTTLQELMSDEGYETAKAKLEAIGLNITQKVFEFWKQNQDLDVEFDLKTDSKDVNLYIRIKNRRHGVTVPFDQRSKGFIWFFSFLVWFDAVQSRQDALVLLLDEPGLNLHALAQADFLAYIRELSTQHQIIYTTHSPFMV 404
96 2.000e-24gi|345889592|ref|ZP_08840591.1| hypothetical protein HMPREF0178_03365 [Bilophila sp. 4_1_30]  clstr ali  15  3LRQIILKNFRGYKNQHQIQI--DQLTAFIGKNDAGKSSIFDALAAFFDHPLGKIDSSDICVHAGRNGELR----------IGCVFSDFPESITIDASSVTTLAGEYLLNGDDMLEIHKVYEF-------ADGTLKKPKVFAIANHPTANGFNGLLSKKNAELKKIGEEANIDAGVDKRSNVALRKAIWGSASDLKLCPSEIQLDKEDAKAIWEQLSK-YLPEYALFRADRPSTDED--SEVQDPLKVAIKQAIEEVQAELDAVKEKVKARTLAVANRTITKLADFDNTLSSQLNPNFKSDPKWDSLFKLSLTGDDEIPINKRGSGVRRLVLFSFERLREERKKGNIIYAVEEPETAQHPDNQRKVIEALQAIAEGCQVMLTTHVPAL. 374
97 3.000e-24gi|241202950|ref|YP_002974046.1| hypothetical protein Rleg_0196 [Rhizobium leguminosarum bv. trifolii WSM1325]  clstr ali  17  3LKSFSVSEFRSIIASG--EITLGDVTCLVGKNEAGKTALLKALYKL-SPMSTTDARFDVTDDYPRKDLGDYQHEVDEGVRVPIRATFELTDAEVSSVANLFGPKALTSNVLTLEKSYDNRRVYSLDFNETEALKYVVSSAELESADLAAVGDVQTWKGLGNRLAELAASPTGAKLKMLVDKINDKYYAYNSILSRSVPEFLYFDEYYQMVGHDNVEALIQRRDSEDLRPSDHPLLGLINLARLSLDDLISSKRTM--EMVNKLEAAGNHLTRQILKYWSQNKHLQMKFDVREAMADDPVEMRSGHNRVYDQVHWATTELSSRSRGFVWFFSFLAWYEDVKRARKNIILLLDEPGTSLHGRAQGDLLRYIQELRPHHQVIYTTHSPFMV 397
98 3.000e-24Oral.Meta HOMD pora_c_2_2751 Prevotella oralis ATCC 33269 [255919 - 254999] AAA ATPase  ali  14  26............................................................................................................................DNKCNTDKAMKYADYIVQIEIESLWSGQRHVVWNLDRQVNILSGVNGVGKSTILNKVVKGLAAGGEFPSHMLKGVHLKVSPEDAKWIRYDIIRSFDRPLINADTLTKMDASLATELDWQLFQLQRKYLDYQVNVGNRIIHILQSGAADAALEQRISEPKKIFQDTIDKLFAETGKKIIRNENEIRFTQIGETLFPYQLSSGEKQMLAIL--LTVLVEDNKPYVLFMDEPEVSLHVDWQQQLIDLILQLNPNVQIILTTHSPAVI 288
99 3.000e-24gi|347430633|ref|YP_004831241.1| hypothetical protein SLG_p_01210 [Sphingobium sp. SYK-6]  clstr ali  11  3INRAKIENFRLLRDVEIGFEE--QTTLIVGRNNSGKTSIAELFRRLLSDRALSFRLEDFSLGCHECFWTSLVSFRAQQDSSETLGQLPAIKLVLDIGYDVDAADLGPLSECIIDLNPDHEARLEFRFAPKANALQALFVDLTEPLEDPEADRARLYRELGNRIASAYAGSLEAVDPNDPTNRKTLEPKILSALVGGGFINAQRGLDDDTFRERDVLGKVVEVL------FQSALTDELDPTRRSTAEQLKEAVDQIQGDLHIGFNAKLTSLLPTFDLFGY-PGLVDPGLVTETSFDVDKLLSNHTRLRYRGVNGVTLPETYNGLGARNLVYMLLQLLRFFREFQGTLIFIEEPEAHLHPQMQEVFIRQLEYIANNVQFVVTTHSPHM. 400
100 3.000e-24gi|86147985|ref|ZP_01066288.1| predicted ATP-dependent endonuclease, OLD family protein [Vibrio sp. MED222]  clstr ali  11  3IESIRVKNFRSFKDETIL---LDDYSCFVGSNGAGKSTVMNALNVFFRQFRDSKTDLSKLSKEDFHHKNTQLPIEITVTFNSLSAEAKSDLADYVRQGKLIVTAKAEYDPATERADVKQYGNRMVISGFSAWFDANKQKAKVPELKAIYQNLKNTFSGLADVKTKGDMEVALHDYEAKNPQLCTLVPS--EDQFYGASKGANKIAPYLEWVFVSASKDFSEEAEQTKGSALDQLLNRVLGTKVTFKDKVSQLKEEYRISYKKMLEEEQPALQEISDSLGIKLKKWSNQIVWNEDPEKSVKIEEPKALVVISEKGFEGELSRFGHGMQRLLSVLQELSDANTAKSPTLVIVEEPELYQHPPQARYLAQLLQEL-DDSQVMVCTHSPYFI 392
101 4.000e-24gi|423709470|ref|ZP_17683824.1| hypothetical protein ESTG_03906 [Escherichia coli B799]  clstr ali  14  3LHSLKIEGFKRIQTAEIIF---GDTTFLIGANNAGKSSVLKAVEWLLSDKKKMDIDCFYCESDESRENK----IATESIVLEAEFRNVPEEALQWRGFRGRIFEYNAGNSGETGKSLIYRKTYEPGNDVVIELKSFSRKLNTRFETAVRASDLVEAGADAEIITEYFPDQAKRFNAADKEKL-KLIDELWDVSDDEEVWDKNPGGIAGVVLSRLPAFLLIPAESASHEIDTKALQKTLNELFKDVRGNSENYRKAQESLNALAKELDPADETSEFGVMMGELNSVLSGVFPESKIYATADLSDPDNFSVEMSSNIKTCVSNQGTGMIRAAVFGLLRFRQQWLRKKGIIGFEEPEIYLHPSAANQMRDLIYELSDGSQIIATTHSPYLI 399
102 4.000e-24Oral.Meta HOMD poul_c_32_26 Prevotella oulorum F0390 [5327 - 6250] excinuclease ATPase subunit  ali  12  26..........................................................................................................................FRKFALTKKYSMAYADYIKQIEIDSLWSGTKHILWTLDRKVNVLSGINGVGKSTILTKIIRSLSQNSAHASHTPKGIKLTLMPQTADEIRFDVVRSFDRPLINADVMGKLDLSLATELDWQLFQLQRKYLDYQVNVGNQMIAALQSGTPDGAAEQRYAAPKQLFQDLIDRLFAETGKTIVRTENEIRFNQMGEMLLPYQLSSGEKQMLMIL--LTVLMENQLPYVLLMDEPEVSLHFEWQKQLIDLILQLNPNVQLIITTHSPAVI 290
103 4.000e-24METAHIT O2 GL0021392 [Complete] locus=scaffold101443_1:2651:5038:-  ali  15  3ITEISIKNFRSF-DERGVSIVVGEMTAFVGKNSSGKSNILQALQLFWGQYALAAEDFYYETDRTISVSVTFAVAPDEI---------LPVLLPYVSPDGFLQLRHDYTEVDLKGKLYSCGKNEYTGQPEMNPFPERKLKLTPAKIGVFLASEQSANLHSYAQSNGKTLD-ESSFYDVLGQYWCANIQSFCNRWNATPVEISGA--NLKNLYLALPAYYYLPVSYTTAKLTQDKHSYFQQIYQQILGDIQQLRENAQAEQLRQRVAALYRTIHKRCNDINQLLSET---AGADSSVKMHIVIGEPDYEALFRDDGYDCDVQGKGQGIQRIFRLLKVFSRNKKQQRKFILAVDEPEAFMHPTYKRSLFKSFLSLCEGCQVMYTTHDPAFV 388
104 4.000e-24gi|418529435|ref|ZP_13095374.1| putative OLD protein [Comamonas testosteroni ATCC 11996]  clstr ali  18  3LRRFEIHNFKCIE---HVTLEWEDLLVLIGENNAGKSSVLSAIAVFLSGSSIKDS------------SLFRRHQTDDGNAIELIGHFDCLTDDEKAQVAVRGRMDGDRWVLKKRYWFEPGEDGEAGGWKEQLFSFSGLEQFVGDPDTTWAAFPADYQPIIDALPNKGARPNVGSRESLKAVVREQRPDLVALGEAAWLWKSNANSILPRPIFVRAVQEASDETNAKDASTYGKLVNLIVERSLARRPEMAALQAALDDVLALFRPDQAQEVRDLQDRINQSLNEVVQALIRTEAPELRMVLPSTSLVIRDAQAGIDTEVGHQGHGLQRTLVILLQLLADAQLQRGTILLIEEPELYLHPQMERLMRDVLHRLAPNTQVACCTHSPVFL 407
105 4.000e-24gi|254449841|ref|ZP_05063278.1| conserved hypothetical protein [Octadecabacter arcticus 238]  clstr ali  35  335........................................................................................................................................................................................................................................................................................KVTARFAEWWKQGDYQFRFEADGSHFRIWVADSRREVELEHRSTGLQWFLSFFLVFLHEAKEHDNCVLLLDEPGHSLHPLAQRDLSAFFEGLSQNNQIIYTTHSPFLV 445
106 4.000e-24gi|384098886|ref|ZP_09999996.1| hypothetical protein W5A_09495 [Imtechella halotolerans K1]  clstr ali  25  5..SFTINNYRAIE---EIKLKLNQINPIIGINEAGKTSVLKAIDKFNRGEHLEFKNKYIIGSKECTISADLILDRGELESLISKLKITTDSKEYSILSKHDEHTIFTLRRNLSQDNYPYSILLD-GVSEAVK--EHIIKFLISNLPYIQYFDDFADRVPEEIEFPTDYIYKRNLGKGKDRDWKEIIEEIFKRADTEGIGEVDDENHLISYL---------------------------KVQNVDTKGDI-----LSDVEATLNREIINEWKRIKKSG----------KSFADDSDKLELVIEGNVFRFKVKDKSRTFDISERSKGFQWFFNYMIKLKFNPNKLENSIFLLDEPGSYLHSSAQTELLNELHSVSKKNTIIYCTHSQFLL 360
107 6.000e-24gi|427425860|ref|ZP_18915934.1| AAA domain protein [Acinetobacter baumannii WC-136]  clstr ali  16  3LVSIEIKNFRCY--EENILISFDNLTTFIGKNDIGKSTILEALEIFFNNSTVKITQDDLN-----------INSTDTDVIITCEFSDLPPKIILDSGVETNLKDEFLVNKNDNLKIKKVFDCSKKNVSTEVFINAYHPTAI---------GFDNLLELKENDLKKIIRDGNIASTLKGNPLMRSAIWSSCSDLCLAEKDIPVSKPKEDIKKIWEQLEKYLPIFALFQSDRSSKDSD--GEVQDPMKAAIATAISEVRDDIEKIQEKVKQRTEEIARKTHKALESIDKNLASQLTPEFTMPTNSKWVGLFNVGNTDDIPLNKRGSGVRRLVLVSFERLLSEKNKQSIIYAIEEPETAQHPNNQKILQSAFVALANNCQVLLTTHSP... 371
108 7.000e-24gi|229526763|ref|ZP_04416167.1| hypothetical protein VCA_000893 [Vibrio cholerae bv. albensis VL426]  clstr ali  15  3IKNVRIKNYRLLKDVSFSIDE--KTTLIVGRNNTGKTSFAEAFRSFLNPAGPKVRYEDFNQSCLTGFEDALNALQGGAEDD--------VVRSMLPTIELELLINYQDNADEYGVLGDFIIDFDDQLFETIILISYQLKDGKISEFLGGLDSVNRKQYFADLRSRIGLHYEANVYAEPTNLNNKARLEFSSFKKLLLSGLINAQRGLDDETHNERDVLGKSLGHIFKSASSVGAPEAFKAQSAEINTVVEELQEIVDTDFQQKVQALLPTLNIFGYPGLHD-----PNLSAATELNVKSLLESHTRVFYQRDDHFTLPETYNGLGMRNLIFILFRIYEYQTPPKGHVIFIEEPEAHLHPQMQEVFIRQLEQIVEQVQFIVSTHSSHI. 394
109 7.000e-24METAHIT MH0054 GL0128170 [Complete] locus=scaffold3656_1:30389:32416:+  ali  19  3LKSARIQNYRSIKDTGLFQVENLK-TIFVGPNESGKTVILQALQQLNQPSDVAEFDELRDYPRSLYNDITTKKVKTEDIEVVRGYFELEDEDKKDIKNDLNRLCAHISKQFSSNNVSSTEKDPTQTLQESIGKWLDFYIINSEKATLLKSWLEKNYSYIDEDNQKEEERYSKLHILITFNEKKDEVLEILDKRTPVFVLFNNYFKVKLQHLADRIDSNILDNDKYYDYGNICLLKLLGFSARELSNIGATASPSQNNPEALKVYRDKLDRRSYQLDAASVRLTNEIKQIWNPDPDKLVISADGQYLKVVVEDNGVKIELDQRSEGFQWLVSFYVFFAEAMDKHKNAILLLDEPGMSLHGLKQREFRETISRLAKKNQTIYTTHSPFLV 435
110 7.000e-24gi|167767258|ref|ZP_02439311.1| hypothetical protein CLOSS21_01777 [Clostridium sp. SS2/1]  clstr ali  14  3IDSMKIKNFRGYKDET--EIKLNDLTVLVGKNDIGKSTILEALDIFFNDG-----------------KGVIKLDKTDVNVKSRTEENLDIEISVCFSELPEQIVIDSTVETSLQDEFMLNANGQLEVIKRYKNGGSAKVFIKAKHPTNDKCAELLLKKNRDLKRIIQSENIECENQTVNAEMRKAIWNKFSDDLQQDIIEIDVSKEDAKKIWEKL-SNYLPTYSLFQSDRKNSDGDNEIQDPLKTAVKQILSDTELQATLAEVAVEVENKLKEVADRTLTKLREMDSTIAASLNPIIDSLKWQDVFKNVSISGDEDIPINKRGSGVKRLVLLNFFRAEEEQGSTGVIYAIEEPETSQHSDNQRIMIEAFKTLASNTQIILTTHSSYIV 380
111 7.000e-24gi|85374405|ref|YP_458467.1| ATP-dependent endonuclease, OLD family protein [Erythrobacter litoralis HTCC2594]  clstr ali  19  3LETVYIKNFRAI---SELEINIDDVTTLIGSNGVGKSCVLKAIDKFFSKSSTLEDFHDGNVSDPIEIGLSFELQADELERYAARVHGGTL-RIVRVFRSSSLGRENGRYFGFAYRHQAFDEVRNLPTAN---DQKSAYNALTETGDFPGLTKCTRIADALTAMSEWEENNSDNCVLAMDDGQFEGFANVARGGLQRFVSFVFIPAVRDASIDAVDKKAVIGQLLELYVRTILQAKKEIKEFQTEMDERYKDLVSPEN--------------IGELDELSGLLTSTLTNFYGESEVELNWKLPLPSAETLLTEQGYKGPVEGKGHGLQRIFTILQHLALALHDTEQDILAIEEPELYQHPTKQRHFAEVLRNLSQSVQLILCSHSPHFL 404
112 8.000e-24gi|429215993|ref|ZP_19207152.1| SMC domain-containing protein [Pseudomonas sp. M1]  clstr ali  14  4.HSLTFKNFRRLKAARIDF--ANDLTIFVGANNSGKTSATHAIELFLSGGKEKFTVHDFCAGCWADFESFSAEDAADAKVKFPAIS-LDVWISVDADNLYRVVELLPRAAWEGSLVGLRIEFAAKDAAQTLVNFRAKAAEAAKFAKTKEKDGQDYKPWPRNMRDYLSRELKNEYGLRYFILDEAQLKAETAAAAYTPKEIIDAERSGHTVINSLIKVDFLSAQRHLSDGSAQARTEDLSKRLSRFYTRNQKQREEDHNALGALALSEDQLTKHFADVFSDTFKSLRKLGYPGLANPTLEIRAALKLERLMGDQQAKLPDSYNGLGFKNLIYMGVELLEEDKRQPIHLIFIEEPEAHMHAQLQQAFVRKLTDLISATQFVITTHSPHIL 423
113 8.000e-24METAHIT MH0013 GL0008960 [Lack 3`-end] locus=C1634883_1:85:1512:+  ali  25  4.KNFKIKNYKAISKELTIDLSP-RLIPLIGINECGKTTILQAI-------------------------FCFDEENDDLYEISNRFNLYEPSDNGPTEITAVIECTRE---------------------------ELDLVYEEMKADSGLEIQDDFVETDGQITITRILNGKSHYISSLNFYEPSEEEEKPYDEEITSNICSCIIQNCPAIIYSDDFNDRPPSFIDFKSNSQS--------GNFEWKEIFKRIAKEAGVEFNNIFEVDERRQQTVLSRIASHINQRITDEWLRFSENIELRVKNTQINDRVQDNDNYFDLSDRSKGFIWHYNFIMKTLFNSKPFKQTIFLLDEPGSYLHVSVQALLCKKLKEISKEGVVIYSTHSSSLL 352
114 9.000e-24gi|386401487|ref|ZP_10086265.1| hypothetical protein Bra1253DRAFT_07224 [Bradyrhizobium sp. WSM1253]  clstr ali  17  3LKWFHVRDFQSVRDSGRIPVSE--ITCLVGKNEAGKSALLKALYRLNPVVPA---------------DGNFDVTNDYPRMDVEDYRHAVESGKRGTAV-----PITACYALDADEIAAIADMFGEACVTKITFEKSYDNKRTYSLSADTSNGLEHLISKADLSEQAGAALTDAPTADGLSAILQAQEQTAEVTRLLAVLAEVKKSGISGYIYTHILLSRRPKYLYFDEYQMTGHENIEALVARESDHPLLGLIRLARLKPELINPASTIELKNRLEGASNHLTRQVLKYWSQNK-HLRMTFDVSG................................................................................... 298
115 1.000e-23gi|119774248|ref|YP_926988.1| ATP-dependent OLD family endonuclease [Shewanella amazonensis SB2B]  clstr ali  16  5LSKIKISNFRSI---DRIEFTLRNYTSLIGPNNAGKSTVLSAIDCFLNQIKPQLSDWRNHNYDEPVIIECLFTNLQPWESTCPGVAGIVQNNEIHLRLVASADVANSSVNVE--YEAYIREEQIEGWSSGWRDLSQTIKEIASE--RGFNGTSWKTVSNREVIKQHLRENHPELIAAGDYIWTSEGISI-KPALQQALPKCVVIPAVSKIGDDLKTTGKSPFNQLLSSVVMPAVARSEEF------RGLQSAIQLLTDKMRGQSEDEFEEIRRITDLLTERLSSILDAEVIMSLNSPDFEKFINSGATLLVNDGHTTSPDNQGSGAQRALTFALLIAQEGEQVKSTLLLFEEPELYIHPHLMRKLKSILETISNHWQVISTTHSPFLI 387
116 1.000e-23METAHIT MH0012 GL0100984 [Complete] locus=scaffold13103_1:3080:4897:+  ali  17  3LKTIYLKNFRCYKDE--VCIEFDDLTTFVGKNDIGKSTILEGLEIFFNN------------DLVKIEPSDANIHGDNNVVITCDFGDLPSELILDSGEITNLTDEYLTISNDTLRIKKVYDCSKSKVSSTVYIVANHPNVVEAENLLSLKEKELQKIIKDKGIDCPLKGNPLMRKAIWASIDDLHLQETEIEVSKAKEDGKEIWTKIDAYLPNYALFQSDRSSHDSDGEVQNPMKVAIQAAISEVEEEINAIQKKVQDKAMANAPQTQEALKYIDNNLANQLTPKFTPPAASK---------WNSLFSIAMDTDEGIALNKRGSGVRRMILVGFFKAEANSKKKNIIYAIEEPETAQHPNNQRILINSFKELSKKCQVILTTHSP... 371
117 1.000e-23gi|289628784|ref|ZP_06461738.1| putative ATP-dependent endonuclease of the OLD family [Pseudomonas syringae pv. aesculi str. NCPPB 3681]  clstr ali  13  3ISRLQLVNYRNFKCANVVF--NKGVNTIIGENGSGKTNLFRALRLLLDDTLLRAAYRLDEKDFHRGLGDWWVVISLEFDEVSQDEAIQSLFLHGNIADGAIGKATYNLIFRPKAAARRTLADLAAGDTVGLAEARSKITISDYETIFTGKSTANFLDPETYRQLVGDFDAVIFPQELTNPAIGGVIPGMLSISREVCFTFVQALRDVVADFQNNRTNPLLTLLKCRSGEIDPQSFEPITALVKGLNDAIEGLPD--------VGTIRTDIRDTITDAAGETYSPRSLSIRSDLSDEADRLFQSLKLFVGESEEEYEGAIHELSLGGANLIYLTLKLLEFKYQKQKNFLVIEEPEAHIHTHIQKTLFDRLN--FDDTQIIYSTHSTHI. 386
118 1.000e-23gi|154244625|ref|YP_001415583.1| hypothetical protein Xaut_0674 [Xanthobacter autotrophicus Py2]  clstr ali  26  158.........................................................................................................................................................................................................................EKMPVFIYLDEYPELNLQRKGKSQLTPTDLNFEKMCKVAGLDPQELQQLEHETRNQLANRASAVITKEIRRLWKDRSLKVRFDTDADHINTFISDPNATYDLNERSRGFQWFFSFYVTFAADTAGGEDAILLLDEPGLYLHAKSQRDLLTHFDDDFSN-QIIYTTHSPFMV 345
119 2.000e-23METAHIT MH0050 GL0015821 [Complete] locus=scaffold29559_2:670:1488:+  ali  12  3......................................................................................................................................KYADYIVQIEIESLWSGTRHIVWNLDPKVNILSGINGVGKSTILNKVVKGLAQGGEFPSHMLRGVRIKVMPEDARWIRYDVIRSFDRPLMSGDLVSKIVDTELDWQLYQLQRKYLDYQVNIGNRIIQTLSSGAPDAAQKAQE--ISRPKNKFQDMMDSLFAETGKRLIRTKNEIMFSQIGEELTPYQLSSGEKQMLAIL--LTVLIEDNQHYVLFMDEPEVSLHVDWQQRLIDLIVDLNPNVQIVLTTHSPAVI 256
120 2.000e-23METAHIT MH0062 GL0113328 [Complete] locus=scaffold25705_2:377:2461:-  ali  19  3LDSFRVTEFRSVKDSG--WIDAEQITALIGTNESGKTNILLPLWKLNPADEDKYHTYRSANPKPIFISAKYSLSDKEKLDLSKLSDHSCDEFSQVIVSKDFDGNLYYDFPFSIDHGPSIIDKAKKVITTCKGTLESGNDAVGKSETERREKAIHIIDSALDILNGNDAHTVLTSVSEEVAKFNDEVKSSISQQLQALIDECSKPELKNIDAVTTYIKERMPKYVYYSNYTLKTLFKFVQLDPKEIMELGSEANGNLSQEQIDSISEKKKEREILLSSASSGFTKSFNEWWKQGNYTFEFQADGNFFKIWVSDSPERIELESRSTGLQWFFSFYLVFLVESELHQNAILLLDEPGVTLHPLAQKDLFLFFENLAQNNQILYTTHSPFMV 440
121 2.000e-23gi|118575988|ref|YP_875731.1| ATP-dependent endonuclease [Cenarchaeum symbiosum A]  clstr ali  18  3LRKFRVRAYRCIHDSGEISV--GDLAAFVGRNESGKTTILQALTLLNRETEVSELDLCDEMSDELKSEVRFELSEHETALIKERFPYVPEIKSLRIFRTNTAQRTQYDFAGLSISEEQNRGLNSWENLRTRITSFLDMIPNHIRIKMDPSFFQGGMPGNQDDYDSGMADLNNQFVNASDEPRVLSEWEEIYRDKESRYENLLSGTTDRAALENYIAENLHPRFVYFSDYKKIYGNINLNEYEFDRAETVRNLFYLAELDVEEMEALHDSKLIKFLNTASNRLTARLNPAWKGDPIHVDLRYQPGNIMSVVISDTNTGLLNRRAEGFKWTFSFIVNFAAETQRAKEAILLLDEPARNLHPTQQMGISDLLRNLAGSNQVLYATHSPFMI 421
122 2.000e-23gi|330995985|ref|ZP_08319879.1| RecF/RecN/SMC protein [Paraprevotella xylaniphila YIT 11841]  clstr ali  17  2.....................................................................................................................................DKIGEYIRRIEIDSLWSGQKHIVWELDRKVNILSGVNGVGKSTILNKVILRLLQVVKDSCTDKPDVKLTYEPTVRFDVVRSFDRPLVHSNLLEKLADDRVATELDWQLYLLQRRFLDYQVNVGNRMIAMLTSGDPXXXXXXXXXXXXRVQ--FQDMVDELFSETGKKIVRSSNEIQLEQFGEVLSPYKLSSGEKQMLVIL--LTVLVEDRQPYVLFMDEPEISLHVEWQQRLITLIRQLNPNVQIILTTHSPAMI 256
123 2.000e-23gi|340360195|ref|ZP_08682665.1| hypothetical protein HMPREF9062_1790 [Actinomyces sp. oral taxon 448 str. F0400]  clstr ali  16  3LVHVNIQRYRSISEPTEFDVE-SDVTALVGKNESGKTAVLQSLYKSNPDRVKFDPDLDYPSHKTPELRKEKCVRVTELTYELDDGDIAAVEILYPEAFDDKCVTITTGFGFTQEEWSLQVNEEKILNHLRNELDLPTADKTKVDAVSTIDGLAETLRSLESETPTAAATLEKIESWRDNDPVLAAIDVLHKRCPKFVYFGDYDVMPGKVSIPTLIYHRDNDKLERGEEALLALLSMQEFISSDNHERLIRQMENASNAISDEVFEYWSQNKELQVELHTIAAAEPNAEPPLNEAPLLQI-------RVKNQRHRVTVPFDERSRGFVWFFSFLAYFSKEKESTQPLILLLDEPGLSLHATAQHDLLRFINELAPHHQVIFTTHSPFMI 391
124 2.000e-23gi|421056674|ref|ZP_15519591.1| hypothetical protein FB4_1405 [Pelosinus fermentans B4]  clstr ali  13  3IKKVEVKNFRLLKDVTLTLEE--KTTVIVGRNNSGKTSLTEFFRRLLSDNSPSFVDFPLVIQQEFWDAFVRKSEGVGESETVELLPTIEAKITIVYDPRAHDLGLLSDFIIDLDINSKEAIALISYKLKDGKINALFENLTYMPDSDLPRQKRDFFRSMKERIPKLYVASLSAVDPTDDSNQKSLDLLKLRSLLQAGFINAQRGLDDTTHKERDVLGKVFERLLTSASAETAAADERTIAL---------ALERAVQGIQSSIDSDFNEQLNGLLPAFSIFGYPGLNDLCTETILDVQRLLENNTRIRYANSNGVSLPETHNGLGSRNLIFILLQLYEFFKCYKGHLIFIEEPEAHLHPQMQEVFIRKLSELANVVQFIVTTHSTHM. 401
125 2.000e-23gi|359450460|ref|ZP_09239899.1| hypothetical protein P20480_2620 [Pseudoalteromonas sp. BSi20480]  clstr ali  17  4LEKVAITGYKGISNRT--EIPAKDFNVIVGKNDSGKSTILKALELFLNNKQYLAENLNNRTHQFSEIELFFSTHRTEIIIDENVTTTFEDEGLVDENGLLHIAKKWDGTKTGKISPEYLITRKSFGELDFFSLTEAKLIRLCRDNNLEAEPGLMTNPDTGAEHN--------------NAEKRQRLKEIYEERNIEFEYIQEKLPTSGQSRLKKTEQEIKKCLPQYEYFLADSPLSESDSAIQKYFKEMAFSVIKDQVDTDALEETVKEQLQTVLTAITEKINSVVPDDEQVRARVDFDWSKLISTSFESDGEQGSVPLSARGDGFRRITMMSYFEYERSREHQNIIFAFEEPETFLHPSAQEKLFEKLMDISGGYQVFLTTHSPVLV 379
126 3.000e-23gi|166365126|ref|YP_001657399.1| hypothetical protein MAE_23850 [Microcystis aeruginosa NIES-843]  clstr ali  15  3IQRVILNNIGLFEKLEITEQNPSNITVFVGNNGAGKTAILKALATSLSWFTARLLTEKGSGNPISEDAIFNTANAGSIE--------IEVWDSSKSLNNPDQSDIDHYFRWILAKNRKGRKAQYNSNLNDCTRLANRYRDALTHDDKTSLPLIAFYPVERVVLDIPLKIRTKHTFLQLDGY-------------------------------DNSLSQGVDFRRFFEWFREREDTENESGVPEDVLNQLRPIMAETNQDVQWLNERNASAKDRQLTAVRTAIGRFMPHLDNLRV------RRKPRLYMAVDKNGETLNVAQLSQGEKSLMALVGDIARRLAMLNPGIVLIDEVDLHLHPSWQRRLCERLTETFPNCQFVLTTHSPLVI 359
127 3.000e-23METAHIT MH0065 GL0027086 [Complete] locus=scaffold4286_1:2845:3660:+  ali  14  2......................................................................................................................................KYAEYIKQIEIDSLWSGKKHIVWNLDRQVNILSGVNGVGKSTILNKVVKGLTAGGEFPSHMLKGVHITVVPEEARWIRYDVIRSFDRPLLNMDTISKMNVSLATELDFQLFQLQRKYLDYQVNIGNRIIAALQSEPDAAQKAQELSAPKKRFQDLIDDLLCETGKKIVRTENEIRFSQIGETLVPYQLSSGEKQMLAIL--LTVLVEDNLPYVLFMDEPEVSLHVEWQERLIELILSLNPNVQIILTTHSPALV 254
128 3.000e-23gi|307353930|ref|YP_003894981.1| hypothetical protein Mpet_1790 [Methanoplanus petrolearius DSM 11571]  clstr ali  13  3LISVTLKNFRCYLDEKTIQI--QDLTTIIGKNDIGKSSVLEALEIFFNNDSVK-----------IDSEDCHLSASEKIVEITCEFDDVPDEIIIDSNAYTTLPKEYLLTADKTLRIKKIFKCTSAKPKEEIFICSCHPT--TKNYEDLLELKITELKKRLDDLSIPKEGINLSSKPSIRHAIWKSCPNLNTAYTEIPVTKEDSKTIWDK------INESLPIYALFQSDRNSRDSDPEVQDPMKIAITTALSDPSIQTKLNEVQDAVKIKAVELAERTQEALKKIDAELADELKPEFKADPKWAGVFSLVLKDDKGISVNKRGSGVRRLILVSFFRAKSENNNQSIIYAIEEPETSQHPDNQRILLDSFKDLANGCQVILTTHSPSF. 375
129 3.000e-23gi|88813366|ref|ZP_01128604.1| hypothetical protein NB231_01843 [Nitrococcus mobilis Nb-231]  clstr ali  11  3IKAITVNRFRGY--SSPVTVDVDDLLVLVGRNDIGKSTILEALDIFFNEGKGCV------KIDKDDINKDCLAQGQDCIEIGVEFTDLPANIVIDATNQTTLQEEYLLTSAGTLYVVKRYPNAGKEKV-----------FIRANHPANAECADLLLKKNADLKRILDAGGFDCSDKTKNAELRKAIWLGQANL-QLGDCEIEVAKIDAKSIWEQL-KAYMPLYTLFQSDRKNSDSDDEVQDPMRIAVREILGDPQIQADLTQVTDTVKARLDQVAQRTLQKLGEMNPAIANSLDPQIPDLKWPDVFKNVSITGDDEIPINKRGSGVKRLVLISFFRAEAERRQNDIVYAIEEPETSQHPEHQRALTDALIALSENTQVLLTTHSPEIV 379
130 3.000e-23gi|344199017|ref|YP_004783343.1| SMC domain-containing protein [Acidithiobacillus ferrivorans SS3]  clstr ali  13  19........FKNLKNVTIDFDQDHWVTVVIGWNGTGKSNVLEALAIIFRDLITKKRTPAFAFQLLYRMGIGENLRHIHIDADPDREKETPFIEGAELASAPRGKAIKLTAFLKADVEYLPRYVFSYYSGESPRMHEVFRPYLESYDSKLRNGEDPGLKRLFYAMPVHSQFVLLAFLIQQSDVVRAFLDDHLGLDPNEGI--ESVLFVLRQPPWKSKAADGDPRFWNARGVVQHFLSRLYDIALAPIEISRRVSTSIWNKETLQFKYLYVKDIAALRRLVGSQVPAQF--FRDLESTYVSELVEEVRIRVRLKKNDGSVTFRELSEGEQQLLTVLGLL--RFTAEDESLFLLDEPDTHLNPRWSVDYISYLKQFIETSHILLTTHNP... 414
131 3.000e-23gi|229526561|ref|ZP_04415965.1| hypothetical protein VCA_000689 [Vibrio cholerae bv. albensis VL426]  clstr ali  14  64LASLKLIGYRGFESLDITFSQKSNITVLVGNNGSGKSSILDAIQKSLTHFVSRLSTRSYNGDQLDELD-----------------------ISNGATFVTVIPEFKVAETSFSFELSQSRPMIEPRKKSKFTELNEIGNLYRLANTEKKELSLPLLASYTVERANDVTTKDIEESDEILSSQIWDKSKAYSKSLTGKADFKLFFRWFKEQVESENDEVSDIKVIKAQIESKESEINSSLMKAILSNPETAETGEILIKQYKDQINDLQEQLNEKSNVGNKSLDSVRNAIYKFLPGFSDLKLKRAPLDMVVKKDGQEFSVLQLSQGEKSVLALIADIARRLTMLNPSLVLIDEVDLHLHPSWQQKIMQRLESTFPNLQFIVTTHSPQV. 436
132 3.000e-23gi|260907402|ref|ZP_05915724.1| hypothetical protein BlinB_18845 [Brevibacterium linens BL2]  clstr ali  21  12...................IKLDKLVAIVGPNEAGKTTLLRSLAYVDASDALRSRASTGIADSTPVVSLRYRVSDEDRKEL-EDLELEDTPIEFFVSRRADGDGPNFTVKPAPRKSEAQLKQLAADLGESLSAISLEPLPIEMAEEDEIPELLDELRLLRQDLDTHLANGEREPIDALRERADKDVEVLSAFAETDVLQRLLVDREDPTERTEKALWNLTPDVVMF-TEADRTLASAYTLDDADVPTALANLARLAGLDLNALQTGQVSRRDTIKNKANITLGNYFKNAWQQSDLKVELNVENKLLRIGIVEDGVHASFDERSAGLRMFVAL-NSFLAARNSGRATILLIDEAETRLHIDAQADLVQMFAKQDKADKIIYTTHSP... 402
133 3.000e-23gi|341615579|ref|ZP_08702448.1| ATP-dependent OLD family endonuclease [Citromicrobium sp. JLT1363]  clstr ali  29  56.........................................................................................................................................................................................................................................................KLLMQLANIEPEYIEAGENGHATALAESINQQLEKKFPKYWVQDRDQLRVTALESELVFTIRDRGTQYTFDERSAGLKYFLSYFIQATHIPDPTRPEILLMDEPDAYLSAEAQQDLLKIFRNFAEPDQVVYVTHSPFLL 212
134 4.000e-23METAHIT O2 GL0061985 [Complete] locus=scaffold3041_1:18447:20555:+  ali  15  7ISNIHIENYRGFSDLSVDF--KDGINILIGPNNSGKSNLLRALALIFDGKFRK------------------QLSVDDFYNGITLSTLKQHSPKIVVTVTLSQSDDEDLMGDELVTVSSWLVKLEKPYSAKLQYEFFLPEEYESIYIESIQNVSSTSEVWTRIDNSFIRLYVYKIWSGNPENQMQADSEGLSKFDFQFLDAIRDVERDMFSGKNTLLKSVIDFFLDYDIKSDKALSS--EEQTQKINERRRDFKEKSDILVEVLKKRLENGRNQILSYADHVGASFDNSKPTFEGAISENEVSSILQLLVQQETGMRIPIGNNGLGYNNLIFMSLLLAKMQIDADGTILAIEEPEAHLHPTMQFQFVKFLKDNLRDRQVFITSHSTHI. 384
135 4.000e-23gi|398840076|ref|ZP_10597314.1| Protein of unknown function (DUF2813) [Pseudomonas sp. GM102]  clstr ali  15  3LHEVDIKNFRKLKDCKIKF---RDTTFLIGPNNAGKSSVFAALDYL-----HKTGDVTLEDYSKTFIPETEDYRRETEIEIVAEYRNLPDDSEGWLGFKGRVITHEAPLPGETNKKIVYKKKWSIEHTKPKVFLMEYPRSVNARYINCRKVEDLVGEDFSDVFLRNHFGEANLNKLLSHAAVKNLLTDLPSYTDQEPVWVENPGGIPGNVLSKLPKIVIIPAESCITQLTHPSLFKTLGELFDTVRQGSDNYNQAQAFLTELAKELNPNDSETDFGRLITDLNTMTHSLFPESSIHLSASLDQPEKAIKEMKSNVRTTVAYQGHGMIRATAFQLLRYVQGFVNRRTIFCFEEPEIYLHPAAANQMRDILYELAPNFQIVATTHSPFMI 400
136 4.000e-23gi|282880383|ref|ZP_06289094.1| conserved hypothetical protein [Prevotella timonensis CRIS 5C-B1]  clstr ali  14  2......................................................................................................................................KYADYIKRIEIDSLWSGRRHIVWNLDRQVNVLSGINGVGKSTILNKVIKGLLEGNNLISELPPSVKITVSPDDADRVRYDIIRSFDRPLMSSDTVAKVDKRLATELDWQLFQLQRKYLDYQVNVGNRMIEVLQKGGPDAAATQQLSSAKVLFQDMMDKLFADTGKTIIRTQNEIRFSQLGETLVPYQLSSGEKQILAIL--LTVLIQDHQPYVLFMDEPEVSLHIDWQEQLIDLILQLNPNVQLILTTHSPAVI 254
137 4.000e-23METAHIT MH0048 GL0072934 [Complete] locus=scaffold5107_1:569:2656:+  ali  21  3LKSFRVTEFRSVKDSG--WIDAESITALIGTNESGKTNILLPLWKLNPADEDKYHLYRSASPKPIFIQAKYILSEQEMHDLSTEFSEIIVSKDFDNTLHYEFPFSVDQEPSIVENGKKVLTDCLETLESGTDTSNRAETERRDNAIQIFDGLKAVNDELGKFPVDVKSSIACVAMSNALQKYQEIISEICKHMPKYVYYSNYGNLDSQIYLPQVLQNIERTDLGEKDAAKARTLKTLFKFVQLDPKEITDLGTEDLSQNQIDQISDKKKEREILLASASTGFTKSFNEWWKQGNYTFEFQADGNFFRIWVSDSIEKIELESRSTGLQWFFSFYLVFLVESELHQNAILLLDEPGVTLHPLAQKDLFLFFENLAQSNQMLYTTHSPFMV 440
138 5.000e-23METAHIT MH0026 GL0062087 [Complete] locus=scaffold14666_2:854:1675:+  ali  13  3......................................................................................................................................KYAEYIKEIEIDSLWSGKKHVCWELHRQVNILSGINGVGKSTILNKVVRSLARGGELPSHPVKGVRLRVAPEEARWVRFDIIRSFDRPLMSTEITDKIDASLVTELDWQIYKLQRKYLDYQVNIGNRMIQALQKATPEAAEEQRISQPKRKFQDLIDDLFSETGKKIVRTENEIRFEQIGETLMPYQLSSGEKQMLVIL--LTVLIEDGQNYVLFMDEPEVSLHVEWQKRLIDLILELNPNVQIILTTHSPAVI 255
139 5.000e-23METAHIT V1 GL0003775 [Complete] locus=scaffold35187_2:179:1033:-  ali  14  4.............................................................................................................................EYIETMEVQANYIRRIEIHGLWHRYDIAWELRPDVNILSGINGVGKTTILNRSVGYLEQTTGEVKSDEKNGVHVFFD-NPEATFIPYDVIRSYDRPLIMGDFTARMADPNVKSELDWQLYLLQRRYLDYQVNIGNKMIELLSGDEQQRSLAPALSVPKRKFQDMIDELFSYTRKKIDRKSNDIVFYQDGERLLPYKLSSGEKQMLVIL--LTVLVRNEEHCVLFMDEPEASLHIEWQQKLIGMIRGLNPNVQLILTTHSPAVI 263
140 5.000e-23gi|91202715|emb|CAJ72354.1| hypothetical protein kustd1609 [Candidatus Kuenenia stuttgartiensis]  clstr ali  18  3LKTVRIHNYKCIDDSEEFSLAP--ITCLVGKNESGKSAVLQALYKLKPVERDQADFDDLEEYPRKGLTDYEVIKDEKPANVLTTVWELDQRDEKVLQDTFGVNPIRSKLVTVTKGYGNKLCWNTEVDEAKVVKHYLKQLRSEKGEITEGTKVLSVADIITQLENIKTEVLAKIKKNIPNGELSQVVNNALATRLPTFLYFADYQKMAGRVSFNALSQNISSKKLLFSEKIFLALLDLAGTTPKEIQE-LGKLEHLIAKLEGVSNKLTREIFEYWSQNEYLRVNFRFENALAEDPPPFNSGYVFMT-RIENTRHQVSVSFEDRSTGFVWFFSFLAWFSVRKTYGTNLFLLLDEPGLSLHAKAQGDLLRYINELKPHFQVIYSTHSPFMV 394
141 5.000e-23gi|418057835|ref|ZP_12695820.1| hypothetical protein MetexDRAFT_0555 [Methylobacterium extorquens DSM 13060]  clstr ali  15  3LDSFRVTNFRSVEDSEEVTLG--DMVCLVGKNEAGKTALLQALAGLNP---------------HPATPTVFDRERDYPRRHLNEYDA------RHPKEEGEAIVITSKWSLSPEDVATLAEALGPDCLRSSRRYDDETFRIDVPLNYPAIAEYLMASHLGETVREPLAEATT--TDMLRKALEALAEPTPDQVALLETIRSFPGQNAVGFVGSYIRSV-TPQFMYFSYYDQIRVDDIVRNGDAPYERVFLDFLEFAGTSVEEIKSTTYESLNAKCESASNAITDQLQEYWT................................................................................................. 293
142 7.000e-23gi|262369876|ref|ZP_06063203.1| ATP-dependent OLD family endonuclease [Acinetobacter johnsonii SH046]  clstr ali  13  3IEKVRVEGYRLLEDIEIVLE--KNSTVIVGRNNSGKTSFTSIFDCFCGESGARFRLEDFSSLSREKFLNARKLKEEGASPEQIYNTLPIITLSLTFRYDSDAPTLGPLSPFIIDLDMDSTTAIACIEYRPVLAKMHLLFDLPQP-----PVGMEPQIHFFKCLRNNLSKIYEVHVSAIDPTDKSNKRNFEGTSAFAALLQCNFVQAQRTLDKTKLGEADVIGKLLSELFKTAAAPTATESDQELAAKLKKSVEDIELNVQSDFDKMLKKLLPVMGVMGFPSLNDT--ELRPETSLNVEALLSGHTKVVYSGTDGVHLPEGYNGLGTRNLIYMLLQLIYRSQITRPSLIFIEEPEAHLHPQMQEVFINAIQKLSSNVQFIITTHSSHV. 399
143 7.000e-23gi|325271389|ref|ZP_08137917.1| ATP-dependent OLD family endonuclease [Pseudomonas sp. TJI-51]  clstr ali  20  3LSKVRVQNYRSIIDTGEFEIERLK-TILVGPNEAGKTAILQAIQQINRANYTQISRGELSAENIEVVKATFALEKTELDHAPEKIKGQPLSYTFTRYLDNSKNDLLRLAAHLDRDIAEGSPKARTEALNKLINNVSQFRYLWSVAEILKPWLDEMLPYVDEDNEKEVARWESIVTALDDDVEINKFRLHLQKNRPVFVLYSNYFRVKPIIHLGNLAKRLETNNLDDEAYDYGNLLKLLGFTAQELSDLGKASDPSHTTTDLEAYRAKLDQRGYELNAASVELTQQIVKVWNPDDTKLKLNADGQYLKVVVEDNGVEVELDQRSEGFQWLVSFFIVFFAEAKKHKNTVLLLDEPGVSLHALKQREFRKTISLLADENQTIYSTHSPFLV 429
144 7.000e-23JCVI_PEP_1096690379419 /source_dna_id=JCVI_ORF_1096690379418 /offset=0 /translation_table=11 /length=308 /full_length=308  ali  23  1....RVQAFRCIHDSGDVVVG--DLAAFVGRNESGKTTILQALTLLNKEESDLDLCDEMTERLKSEIRIVFELNHDETEIIREKFPDLQLKRIFRTNKNPEIQYFGDVKVDEKED--ENLKHWQDVTKQILAFVESIPNYISKKLDTYFPSSKETIQTELDEFDIKIQNIATDEQQVLSEWEKTYTNVVKS------IGKISIDDTKSDTLKKFIAENLHPRFVYFSDYKKIASAGIEYIEGFDRAETVRNLLYLAELDIEQLEKSSPSKLIKFLSAASKNLTQRLNP.................................................................................................... 305
145 9.000e-23gi|224025067|ref|ZP_03643433.1| hypothetical protein BACCOPRO_01801 [Bacteroides coprophilus DSM 18228]  clstr ali  14  3IKSVTLKNFRGYRSETTVLF--SNLTTFVGRNDIGKSTILEALDIFFN-----------------EGKGCISLDKEDINKRASSEGDDEIIIAVEFFKLPDSLVIDDSNRTTLAAEYLLTESNTLKIVKRYPKAGREKVYIRAKHPTNAVCCDLLSKKITDLKTILNRENIECEDQTRKAVIRTAIWNHFADNLNLEEKEIDVTKEDGKTIWESLKK-FLPVYSLFQADRSNNDHDKEIQDPLKEAVKSILKEENVAQMCQQIAEHVTTKLQEVSNHTLDKIREMNPELANSLSPNITDLKWSDLFKNVSIAGDNDIPINKRGSGVKRLILLNFFRAEAERMQSNTIYAIEEPETSQHVAHQKILMKALIDLNKNVQVVLTTHSSYVV 380
146 9.000e-23gi|424065320|ref|ZP_17802800.1| hypothetical protein Pav013_0143 [Pseudomonas syringae pv. avellanae str. ISPaVe013]  clstr ali  12  24LSKVSLVNYRNFEFAK--FVFKPGVNTIIGENGSGKSNLFRAIRLLLDSNIYRAAHELSEGDFFRKKKGHWIVISLEFDDISTDESIQSLFVHHGAIVSGSAVNKATYNLIFRPNSHIRTKLAALSAGDKAGLATLQESMTVDDYEVWFTGRSDVDFTAPARYREIVGDFDNVWFPALDSKLITKIPHQLSVAKEVSFTFVKALRDVVSDFNGNRQNPLLNLLTRKSQEIDKSKYETITNTVKSLNLDIEALQD--------VQDVRGDIRTTISETAGDAYAPASLHIRSDLPSEAEKLLQSLKLFVGEADENYAGDISELSLGGANLIYLTLKLLEFKYQKQRNFLLVEEPEAHIHTHIQKTLFDNIN--YSNTQIIYSTHSTQI. 406
147 9.000e-23Oral.Meta HOMD pmac_c_1_160 Prevotella maculosa OT 289 [46075 - 47160] excinuclease ATPase subunit  ali  12  92...................................................................................................................................ITMKYADYIEQIEIESLWSGTKHILWNLDRKVNILSGINGVGKSTILSKVIRGLAQGGEFPSHLLKGVHLKVKPEDAKWIRYDVIRSFDRPLVNTDSLSENLITELDWQLFLLQRKYLDYQVNVGNRIIEVLQSGAKD--AALQAQSISEGKKMFQDIIDDLFKETGKTIIRTENEIRFSQLGEVLRPYQLSSGEKQMLAIL--LTVLVEDRLPYVLFMDEPEVSLHFEWQKRLIELILKLNPNVQLILATHSPAVI 346
148 1.000e-22gi|256423223|ref|YP_003123876.1| ATP-dependent endonuclease, OLD family [Chitinophaga pinensis DSM 2588]  clstr ali  16  3LKTICIKNYRRLKDVKINI--QKDTTIFVGANNSGKTSATHIFQSFLSGKADFSLHDFSVDCWKLIKDISQSTNIVEDIYKLPTISLDLWFEVSEDDLNYIIDLLPNLDWASQPVGIRLMYAPKGHDNLLLEYQTAKADAQKKGKDMFQPWPKDLSDYLTKRLNQEYEINYFQFDRNYNIIDPSYTPHALHEDKDNKKTGAAIIRSLIKVDFLNAQRHLSDNISTGRSEDLSKRFNRFYDRNLEKRENDPEIYKALFDSESLLTQHLEKVFQPTLDSLNKLGYPGFTNPKLVIKAAYSQESVSQYAQLHYSIGDLDLPDKYNGLGFKNLIYMVIEILDFHERWKEHLILIEEPEAHLHAQLQQVFIRQILNIINNTQLIVSTHSPHII 409
149 1.000e-22gi|329922944|ref|ZP_08278460.1| hypothetical protein HMPREF9412_5024 [Paenibacillus sp. HGF5]  clstr ali  11  3LYKLEIEGFRRHTDTNVLF---SDATFLIGENNVGKSSVLAALNILLNDVKRVSDEEFFS-----YMDGELTRRGSDKIVLTAEFRDVPEEAKQWIGFKGRVLRYNKDDGKTGLRVIYRKTFTPGTDCAVELRQQVKKVKTQFENCSTVGQYIDAGLNLTSVETKISEIDRDKKLTAKVKSIXXXXXXXXXXXXXXXXWFKNPGGIPANVLTKLPKFLLIPAQDKAEELSGNSLVSTLIELFNDVRDSSNNYKQAQLFLNQLAEELDPTNAQSEFGQMMTELNGVMKEVFPNTGLKADADKVIKPQFTISMFSNINTPVNLQGTGMIRSAVFALLRYRNLRNNRKTIIGFEEPEIYLHPNAAKQMRDTIYELAHNNQIVCTTHSPYMI 399
150 1.000e-22gi|399522316|ref|ZP_10762980.1| SMC domain-containing protein [Pseudomonas pseudoalcaligenes CECT 5344]  clstr ali  14  19........FKNLKNVSIDFDQQHWITVVIGWNGTGKSNVLEALATIFRDFIQGARKPAFAFNLEYRISSGSTALHVNIDADPDRPRDSLIIHVATDAEAKSDELFDASFEISSKTSALRGKRIPLKDPKFGYLPRYVFAYYSGESDRLYQVFRPYLEDFDKKLRRGEDPGLKRLFYAFLIQQSDDVRNFLAEHLGIDPDEGIESVLFVLREPPWTSKEGDPRFWRAKGVVASFLDRLYNIALAPVELSRRERVSLWSDKVLQFKYLYVKDIASLRKLVGEQRPAEF--FRDMESTHVSQLIDEVRIRVRLQKNDGTVTFRELSEGEQQLLTVLGLL--RFTAESESLFLLDEPDTHLNPRWAVDYFNYLRTFAENSHILLTTHNP... 412
151 1.000e-22METAHIT O2 GL0086641 [Complete] locus=scaffold19346_2:416:1243:+  ali  13  2......................................................................................................................................KYAEYIQQIEIDSLWSGKRHVVWNLDRQVNILSGINGVGKSTILNKVVKGLSAGGEFPSHMLKGVRLKVVPEDARWIRYDVIRSFDRPLVNPVSADKLNTTELDIQLFFLQRKYLDYQVNIGNRIIQCLQEATPDAAQKA--QTISAPKKRFQDLIDDLFADTGKTIIRTENEIRFSQIGETLTPYQLSSGEKQMLVIL--LTVLVEDQRPYVLFMDEPEVSLHVDWQQRLIDLILELNPNVQIILTTHSPAVI 257
152 2.000e-22gi|357029712|ref|ZP_09091693.1| SMC domain-containing protein [Mesorhizobium amorphae CCNWGS0123]  clstr ali  13  19........FKNLKDVTVDFDQKHWITVVIGWNGTGKSNVLEALAVLFRDLIQGERRPAYAYNLTYRMGSGDETLHINIDADPDRDREALIIHVASETEARGAGTLTPFIEGEPETSPLRGKKVSLKAFFDGGKRQFVFAYYSGESDRLYEVFKPYLETFDRQLRQGKNPGLKRLFYAFLIQQSDEVREFLADHLGIDPDEGIESVLFVLRQPPWTSKDGDPRFWYAKGVVANFLSRLQDIALAPIETSRRVDVSMWSKETLQFKYLYIKDIASLRELVGAQRPAEF--FRDMESTHVSQLIEEVRIRVRLTKNDGTVTFRELSEGEQQLLTVLGLL--RFTAESESLFLLDEPDTHLNPRWAVDYLSYLRKFAENSHILITTHNP... 412
153 2.000e-22Oral.Meta HOMD pmar_c_6_60 Prevotella marshii DSM 16973 [17329 - 18225] ABC superfamily ATP binding cassette transporter ABC proteins  ali  14  29......................................................................................................................................KYADYIEQIEIESLWSGRKHVVWNLDRQVNVLSGVNGVGKSTILNKVVKGLSTSGEITYEPARGVHLKVYPADAERIRYDVIRSFDKPLINADTITKMNLSLATELDWQIFQLQRKYLDYQVNMGNRIITALQSGNPDTASEQRISEPKRKFQDMLDNLFAETGKTIVRSENEIQFMQMGETLMPYQLSSGEKQMLVIL--LTVLVEDSLPYVLFMDEPEVSLHVDWQQRLIDLIIDLNPNVQIILTTHSPAVI 281
154 2.000e-22gi|302552639|ref|ZP_07304981.1| conserved hypothetical protein [Streptomyces viridochromogenes DSM 40736]  clstr ali  16  3ITKVKISNYRGL---ESVEIPLNRFGCVIGENNAGKSSVFQALNTFLRGSAMDSSDFLSRRQNIRVQVSFSEIGPDDLARLDTQHRKIEKEVEDGSLTLVRTYTSPGKGEIRVLSKVPRDERFSSVALEGTLKVGLSAAEISANVQHTYPEIYDQLKITKAAVRRAFEELVSNLRPEELTEGESKLPTGIDRSITTLLPDVIYIPAV-KELNDELKTTDSSTFGKLLGLLFGQIEHQMPTLQKSFDDLRQHLNVVTDDQGNEIDQRLQEVR-DVEKLIERNLQEAFPRADVRLDIPPPALRTLLSSAEISINDGVSGHFRTKGDGLRRSVTFAILRAYVDQKKKPTILLFEEPEVFLHPRAQRKLFEALKFFSQYNDVLVTTHSSAF. 398
155 2.000e-22gi|407801463|ref|ZP_11148307.1| ATP-dependent OLD family endonuclease [Alcanivorax sp. W11-5]  clstr ali  12  3LRHAKIKNFRLLADVQLALEDL--TTVVVGRNNSGKTSLSEIIRRLLAEGSAAFQLEDFSSACYDRFCTALEAHNNGQDDDVVRALIPFIELRLTFEYDPAQPQLGPLSPFVIDLDPDCNEVLAVVRYELKDGQLAQFFSGQPDTPLTDETRIAFFRSLRERIPTSFAVRVWAEDPNDAENNRQLQPSALKALIKTG--FINAQRGLDDITSRESDVLAKTVELLFATASSSSADEADKQIAQALKEAVQDIQSQIDSSFGGQLNNLIPALKNFGYPGLGN-----QELHTETLLDVRKLLSNFTKVRYAGYSGVTLPESYNGLGARNLIFILLQLAFLAEPNSPGLVFIEEPEAHLHPQMQEVFIRQLAKTAQLVQFVVSTHSSHI. 399
156 2.000e-22gi|317054720|ref|YP_004103188.1| hypothetical protein pAMI7_p09 [Paracoccus aminophilus]  clstr ali  27  285....................................................................................................................................................................................................................................FSFVKLEAKEILELGRDFKEVNGQNREPTADEIAEIAEQKRTRSILLQSAGATLTTRFRDWWKQGDYRFRFEADGNHFRIWVADDRTEVELENRSTGLQWFLSFYLVFLVERQDHKKAVLLLDEPGVSLHPLAQRDLSAFFESLSKTNQIIYTSHSPFLV 447
157 3.000e-22gi|224371530|ref|YP_002605694.1| hypothetical protein HRM2_44740 [Desulfobacterium autotrophicum HRM2]  clstr ali  14  3LKWVYIKNYRSCKDVR---INIDSMQALVGANNAGKSSIIRALDLLFNPSTTKVDEETFWN-GDSELQIWIEAVFNELSDAEKEDEKLKPFLRPDDTFHIARSATWKIEEPEEEGASPGDGKISQHFCKPMPKYVWLQEGQINGKNITEWWKNKDDLKVGDADFLGYTGTSKPAVGVWKEKVKEFIEAHLTDDDFEDVWNDNPQGYAGVLKGTLPHFIFVPAVRDITDEAKVTKTNPFGKLLYAVLEQKAELETTLEGLQKRLNRIGGAERLESIVETEKKLNDVLKEYMSEIEFQSPSVETLLTTPQLFADDGFRNMVTNKGHGLQRAIIFSILRCYSEQKKKPMIFAVEEPELYMHPQAQRNIRKVFRGIAKDDQVLFSTHSSLLL 404
158 3.000e-22gi|398308201|ref|ZP_10511675.1| hypothetical protein BmojR_01521 [Bacillus mojavensis RO-H-1]  clstr ali  14  34IHSLRIQGLRKHLDTTIHF---GASTFLIGQNNIGKSTVFKALEYLLTDIKKIDDYDEFLSTLDMDSNQNQLLT--DKIILTAEFRNCPAEANTWRGLKGRVFTYDNSSCPDETGYRIFYRKTFEKGANVKREMKQLKRNLKFSQCRTLDDYIQNGLSEELISEEFPGVDRAKNLVAAQKKQIQLFDDLYDIDEDAEEWFLNPGGIAGNVLSRLPNFLLIPAQDKIDELSGTSLLKTLNNLFEEVRNASPNFQEAQKYLALLQQELDPDDETKEFGKMMNELNNILDGVFPNTKLFSDANRSIKPVFEVKMTSNVNTKVENQGTGVIRSAVFAMLRYRNMRENAPLIIGFEEPEIYLHPNAAHQLRDTIYDLANNNQIICTTHSPFMI 431
159 3.000e-22METAHIT MH0049 GL0046007 [Complete] locus=C2352555_1:327:1892:-  ali  12  3LKSFSLKNFRGYRNEVRINM--SDLTVFVGRNDIGKSTILEALDIFFNDKSAVSPIELADVNKDAIINGDTETI------FTAVFDNLPDSIIIDDTVSTTLQDEMLLDSNGCLTVVKKYQAAGKP-------------KIYIKANHPTNPNCNDLLLQKIADLKKKANGLDCSDRTKKALLRKAIWNHYANDLQLEEGEIDTTGDGLKDIWQKLD-LYMPIYSLFQSDRSNSDKDKEAQDPLKEAVKEIFSEEAILDKLTEVANEVRNKLQTVTSATLGKIGEMNPEIAQTLNPSIESLKWADVFKNVSITSDNDIEINKRGSGVKRLILLNFFRAKAESDHSDIIYAIEEPETSQHIHHQRMLIDSFKQIATNAQIIMTTHSSHVV 378
160 3.000e-22METAHIT MH0051 GL0087638 [Complete] locus=scaffold51464_1:3755:5572:+  ali  18  3LKTIYLKNFRCYKDE--VSIEFDDLTTFVGKNDIGKSTVLEGLEIFFNNDLVKIEQSD------------ANIHGDKNVVITCDFCDLPSELVLDSGEKTNLADEYLTIANDILRIKKVYDCSKSKVSSTVYIVANHPNAVDVENLLSLKEKDLQKIIKDKELDVPLKGNPLMRKAIWASIADLNLKETEIEVSKAKEDGKEIWTKLDAYLPNYALFQSDRSSQDSDGEVQNPMKMAIQEAISEVQEEINVIQKKVQDKAMAIAQQTQEALKYIDSNLANQLTPKFTPPAS---------AKWNGLFSIAMDTDEGIALNKRGSGVRRMILVGFFKAESGSKKKNIIYAIEEPETAQHPNNQRILINSFKELSKKCQVILTTHSP... 373
161 3.000e-22METAHIT unmapped GL0431935 unmapped_[Lack_3`-end]_[mRNA]_locus=scaffold810950_1:1:1788:-  ali  22  2.......NFRSVKNSG--WIDCDDVTTLVGVNESGKSNLLLALWKLNPA---RGGEIDILHDMPVSELSTLRNRKNEVKFISAEFEMEKDCAEVISKNTGYKCEEGMRVIVSRFYDGRYEIDFPDGDPEVMICAXXXXXXXXXXXXXXXXXXXXXXXXXXMDLILEKIPKFVYYSNYGNLSSKIYLPNVIKWLNGQQIQGIEINEEQVRTLKVLFEFVNLNPEEILELGQDPKMTAIKRNNSISSNPTLKEIEKA---------ENDKEERSILLQSASRNLTTKFADWWKQGEYRFRFEADGDYFRIWVSDEKDEVGLELRSTGLQWFLSFYLIFLVESQENKDAILLLDEAGLTLHPLAQKDLAQFFVGLSENNQIINTTHSPFII 371
162 3.000e-22gi|184200376|ref|YP_001854583.1| hypothetical protein KRH_07300 [Kocuria rhizophila DC2201]  clstr ali  17  3LTNVRIKNFRAHSNT---ELPLPQLGCLIGENNAGKSSVLHAIQYVLEDRKLSAEDF-----RNPELPASVELSIEGIDE-----EDLRRVNETHRDRVREMLKDGVLTIVRTQEIDGKAESRYLKPGPRDPSWSQESLASTIKGKKGAQLRQAAVELLPPMEDALPPAPSQQQVKDAWTKLVEQLPPEELEERPTAYIAQSVKPLLPSVIYIEAVKDASVEAKSTGSSAFSKLLELLFDEVADQFSDINDQFRSVYQKLNRSLNDDGLEVDARLEAV-QRIESTIEEFVRASFPGVSLRMDVPAPTLSMIDDGHEGSISSKGDGLKRTVLFALLRAYASIRSTSYVLLFEEPELYLHPRAQRQLMAALGTFSNEHQVLVTTHSP... 397
163 4.000e-22METAHIT MH0003 GL0145375 [Complete] locus=scaffold25722_1:48:1976:-  ali  19  10LVKATINRYKCIEKEQSFNVE-DNITVLVGMNESGKTSILEALSKANYFEDDDGFKFNATHDYPRKQKKLMDKSGVIPEAVKLQYEIDNKLKATIEEDVGVVIQSTQFSFTRKYDNSKLWTVSFVDKNAFVKAKAKSFGIKSKELIEALTKVSNASSFDAFVKGQSAEIDAAILEQIKSLKKYFENKNNWDNCIDEYITITYLVPNLPKFMYYDLNNIASNSNATSSDKTAKALLELADIDVNKVIKSTNYEEFIAELEATQLTITDELFKYWTTNKNLKILFNIDKVEQTDNRNNTRIVDHVLDIRVQNQRSGVSLPLSNRSKGFNWFFSFLVWFMKIQENRDDTILLLDEPGLNLHAKAQNDLLRFLCDLSGNYQIIYTTHSPFMI 407
164 4.000e-22METAHIT MH0009 GL0005825 [Complete] locus=scaffold20608_3:8085:8918:-  ali  14  6......................................................................................................................................KYITRIEISSLWSGHKHIVWHMRPDVNVLSGGNGAGKSTILNRLIQHLRNVPTSGEIIEGMRLGVKIDFEPADATSIHYDIIRSFDRRLVNVEKLDQLTDTELDWQLYQLQRRYLDYQVNVANRMIELLSSGDPETRAKATEAAMIKTH--FQDLVDDLFGETGKRIDRKSNELNFIQYDEPLQPYLLSSGEKQMLIIL--LTVLTEDRQPYVLFMDEPEASLHFEWQKRLIGMIRDLNPNAQIILTTHSPAVI 259
165 4.000e-22gi|322434427|ref|YP_004216639.1| hypothetical protein AciX9_0790 [Granulicella tundricola MP5ACTX9]  clstr ali  20  3LIKARIINFRSIEDSNDVQIEPT-VTVLVGQNDSGKTGFLQALD--RTNSVNPKQTFNPIEDYPRRYLTKYERELAKDPPVVVQLTYSASSGEIASINNDLGPVVGDPFFFSVDFKYGGGKAIGLSVNESPLISQILAIDPLKLLAAPELGKTSTLRQFFTKLEAIDLNEAAKAQIDALRAKFLPGADNWDSLLSYYIYKQYVASRLPQFVYFDDYKLLPGKVNLPSFQQRVAAAIAQKKALSDQDSTVQALLRMAGISLEELNSTNYETIKAKLESFSNDITDRVFKYWKELDVLFDIKSDANDLAPFNSGNNLYIPFDRRSKGFIWFFSFIIWFAEEVNAKNDLVLLLDEPGLSLHALAQADFLGYIRELSSDYQVIYTTHSPFMV 405
166 4.000e-22METAHIT MH0009 GL0146085 [Complete] locus=scaffold41603_1:5758:7353:-  ali  13  3IKSVAIDNFRGYQ--QKAVVCFENLTSIVGRNDIGKSTIMEALDIFFHDGKG------LIKLDKDDINKTGKKSGNTDITISVCFTELPQCVVIDSSNETTLADEFLL----NKEGYLEVSKTFKNATTTATGMRVAIRANHPTNPLCADLLLKKQAALNSIVDELGVECEDKRKNACLRKAIWNKYSSSDELKLDEIEIDVNSKDGDIKAIWSKLQTYLPYYSLFQSDRKNCDGDNEIQDPLKEAVKQIINDSDLQEKLDYVATEVRKKLQEVSDLTLAKIKEMNSEVADSLHPKVPLTQDLKWFKGLSITGDEDIPINKRGSGVKRLILLNFFRAEAERRQKEIIYAIEEPETSQHKQHQKILVDALKTLSANVQVIITTHSSDIV 388
167 4.000e-22Oral.Meta HOMD pdenti_c_1_16415 Prevotella denticola F0289 [259053 - 258115] excinuclease ATPase subunit  ali  11  26....................................................................................................................IKNIIFALQLSSISTIMQKYADYIEEIEIDSLWSGKKHIRWTLDRQVNILSGINGVGKSTILNKVVRSLSQGGEFPSHSLKGVRLKVCPDDARWIRYDIIRSFDRPLMDSDSISKINTNLVTELDWQLFQLQRKYLDYQVNIGNRIIETLQGEADAAVKAQRISQPKKRFQDILDDLFTETGKKIVRSENEIRFSLMGETLAPYQLSSGEKQMLVIL--LTVLVEDNKDYVLFMDEPEVSLHIDWQKRLIDLILELNPNVQIILATHSPAVI 296
168 4.000e-22METAHIT MH0003 GL0063164 [Complete] locus=scaffold60272_3:166:2031:-  ali  15  3IHSVKLVNFKSIGNYESEIILEPKVTAIIGKNESGKSNILDGINFLKANSSAFSAEVVNRNSESGTENIYLITLKPDTKEIANELHTDTLVEISKAHCTVTGGFLAYYLQHVWLEFQTVVKFLDEISTNPMQLIDQELTRYRTYKQELLKNEQIDLYQIMSALEFFRTRIPKLPAERRKEFEDKLGSARDTWMELSALFPVFFYRKADKHLNTSYKLEDVEKELKGSSVAPNSLLYDFVKLIGVSPDDFVTAVRSGALPKQE------SLRRRINKLVNDKINTPFRNFYQTETITLDLGFNSGVVSFVVSEDGEALMLSERSNGLRWYLETFIDAQANDIAGRNVVYLLDEPGTSLHVNAQRELLSLFQHLSKGNQVVYTTHSPYML 390
169 5.000e-22Oral.Meta HOMD pmulx_c_1_3138 Prevotella multisaccharivorax DSM 17128 [897180 - 896335] AAA ATPase  ali  15  14......................................................................................................................................KYADYITQIEIDALWSGRKHILWNLDRRVNILSGVNGVGKSTIINKVVKGLSAGGEFPSHMLKGVHLKVDPEDANWIRFDIIRSFDRPLINAEVISQMNISLATELDWQLYKLQRKYLDYQVNIGNRIIEVLQKGGAQAASDQKLSEPKKKFQDIIDSLFADTGKKIVRTENEISFSQIGETLVPYQLSSGEKQILAIL--LTVLVEDQKPYVLFMDEPEVSLHIEWQKKLIDLILELNPNVQIILTTHSPAVI 266
170 5.000e-22gi|284106862|ref|ZP_06386305.1| conserved hypothetical protein [Candidatus Poribacteria sp. WGA-A3]  clstr ali  27  3LIKFRIQHYKSIKDSGWCWL-ASDVTTLAGKNESGKSAVLEALRDFERDVEPPDGAKPIDDSGKPMLEMCFKIEKSLLDEIETSITISRETQEYMWEKGITIIKHHDGNYDLAEEINTRLDTARNESNASRIEKIKQTVGYLSKVGYLSGITIPELEDDIANFTQRFSVYLQEIEAQAASIPDEEIGQKVHEAIETLKAEKDALHEDVLSKFVDALTKQTPYFIFFSDFSDILPFELPFTEAKERKTVQDFAKLAGLDLDEVINTTDSQWRRNILSRHSAKISGDFRSHWEQDEIELLAEADGDNLRFGIKESGDYFKPEQRSKGFQWFLSFYLRL--NAEQAETSVILIDEPGLYLHSKAQKDVLKVFESLSGKSQVIISTHSPYLI 393
171 6.000e-22METAHIT MH0030 GL0048050 [Complete] locus=scaffold56965_1:16:834:-  ali  13  3......................................................................................................................................KYADYIKQIEIDSLWSGTKHILWNLDRRVNILSGVNGVGKSTILNKVVKGLAQGGEFPSHLLKGVHLQVEPEEAKWIRFDVIRSVDRPLMNAEMINKIDLSLVTELDWQLFQLQRKYLDYQVNIGNRIIAVLQGEPDAAQKAQTLSEPKKLFQDIVDSLFKDTGKTIIRTANEISFNQMGEQLLPYQLSAGEKQILAIL--LTVLVEDNQPYVLFMDEPEISLHFEWQKRLIDLVLQLNPNIQIIMTTHSPAVV 255
172 6.000e-22METAHIT MH0048 GL0004422 [Complete] locus=scaffold62256_1:278:2311:-  ali  20  3LVKARVTGYRSIIDSGYFDVENGK-TILVGPNEAGKTAILQALQKLNPPKDVELFSPLRDYPRAKYDEDIEKLEESDVAEVPEAYRDIIYVYGRHLDNTTWHRLDNAPAKLTFADIEKDLLKMIIHFQETIQTEFDTIVLELTRQSIIGVEKSKQIQAWLKKYIKYLSDDNAKESTRYEKIMAQLERSIEEKLLPQFILFSNYFRIKLRKLADRIASNSLDDSQYDYGNICLLKFLGFTPQQLADAGDTSRFNNLSDPQQYEQYKAQLDERDYKLNAATIRLTNAIREVWNPTQNKLRIKVDGQYLKVVVEDEGVEVELDQRSEGFQWMVSFYVVFFAEASDKKNAILLLDEPGQSLHALKQAEFRETLSKLSMKNQTVYTTHSPFLV 437
173 7.000e-22Oral.Meta HOMD ppal_c_26_53 Prevotella pallens ATCC 700821 [30081 - 30941] ABC superfamily ATP binding cassette transporter ABC proteins  ali  13  10..............................................................................................................................KITELLCKKYADYIKEIEIDSLWAGHKHIRWELNRHVNILSGINGVGKSTILNKVVKGLAQGGEFPSHMLKGVHIKVSPDDATWIRYDIIRSFDRPLMNIESISKADLNLVTELDWQLFQLQRKYLDYQVNVGNRIIETLQSGAPDAATKQTYSAPKLLFQNIIDELFAETGKKIVRSENEIRFSQMGCTLYPYQLSSGEKQMLAIL--LTVLVQDSRSYALFMDEPEVSMHIEWQKRLISLILSLNPNVQIILTTHSPAVI 270
174 8.000e-22METAHIT MH0086 GL0124371 [Complete] locus=scaffold2733_5:902:2200:+  ali  14  2..KIKMKN---IGRVAEADIEINGIAVIAGENGTGKSTVGKALYAAFNSMSDSENKIDRMRRNSVE-------------------RAIRKAYVGSPLDSTSRHRRTAGRMNSFIDRVFSGECTRDELIDEIKEYYGEEISREIESDFTNGVAGVADQIIEIMDISDDEVFRAIATNRFRSEFNGQINSVFGEEPGKVELQIKDASTVFSVASDEVAEVHDRRVLRFRAHYLDDPFLIDSLPAFRFKPLLGHQEELRQDLIQATIRNDDSESSLFEEIAKERHLKVLMDKVSSLPGHFERSESRGHLTYLEEGFARGLEPGNLSAGLK-TFAIMKVLLKSGALDAGGTIILDEPEIHLHPAWQLAFAEIIVLLQKGMHVLMSTHSPYFL 372
175 8.000e-22METAHIT MH0078 GL0041319 [Complete] locus=C3061608_1:1307:2152:+  ali  17  112..........................................................................................................................................................................................................................................TELDWQLYLLQRRYLDYQVNLGNHMIELLTAGGPEAGQRAAQLA--QGKTEFQDMVDSLFGETGKKIDRKSNEIVLLQQGERLSPYVLSSGEKQMLIIL--LTVLTENKEPYVLLMDEPEISLHVEWQQRLIALIRQLNPRVQIVLTTHSPAMI 261
176 1.000e-21gi|91224631|ref|ZP_01259892.1| predicted ATP-dependent endonuclease of the OLD family protein [Vibrio alginolyticus 12G01]  clstr ali  16  3LKKVVIENFRGI---TFAAIDVDDFTTLVGRNNIGKSTILSAIRIALNTSHPTLDDWPNKACSEEPMRITCEFDIQEWEKRKPAISQLMDGENLKIRMEGIWTEEGGSPAYKYYVHNEKITTPFDGVKITAARKDEFLSTVLAALDIKDAADYNQRLGEIEQYVIENHEDKVERSTGWHEKSFANSLQQAIPHVMYVPASFRIEEDLKVTSNTSPFSILFNKRLFPKVKGDDSYSEYIDKARLLSEKLKGQAKDG----------TCIEGLNAELETLSSTLNQIIDFDSKVKLTVGDIDIETAFRKTLLIDEQLETSLVYQGSGVQRALAFALLEGNASVDQRTTIVLYEEPELYIHPHLMRRLKDTLHSRSETVQVICSTHSPFLI 388
177 1.000e-21gi|383459843|ref|YP_005373832.1| ATP-dependent OLD family endonuclease [Corallococcus coralloides DSM 2259]  clstr ali  13  2LTKVSIRNFRLLRNVEMLFDEQS--TLIIGRNNSGKTSLAELFRRLVEDGIPAFTLQDFSLDTHEEFWNAYLLSTQGQLDKARDTLPSIKVTLTLSYDQETLDLGHLADFIVDLNPECSEVQIEITYALIPEKAKPFFETPATTHEQPPPDKALFFRTLKERLPHHFRTLASVDPNDATNRKHIEWSKLRLLVQGNFISAQRGLDDITHKENDTLGKILNSLFNTAESES----------AHQDDRKTTHDLRAAVSDIQAKLDTGFNEKLKNLLPAINMFGYPGLPNILTETLLDVGLLLRNNTKIRYSGNNGVHLPESYNGLGTRNLIYILLKLLFEAKPTTPSVIFIEEPEAHLHPQMQEVFIKLLSEMFTKVQFVVSTHSSHI. 398
178 1.000e-21Oral.Meta HOMD pot306_c_44_16 Prevotella sp oral taxon 306 str. F0472 [9103 - 7832] (REVERSE SENSE) ORF  ali  11  64.........................................SFFAIFVISVTFNYLFHQPIKTLIIASSKCFVSFSQVQRYGETLVFKILTLCYFPYHNYGIYVKKSLFYRQTDKKHYICDSVIILQESLMQKYANYIEEI--EIDSLWSGKKHIRWTLDRQVNILSGINGVGKSTIINKVVRSFSQGGEFPSHLLKGVRLKVNPSDAKWIRYDIIRSFDRPLLNSDSVSKMDGNLSTELDWQLFQLQRKYLDYQVNIGNRIIATLQSGKPAAEEAQLISLPKKRFQDMIDDLFTETGKTIIRTENEIRFSQIGETLYPYQLSSGEKQILVIL--LTVLVEDNKPYVLFMDEPEVSLHVDWQKRLIDLILELNPNVQIILSTHSPAVI 407
179 1.000e-21gi|83943085|ref|ZP_00955545.1| hypothetical protein EE36_12928 [Sulfitobacter sp. EE-36]  clstr ali  15  3LDKIKIKNFKNLKDVTIDFDQNHWVTVVIGWNGTGKSNVLEALAVIFRDLIMRKRSPEFAFLLHYRMDSGEATRHIEIDADPDRAKEPFIIHVADDAEAKRGKKISLSVFLKEEDRYLPRYVFSYYSGESTRMHEVFSPYLERYDSDLRGGKDPGLKRLFFAQPVHSQFVLLAFLIQQSENVRDFLVDHLGIDP--IEGIESVLFVLRQPPWNSKASDGDPRFWNARGVVSSFLDRLYNIALAPIEISRTEPVSLWNKKKLQFKYLYVKDVDALRRLVGEQPAAEF--FRDLESTHVSQLIDEVRIKIRLRNSDGSVTFRELSEGEQQLLTVLGLL--RFTADSEGLFLLDEPDTHLNPRWCVDYISYLKQFVSESHILLTTHNP... 414
180 1.000e-21gi|345883584|ref|ZP_08835024.1| hypothetical protein HMPREF0666_01200 [Prevotella sp. C561]  clstr ali  10  3........................................................................................IYEILSLCYLAYHKRGIYIKIRLSYCYSHKKPYICITIVTISTSMQKYADYIEEIEIDSLWSGKKHIRWTLDRQVNILSGINGVGKSTILNKVVRSLSQGGEFPSHSLKGVRLKVSPNDARWIRYDIIRSFDRPLMNSDSISKINVDLVTELDWQLFQLQRKYLDYQVNIGNRIIETLQSEADAAEKAQRISQPKKRFQDILDDLFTETGKKIIRSENEIKFSSLGEELAPYQLSSGEKQILVIL--LTVLVEDNEHYVLFMDEPEVSLHIEWQKRLIDLILELNPNVQIILTTHSPAVI 301
181 1.000e-21METAHIT MH0030 GL0025945 [Complete] locus=scaffold32386_7:1325:2143:+  ali  13  3......................................................................................................................................KYADYIKQIEIDSLWSGRKHVLWNLDRRVNILSGVNGVGKSTIINKVVKGLAAGGEFPSHLLKGVRLSVVPEDAKWIRFDIIRSFDNPVVNQELLNKVGISLVTELDWQLYTLQRKYLDYQVNVGNRIIAALQSEPDAAEKAQALSEPKKKFQDIVDDLFADTGKTIVRSANEIQLNQMGEVLQPYQLSSGEKQMLVIL--LTVLIEDQKPYVLFMDEPEVSLHVDWQQRLIDLILDLNPNVQIILSTHAPAVI 255
182 1.000e-21gi|255284296|ref|ZP_05348851.1| conserved hypothetical protein [Bryantella formatexigens DSM 14469]  clstr ali  17  3LKKLIIKNFRIFDEMGIELIFNKGVNAIIGENNSGKSSVIDALRIVYSTVTYRKDIFFSKSDFHVCEDGTV----VDYTQFDVYLEDVPRRMTEIWNPQSESGMGGDFHIKFEKYIAPNGTEKVRSVYWGFGTEGNQLSSDTFEATDVVFLGALRDSESEMKPSRNSKLAQLLRNLVPEEAVREELVQILNNANNDLLKKEQLKKTRNTINQNLARIEQEFLNQQIDIGLVEPRFDSIASSLRAWVKPKWILINKEDAVYETAHTYFQSNM-----DLKKIQDDAKGIYFEISILDSETELDKKVADRISEIANKSFELYQNGLGYNNLLFMSAVLGDMAIERGGNLLLVEEPEAHLHPQLQELVHDFLSDANKNIQIIYTSHSPTL. 386
183 1.000e-21gi|322418046|ref|YP_004197269.1| SMC domain-containing protein [Geobacter sp. M18]  clstr ali  12  3IESVRIKNFRGYADETIFF---DNYTCLVGPNGAGKSTILSALNVFFRQYKDSKTDLSKLSIEDFHHKNVDEPIEITVTFTELSDAAKTELSDYVRQDKLIVSSVARYDSATERAEVKQFGNRLGFEGFKQYFEADKSGVSAADLKNIYAGFQSVFSELPSAKTKQDMANALRLYESQHPGKCVLIP-----SEDQFYGASKGTSRLAPHVQWVFISADKDVSEESDETKNSQLLARTIRSKVNFADKVSKLRDDIRRDYQAILDGEQPLLDELSVSLGIRLKNWAHQILWKQDPDKSVKVEEPWAYIKLGERGFEGDLTRFGHGLQRLLTLLQVLSEVDDANAPTLIMIEEPEIYQHPPQAKYLAEVMHDLSEGSQVIACSHSPLFI 394
184 2.000e-21gi|393764209|ref|ZP_10352821.1| hypothetical protein AGRI_14495 [Alishewanella agri BL06]  clstr ali  15  3LHSVEIKNFRKLKNCKIIF---KDATFLIGSNNAGKSSVFAALNNLHKNTNVSREDY-SKTFIPEDESYKYAEEIEIIAEYRNIPEDANNWIGFRGRITKKAPPTPGDTGYAITYKKIWSISQTKPKVYLLEHERTRSEKYANAKKINDLKGDDFTEEFLKEHFEEQDLEKSLTTAAAKQKILDLPQLWDIKTDEDATWVENPGGIPGNVLSKLPRVVVIPAESCVSELTSNNLYSLLTELFDQVRKKSNNYEQAQKLLNELAKELNPSDGNTDFGRLIQDLNGMTHNLFPESSIHVSASLDQPEKSIKEMESNVKTAVPYQGHGMIRATAFQLLRFTNDFVNKNSIFCFEEPEIYLHPAAANQMRDALYDLAGGCQIVATTHSPFMV 400
185 2.000e-21METAHIT MH0074 GL0112114 [Complete] locus=scaffold1409_4:2438:3280:-  ali  14  1..................................................................................................................................MEEQANYIQRIEIHRLWDRFNIAWDLRPDVNILSGINGVGKTTILNRSVHYLEELSGEI-KNGEIEGVRITFDRPDATYIPYDVIRSYDRPLIMGDFTARMADPNVKSELDWQLYLLQRRYLDYQVNIGNKMIELLSGDEEQRSQAASLSLPKRKFQDLMDQLFSYTRKSIDRRSNEIIFYQDGERLLPYKLSSGEKQMLIIL--LTVLVRDNAHCVLFMDEPEASLHIEWQQKLISMIRELNPNVQLILTTHSPAVI 255
186 2.000e-21METAHIT MH0055 GL0029154 [Lack 3`-end] locus=scaffold20574_1:2:808:-  ali  13  3......................................................................................................................................KYADYIESVEIESLWSGRRHVTWSLDRKVNILSGTNGMGKSTIINKLVRSIGPQGDIVNHVMKGVHMKVSPEGATHIRYDLIRSFDRPLIHSELVTDIGMNLVTELDLQLFKLQRKYLDYQVNIGNRIIAILQAGGNDAAERQAVSEPKRMFQDMIDDLFSDTGKTIIRNENEIRFSQIGETLYPYQLSSGEKQILVIL--LTVLVEDNQPYVLFMDEPEVSLHIEWQKRLISLIVQLNPNVQVILATHSPAVV 255
187 2.000e-21gi|163801686|ref|ZP_02195584.1| hypothetical protein 1103602000597_AND4_09537 [Vibrio sp. AND4]  clstr ali  20  3LTKFRVRNFRSINDSG--EITTNDLTAILGRNESGKSNILLALQHLNPPNFPRDRRLAEQDENTPFLNTEWRLSQKDRESLSSIFPRASEVSTVTISRRYGSTRYIGLSRLKNQSLDIKAINRNIDKIVTLLDVLKTDENADSVDTAVQQVSMLKATVTQSANSKAVLDQYDQVFRGAAQYTLEKQDEFLDLKDEFEQIVKALDDGEQEKKAFNFIIECLPVFVYIDEYPHLDGHQNLSILSQHRQNHQLTAEDDIDPSELQELESDPETRNQLVNRAGAVVTREIRRLWTDRELKVRFNLDGNFFDTYVSDPDVEVNLNERSRGFRWFFSFYITFFADTHDAENAIILLDEPGLYLHAKSQSDLLKHLDDDFSN-QIIYTTHSPFLV 415
188 2.000e-21METAHIT MH0016 GL0043435 [Complete] locus=scaffold37007_2:2757:4817:-  ali  13  3ISHIKVKGFRNFKDSDI--EFNDGLNVLIGHNNAGKTNLLKALQLVIEPHYRYRRLNANDFNRDISLENLKSQSPSVTISVTFKNSNIEYN--------------------EQEEDLRVVANWFTDMENGYAAMLTYRFYLPAEKEDDYKAAMADVEDIKNGWSILENDFLRYYVYKLLAPLDAPIQPEMDKLERFDFQFLGAMRNVEDDMFYGRSTMLKDVLNFFIDYGIKTKGDKTKEEKEELKDVRNDFGNEATALMTSLLERLSEGKDVMLDYAHETGASFNNALPDFKSTLTEQDLFSALKLIIKYGEDIEISATHNGLGYNNLIYMSLLLAKMQADADGNILAIEEPEAHLHPAMQYKFLKFLDKNLKVRQIFITTHSSQI. 383
189 2.000e-21METAHIT MH0009 GL0027940 [Complete] locus=scaffold66740_2:512:2338:-  ali  16  3LREVILKNFRGYYDETRISI--NDLTALIGKNDVGKSTILEALEIFFNQAKIESGDKNVFHTAEDTIIGCVFDDLPSEIALENVSTSFTAEYLLNEDGDLEIRKIYRTGG------------------------KQTIWINAKHPSNAGFDDLLSKKNQELKAMIRENGLENSVNLTINTEMRTALWESLGESITYQKKLISADQADEKKLWPKIE-PLLPQYHLFKADRSGN-ADEDKVAQDPMQDAVRMALEEQKKQLADIAGEVQRKVSDVASRTISKLKEFDSELAKTLTPEFKKEPMWEKAFAFSLTGDNEIPLNKRGSGIRRLVLFSFFRASVESEGKSIIYAIEEPETSQHPDAQRMILKTFQEMTEKNQIILTTHVP... 364
190 2.000e-21Oral.Meta HOMD pint_c_1_9607 Prevotella intermedia 17 [425888 - 425040] ABC superfamily ATP binding cassette transporter ABC proteins  ali  12  2..........................................................................................................................LYLRRNKRTIMQKYADYIEEIEIDSLWAGLKHIRWTLDRKVNILSGINGVGKSTILNKVIKGLSQGGEFPSHMMKGVHIKVSPRDANWIRYDIIRSFDRPLLNIESINKADLNLTTELDWQLFQLQRKYLDYQVNVGNRIIEALQSNGEAAAKAQTYSAPKRLFQDIIDELFAETGKKIVRSENEIRFSQVGETLFPYQLSSGEKQILAIL--LTVLVQDGLPYVLFMDEPEVSMHVDWQKKLIALILSLNPNVQIILSTHSPAVI 266
191 2.000e-21METAHIT MH0023 GL0019469 [Lack 3`-end] locus=scaffold28158_3:1055:2275:+  ali  12  3LKKLHISNFRCFRDYTI--EFAPGVTVLFGKNGSGKSTLIHAIHKALSFLMYSEEIKEKTGKGKKAKVIDVKTFRLNNPYPTVEGFSVLDCNYEGA------KPIEYEINIHADAIFGEHFPLDWDMTGVAPKMSLRKSGYRKEFLELYKWSKDTCPSPQLPLLAYYSDGYPHYTLFNQRNRKEETKRDFHLKNSFPELGYTDWNSEKGFTNIWLERLRNKLSRQEVIPREIRLIEDRYKAGKIEKEKYNTFIEASKKELEECNNEISKI-STCLQLFSEGDGNNMEVVSLELGIHYRTEVN------IVTPDRERYAFSVLSAGYKRLFYIALDLAYRSFLLSNGVAIIDEIDLHLHPELEQTVLERLTKTFTHIQFVVSTHSPLVL 382
192 2.000e-21METAHIT MH0045 GL0127725 [Complete] locus=scaffold6148_5:23205:25094:-  ali  17  3LKKVTIHKYKSFLTEQSYEVE-SAITRIVGKNESGKTALLEALAK--SNYFEDNAEFKFDKDLDYPRSELTKVRNENPAVLTCEYELSDDIIKSVEDDFAEGIVAGKTFSVTSYYDNKKTTTGISVDFAVFKEWLIAAFDIGDQCKELIHAATAYSELESTVSENNSLPGMKEIKGELDR-----IKKDSHGWTNPLEGYIYHKYVSPAIPKLWYFSDYFSLPCRINLNEFSSGRPTGSLTSEEFKIAKALFDLSGLQLSDIQSESNFEAFKAQLEATSNAITDEMFEYWSTNNLEIRFDIEYLNIRIYNSKHRVTLPLKNRSKGFLWFFSFLVWFSKIQGDKNKYILLLDEPGLSLHASAQSDLLRFIEKLAPDYQVIYTTHSPFMI 392
193 2.000e-21gi|154509446|ref|ZP_02045088.1| hypothetical protein ACTODO_01977 [Actinomyces odontolyticus ATCC 17982]  clstr ali  14  7LVEATVKGLFGKYDHSVTFKDDSRFVILYGQNGVGKTKLLEIIHHLSRLDYTRLSQMPFDPNESEEDTGSYDILFRLCKPDTEPIEELSEFHEFLIRETTYLPIGTDLWQDTSDGEVVTYSDLTRRYHRPYIRMGQPCIEIHESFRDFCYDTPTYFINTQRLSALQTYTDRSETHIGFNSVRRQQAATRIRELSETIKEQLNKAQTEHSRLSQQKDRSFPSRVLQAVDSDTPRDPNEIQSRYAEQNKFRDRLSKDWELALFDLYVRDANEKLEPFRSLLKRIELLQNLVNDRLETKVLSITDTMGLIVKRTDDGEIIDLDSLSSGEQHEIILLFDLLFNVEP--GATVLIDEPEISLHIAWQLAFIPDVVKIAEDVRFIVATHSPQII 435
194 2.000e-21gi|359788126|ref|ZP_09291108.1| hypothetical protein MAXJ12_02231 [Mesorhizobium alhagi CCNWXJ12-2]  clstr ali  34  1..................................................................................................................................................................................................................................................................................MQSAGTKLTSKFKDWWKQGDYRFRFEADGDHFRIWVSDDREEVELEGRSTGLQWFLSFYLVFLVESEEHKDAFLLLDEPGLSLHPLAQKNLSSFFVNLATTNQIIFTTHSPFLV 117
195 2.000e-21gi|167830098|ref|ZP_02461569.1| putative old protein [Burkholderia pseudomallei 9]  clstr ali  16  5..RFEVRNFKC---VEYASLEWEDLLVLIGENNAGKSTILSAIAAFLSGSAIKD------------PSLFRRHLTDVANAIELIGHFDGLSDEETTQVAVRGRMNGDRWVLKKRYWFEAGEDGESGGWKEALYSFSGAERFEGEADATWNAFPEEYQPLIAALPNRGVRPTNAARETLREAVRRQRPDLVAFGAPNWVWKSNANSILPRPILVRAVQEASDETNAKDASTYGKLVNLIVERSLAQRPEMVRLQEALDEVLALFRPDEANEVRDLQDRINRSLNEVVGGIRTEAPEIRSMVLPSTSLVIRDVEAGIDTDVGHQGHGLQRTLVLLQSLADAQAQVVPNILLIEEPELYLHPQMERLMRDVLYRLAESTQVACCTHSPVFL 407
196 2.000e-21gi|162457056|ref|YP_001619423.1| OLD protein [Sorangium cellulosum So ce56]  clstr ali  19  3LSQVVIRRFKSIKELSLTIPARDDFVSIVGENNVGKSSILEAIRLACPGSGKP--TIDQFRNLDPSIPIEVELEFDRLTDADKEKHAVRV-------------HLFVDHGVEKYRIKKVWRAPGVIPESFAYSPDTRQYRFREWPDLKSKAEFNLGAEWKAIVDSADAAGSKKLKDNYLRAAVQMNSPLIEETEPWSPNLSNLDSVLPTVIWVPALRETAEADVSEKQSAVRKIVNALFEQQLSKHDKVIRFRRAAEELEQLFASDGKHKIVASVEAHITSKLKELIDICADLRFTADVTADASKTEFRVLDGNISTRPEHQGHGAQRSIVLAQLRIIGSSDASRTLFLIEEPEIYLHPEMCRRMRDALLRIAQSGQVVCTTHSPVFL 404
197 2.000e-21METAHIT MH0041 GL0013483 [Lack 5`-end] locus=scaffold88183_1:1:903:+  ali  35  1...................................................................................................................................................................................................................................................................................................TNKINLLFDMDNGIINFVVEDDGTSITLSERSDGLKWYISMFLQLYSSKKTHKYSLILLDEPGTSLHVIAQKKLLELLMQ-KGDYQIIYTTHSPFMI 101
198 3.000e-21gi|163941362|ref|YP_001646246.1| hypothetical protein BcerKBAB4_3445 [Bacillus weihenstephanensis KBAB4]  clstr ali  15  3LTTIKLENFRSY--HGEVVIDISNFTTLIGRNDAGKSTILEALEIFFNAEIVK-----------PDPNDVCKFSGGTSFSITCCFSDLPSSIIIDDSVPTSFNREYLLNNNGELEIKKVYNCSAVRIIPKV--FLNTVVPDIQEMHELVTFNNLSLKAIARKQDINERLYTKTSNVSLRDAIRMHLRDKYPDVGDREYLLEISGTNKNLKEIHTKIGRLLPHYALFQADRPSRDED--SEVQNPLKLAIKSAIDQVAPELERIREKVQDEVLDVANHTLRKLEEMDPKLAQQLIPQPKKEPEWHKIFNFTLDGDNEIPINKRGSGVRRLILLNFFRAERDSQEKDIILAVEEPETAQHPNNQRKLVETLMSLSQNYQVLITTHVPAI. 376
199 3.000e-21gi|421603422|ref|ZP_16045824.1| hypothetical protein BCCGELA001_33573 [Bradyrhizobium sp. CCGE-LA001]  clstr ali  12  6LREVRIKALFGHLDYTINFSESENVSLLYGENGAGKTTVLRMIYAALSPNNGEGLRSYFRFISFRELSIETSIIQKKKPSDSFYRYVVSTPIGTVDSVLFRKDDNSTSKVEEADLDRARDLLANSGFDIHYLSDDRLLRSSSSYLATTIQTESEHRPDRRNKIPWLIEEARGITDRTWLNIDVTASQVTDAFLEQGNQGQRRTNNIYLDMANRLVSSWNTPSESSDDAFVRMALEIETLERERDELPLLKTLVSFPSREFAEILNNAPADRRHDLVRILRRILGLLVDELSAFFKRKTLNFDFSDSFVVRSPQGEPIPLGMLSSGEKQIFLLLC--SAILSRRSPCIFLIDEPELSLNVYWQRSLPRTLQRLVENTQYVLATHSLEIL 419
200 3.000e-21METAHIT MH0033 GL0010431 [Complete] locus=scaffold39664_1:3406:5244:+  ali  14  1..................................................................................................................................MKKQADYIKRIEIKRLWGRKDISWELRPDVNILSGVNGIGKSTILNRSVNSLTALEGGALSNGSAPGVHFVFSPEDATQIHFDVIRSFDRPLIHSELLEKMADKNVKTELDWQLYQLQRRYLDYQVNIGNRIIECLTSDGPDGQLRAAEMSYKTKFQNLMDDLFGETGKKIIRKSNEILFEQDGDILYPYQLSSGEKQILVIL--LTVLVQDNRRGVLFMDEPEVSLHVEWQQRLISLIRQLNPNVQIVLTTHSPAVI 257
201 3.000e-21METAHIT MH0082 GL0071509 [Lack 5`-end] locus=scaffold104191_2:174:2186:-  ali  14  7IQKVKLQNFRSFGDEGICFLFNKGINAVIGENNNGKTALIDAIRIAFSCVLYKKDIFFSKTDFHVNAAGERAAFAQIDVYLKDVPQNLIEIWDPIQPDCGEFHVVFTLEKTAAGTDKVKYRAWGGKCEGNLLSSDTLEAINLDYLSALRDASSEMKPSRNSKLAELLETIAKEP------KDKEALVDKLRTANQEILQTESLGKTKQVINENLFSIEQDLMYQKVDLGLVEPRFESITASLRTWIVPRWCFMGEDHQKYAQVRALESSDK----YKAYIHDQECGLYIDVDSLIAKKEDLDDSLKDALVGLKKYSFEIFQNGLGYNNLLFILGDMSFEKSGIYENVFLVEEPEAHLHPQLQELILNFFMKNVENIQVIMTSHSPTMV 390
202 3.000e-21gi|358447880|ref|ZP_09158392.1| ATP-dependent OLD family endonuclease [Marinobacter manganoxydans MnI7-9]  clstr ali  14  3LNRVQIKNFRLLRDVELFLE--SETSVIVGRNNSGKTSLSEVIRRFTSDKNATFYLQDFSTECYEEFCAAFKAEREGKEESEIRTLLPIIELRLFFRYNPAQPRLGPLGEFIVDLDMACDEALVVMRFEPMDGAINRLFDGLPEEITDATRKLFFREIAARIHNLYGIKVWAEDPNDASNRKESSQAAVRTLLKTGFINAQRGLDDITTKESDVLAKVLEGLFNNASLDTADEKERKIAEQLEEAVRTIQETIDSDFRSQLQQLLPTLQTFGYPGLGGSVLTTETSLDVHRLLTNHTKIRYEGDSG-VLLPESYNGLGMRNLIFILLQIVSFYREFRAQAHAPGVHIVFIEEPEAHLHPQMQEVFIRQIEKLNKEVQFLVSTHSSHI. 398
203 3.000e-21METAHIT MH0009 GL0096645 [Complete] locus=scaffold59657_3:1422:2249:+  ali  17  1..................................................................................................................................MKKQADYIKNIEIKGLWGRKNISWALRPDVNILSGVNGIGKSTILNDSVRTLDKLVGGTLTNGIKPGVNFEFYPEDATFVKFNVIRSFDRPLISSTLLEKIGNQNVRTELDWQLYQLQRSYLDYQVNIGNRIIKALTSGSPDGHLQATLSQAKTKFQDLIDELFSETNKKINRQSNEILFFQDGDTLTPYQLSSGEKQMLVIL--LTVLVQDNQHYTLFMDEPEISLHVEWQQRLIELIRQLNPNVQIILTTHSPALI 257
204 3.000e-21gi|383452362|ref|YP_005366351.1| ATP-dependent OLD family endonuclease [Corallococcus coralloides DSM 2259]  clstr ali  12  3LDRVTIRNYKSIKSIELRIPQKEDFLSIVGENNAGKSSILEAIRLACSASMKASEEQFPGNASSNGPIVVELEFDQLTDSDRQLDALKDNTFFDGTQQRYRLKRVWKAIGASAENWSYSPDRPTTYQLTGWSSNKKNLKQLGTTDERWKSLLEHASKEVS--ISKLTQEHLIKSARELQSPLLTESKEAWMQYPGSIATALEAALPSVIYVPALRETSEETDVGSKQSAIRKIVKALFDQQLANHECVIRFKSAADELQELFATEGKHRIVASMEEKLTEKFQELINIRAELKFTTPDVTSDLSSTEFRVLDGALSTRPDNQGHGAQRSIVLLLQLYVEQNRQQHMLFLIEEPEIYLHPGMCRKMRDTLLKIAQSGQVLCTTHSPVFL 405
205 3.000e-21METAHIT V1 GL0101100 [Lack 3`-end] locus=scaffold82229_3:2:1036:-  ali  22  18ITKIRIKNFGSIKDEKIIKFNKD-VTTFIGKNESGKSTLLRAIAKLNNGKILESEKNVLLREEDSVIEATFRLELDEIKNI-----NLEQEENTNYQFYKFPENLGTLYYTKKID----ESESKYYGLYYLKEDKKGKKTIETNINSIF------IEKIRNTIIELLKNEKDENTITFLNDIKKFNEDEIKNKLTSLNVDADLKEQLEIISSEIKKNNWIYKFISFSSFKDV-LSDNVLLENIESNLQALNILKVANLNLEKIKKAFEENDEIALGDMETEVSKKFKEIFQQTDENFKLRIRKKEIIFLTQDDSKAINLSQRSDGFKWY........................................................... 345
206 4.000e-21METAHIT MH0012 GL0050763 [Complete] locus=scaffold25266_3:1021:1860:+  ali  15  1..................................................................................................................................MEKQANYIRRIEIDGLWGRFNVAWDLRPDVNILSGINGVGKTTILNRSVNYLEELSGEMKNGVKQ-GVHIYFDDPEATYIPYDVIRSYDRPLVMGDFTARMADKNVKSELDWQLYLLQRRYLDYQVNIGNKMIELLAGNTEKGREEAAGLSLKKRFQDQIDELFSYTRKKIDRKRNDIAFYQDGELLLPYKLSSGEKQMLVIL--LTVLVQDNEHYVLFMDEPEASLHIEWQQKLIAMIRELNPNVQIILTTHSPALI 256
207 4.000e-21gi|10956128|ref|NP_037556.1| hypothetical protein pMD136_p01 [Pediococcus pentosaceus]  clstr ali  16  3LVSVTIHNFRGYKNTKINID--DQLTTLIGKNDVGKSTIVDALEIFFNNTVVKLDTNDLNIY----------ATDSKLVSISCEFSDIPESIIIDSNQQTNLKDEYLVNANGNLEIKKVY-DCSKKTPKPQIFAVVHYPDNPEIADLLYLTHSKLLTALKKLPPAIQETVTSRVANAPIRQAIRSAYNITNFLTKDIDLQKVDGKTLWDKIETCL-------PIYALFQSDRPSNDSDAEVQDPMNTAIQESLSNAAXXXXXXXXXXXXEVTAVAEMTISKLKEMDPEIAKGLEPQYQESPKWNKLFKFVIADEKGIPLNKRGSGVRRLVLLNFFRAKDKLKTNGLIYAVEEPETAQHPDNQRKIMQALLELGQNCQIIITTH..... 372
208 4.000e-21gi|340346985|ref|ZP_08670102.1| hypothetical protein HMPREF9136_1100 [Prevotella dentalis DSM 3688]  clstr ali  15  3LKRLYLENFRSYKDL--ISIDFDSITTFIGKNDAGKSTILEALEIFFNNDIVK-----------IDSSDANIFSNSKKVTIACDFTELPNELVLDSGEKTSLKEEYLLIDEDTMRIKKIYDCNKSKPSEDIYIVANHPTADGFENLLSLKEKELQKMVKEHQLNCPQKGNPIMRKALWKSTDDLKISEVEISLTKSKEDVKDIWSKIESYLPTYALFQSDRSSSDSDGEVQNPMKVAIQEAISEVQKEIQEIQEKVREKATEIANQTHKALQAIDPSLANELTPTF---------ATPAASKWNSLFSIAMDTDAGISLNKRGSGVRRMILVGFERKAKKSNKKDIIYAIEEPETAQHPNNQKILINSFLELSPHCQIILTTHSP... 372
209 4.000e-21gi|357060536|ref|ZP_09121304.1| hypothetical protein HMPREF9332_00861 [Prevotella sp. oral taxon 302 str. F0323]  clstr ali  16  2......................................................................................................................................KYANYIRRIDIPSLWSGHKHIVWELNNILSGRNGEGKSTILNRLIQHLREELSPADTSTGLTMEFAPSDATGIRYDIIRSFDRQLVKSDHLEQLTDVHVATELDWQLYLLQRRYLDYQVNVGNRMIELLTSGDPDARKKATDAAI--IKTRFLDIVDDLFSETGKKIDRKSNELQFSQYGEVLQPYVLSSGEKQVLVIL--LTALTEDQQPYVLFMDEPEASLHFEWQKRLVGLIRELNPNAQIVLTTHSPAVI 259
210 4.000e-21METAHIT MH0055 GL0018277 [Complete] locus=scaffold17971_9:1018:1845:+  ali  14  1..................................................................................................................................MSKQADYIKRIEIKGIWGWKNIAWDLRPDVNILSGINGIGKSTIVNQAVHVLHGELDKQILPENVRFVFSPEDASYIRFDVIRSFDRPLLNAGLMQKVTDVNVRTELDWQLYRLQRRYLDYQVNIGNRIIELLTEGTPESQRKATEA--SVPKRKFQDMIDSLFSETGKKINRKSNEILIEQDGDELHPYQLSSGEKQILVIL--LTVLVQDGQPFALFMDEPEISLHIEWQQQLIKLIRELNPNVQIILTTHSPAVI 258
211 5.000e-21gi|198274182|ref|ZP_03206714.1| hypothetical protein BACPLE_00322 [Bacteroides plebeius DSM 17135]  clstr ali  16  1..................................................................................................................................MKKQAEYIKRIEIKGLWGRKNIAWDLRPDVNILSGVNGIGKSTILNNSVRRLSDLEGGALSNGIHLGVSFTFYPEDATYIHFDVIRSFDRPLLSSGLLEKIGNQNVKTELDWQLYLLQRRYLDYQVNIGNRIIELLTSGKPENQSKAAEISLPKTFQNLVDDLFSETGKKILRQSNEIQFEQDGDILTPYQLSSGEKQMLVIL--LTVLVQDNQPCTLFMDEPEISLHVEWQQRLISLIRSLNPNVQIILTTHSPALI 257
212 5.000e-21gi|425743179|ref|ZP_18861270.1| AAA ATPase domain protein [Acinetobacter baumannii WC-487]  clstr ali  21  3LTGFQVENFRSIDKSEWIDVE--DVTALIGTNESGKTNLLCALWKLNPASKDGDINLLTDYDGVYLISFPDEKSPTLKADIFQKFIDEKIKYIQELQLLKSENEEKRDNFSDVFNQLKELFESSVINKALIDKASLILSNLRDEKEPKTSELTKTLNETETFLKDHSTEIDRPSDDELTDSRRYIVNNLPTFVYYSNYGNLDSEIYLPHVIENMSRTDLGAKESAKVKTLKVLFDYVKLEPQDILDLGRSDSDDELSEEEIELKSKEKKERSILLQSASTELTAKFRDWWKQGEYRFRFEADGNHFRIWVSDDKEDIELEGRSTGLQWFLSFYLTFLVESKDHKDSILLLDEPGLSLHPLAQKDLSLFFRNLSQTNLILYTTHSPFLV 443
213 5.000e-21METAHIT MH0084 GL0068941 [Complete] locus=scaffold16875_3:418:1962:+  ali  12  3IKSVIIENFRGYQ--TRQTIAFDQLTAFVGKNDVGKSTILEALDIFFNDGAGP---ISLDVRDVNVDAKNAANGANVDVIIGVEFSEVPDYVVLDDNNQTSLADEYLLNSEDSLTIIKHYPNAGKPKVFIYANHPSHPDCCALLHKKQTELRKLTIDIDCDHNK--------------NAEMRKALRQQHVNELNLQMQEIDVSKEDAKNIWEKL-RNYLPVYCLFQSDRSNGDKDKEVQDPLKEAIKIIFSKQEIKEKCKEIYSAVINELEDVSSRTLNKLNEMNSHLASTLHPSSDALKWIDVFKNVSITGDNDIPINKRGSGVKRMILLNFFRAEAERSQPGIIYAIEEPETAQHIVHQQIMVKSLKELASHTQVVITTHSSVIL 380
214 5.000e-21Oral.Meta HOMD sves_c_9_47 Streptococcus vestibularis F0396 [20268 - 22103] lantibiotic protection ABC superfamily ATP binding cassettestransporter :  ali  15  14LKQIKINNFRGYKDETIVDF--DNLTAFIGKNDVGKSTILEALEIFFNNKMVVCEKDDLSVGV-----------DSDSIFITCIFDELPDEIVVDTSSKTSLKDENLLNSNGDLEIKKTFKCSSAKPKPETKIICNHP----------IDDNYNDLLLLKQVDLKKRAVDLGIDENKYDKRSNVSIRQAILSSKRDLTIKEIELEVTKEDAKKVYGVIETFLPIYALFQSDRSSSDSDKEIADPMSVAVSQALQELQTEINKIKSEVQKKAIETAGRTLAKLQEMDEDLAASLVPEFKSEPKFDSLFKLSIKSDDDISINKRGSGVRRLILLNFFRAEEVERNKSIIYAFEEPETSQHPSHQKLLIEAFLELSENTQIILTTHTPAL. 385
215 6.000e-21gi|255283559|ref|ZP_05348114.1| conserved hypothetical protein [Bryantella formatexigens DSM 14469]  clstr ali  19  4LTKVRIHQYKSIENALDMDVE-SDITVLMGKNEAGKTNILEALAKYFDREDKKFCYDPLPDYPRRRKKIEQIQKEMLLEAKSSQFSRITDYRGRHQVVESGFDYDLYEFWETYVSRKEPCLERYRRLLASIRTKEAFQEFYKQEAPSCSMEEKNALRNIEKFFRNPHRWANPLNEYVYRTYLLPNLPKFMYYDECYMLPSRISLDRLQNEEELTPQERTAKAFLMLADIDVDQVGGCFENYKSELETAQGRLNEELLKYWSANRNLRIEFEIVREELPEAQPEKKRRFFLFGKKEKAEPRYNWLEIRIRDVQSMISLPLENRSKGFNWFFSFWVWFKAIREYEEPYILLLDEPGMHLHATAQRDLVDFMKDLSAKYQIVYTTHSPYML 418
216 6.000e-21gi|422667473|ref|ZP_16727336.1| SMC domain-containing protein [Pseudomonas syringae pv. aptata str. DSM 50252]  clstr ali  13  19........FKNLKNVTIDFDQDHWVTVVIGWNGTGKSNVLEALAIIFRDLIGKERMPAFAFKDPDRENEPLIIHVATDAEARGEGTLTPFIEGEEAASALRGKAIKLTAFLKADAESLPRYVFSYYSGESTRMYEVFSPYLESYDSKLRNGIDPGLKRLFYAMPVHSQFVLLAFMIQQSDVVRAFLDDHLGIDPD--DGIESVLFVLRQPPWKSKAPDGDPRFWNARGVVRDFLSRLHDIALAPIEISRQVSTSIWNKTKLQFKYLYVKDIAALRRLVGNQAPAQF--FRDLESTYVSELIEEVRIRIRLKKNDGSVTFRELSEGEQQLLTVLGLL--RFTAEDESLFLLDEPDTHLNPRWSVDYISYLKQFIANSHILLTTHNP... 414
217 6.000e-21METAHIT MH0042 GL0032619 [Complete] locus=scaffold115889_1:49:1950:+  ali  17  5LKKVTIHKYKSFLTEQSYTVE-DHITRIVGKNESGKTALLEALAKSNYFEDNVDFQFDKDLDYPRSELIKAKSKNPAVLTCEYELSDEDVESVEDEYGEGIISKTFSLTSYYDNTRTTTGVAANFNVFKNWLITSFDVGDQGKELLRDAASFSALEDVVSENETTPGMKEIQTELNKIKKGAGKWKNPLEGYIYLTYISPAVPKLWYFSDYFNLPCRINLNEFSAGKPTGSLSSEEFKIAKALFELSGLQLSDIQSETNFEAFKAQLEATSNSITDDMFEYWTTNQNLEIRFDIEHADNNARYLNIRIYNSKHRVTLPLKNRSKGFLWFFSFLVWFSKIQNADNKYILLLDEPGLSLHASAQSDLLRFIEKLAPEYQVIYTTHSPFMI 394
218 6.000e-21gi|326385633|ref|ZP_08207267.1| SMC protein-like protein [Novosphingobium nitrogenifigens DSM 19370]  clstr ali  14  3LKKITIENVRSFLDRREM-VFDGPISIIIGPNGGGKTNLLDVVNTMLR-RYLFATRYFTQKYDAEQKVQWELRHNDQLNNMRLEKHSDARSLPQHVSIEVEVSQGDLDNMAQIQRDADELRKASKRRFVHNPWEGVGAWKIENILPETRLVYEWKNGAFQPAQTEEAQHFLSYLQIFELDNDVRAEVGKDALKLSMVYLPVNRSASGFQGSIGLANYNDYDQKRSLDAVTSRNGGNIISLAIGRLAKKYRQLQEDDNTSAK---------KKFYADKNLDELSKALKEIGYEWEL-TCTDPMNNTYDITLRKQGTSFLVSAASSGEKELLTYLFAIYALNVRD--ALIIVDEPELHLHPRWQKTLFRLFERLADKNQFVLATHSPTFI 378
219 6.000e-21METAHIT MH0055 GL0096260 [Complete] locus=scaffold8667_1:4373:5797:-  ali  14  3LKKLHISNFRCFCDYTI--EFAPSVTVLFGKNGSGKSTLMHAIHKALSFAFKNDKVEEGEITLASGFSSLKPNQYKKKDDIVRDEKSGFPLPDINIHAEADFLNANLQWDMYA-----------------LTSTFTLQPSKYKTAYQLLMSRIKETGTFPVFAYFSDSFPHISTKASTLSKTQLSLRNLGYLGWDDETAYSDLWITRLTKIWTIWNRAKMNVMQEESALANCEKFKASGIINENEYNEDVDLHRARLENALK----DFNKYNPEISSIRECLVKFSKKLSGIDVLDFFVSVYEEDGLCLETKDGKNPAFEKLPAGYKRIFYMALDIAYRSYIDSEGIVVIDEIDLHLHPALEQVILQCFQETFPNIQFIVSTHSPLVL 372
220 6.000e-21gi|307726822|ref|YP_003910035.1| ATP-dependent OLD family endonuclease [Burkholderia sp. CCGE1003]  clstr ali  19  3IQSVRIRNFRALRD---VTIPFDSVTTFIGPNGAGKSTVLRALDWYFNGKPSSLTEKDCCFGETGE-EVEVQVTFSDLTDKDRDALGKYAP---AGAQTFTAWKRWATNGSEALSANAKGFPEFNAIKSASGAVAK--RELYGNLRSNRPDLNLPAANTGTAVDQAMTTWESSHTDLLVDA---------PEALQTNFFGFNSGGKMSGLFDFVLVTADL-RASEESVDGRSSIIGRILERSVDRTAADEEIEKIVEESRAKQQSVYKEKFKAQLDSLTAQLNQVVTSYTTVTPAAVELKAPRTVFEVAVLDGKTETAVERQGHGFQRTLALQLLAQSGAASAQGVICLIEEPELYQHPTAQAKVLRSLEETSKRVQVTYATHSPYFL 384
221 6.000e-21gi|395782512|ref|ZP_10462899.1| hypothetical protein MCY_01173 [Bartonella rattimassiliensis 15908]  clstr ali  24  4.TSFELENFKGIGEPVKIDLSGGDRSILVGNNESGKTTTLQGIHLLSQEDFSSIRPKTAFFDEDIVLSTTILLDETEIEXXXXXXXXXXXXDDLSEKSQLSFVYSFDNSICTEKYIKINDKNYGDEIATFLNYLKNHIPEIVYYDDFMF----DVPDKIRFLKSATHASNEELKEDSFLSDKK--------------------------------------NLLWHDIFNDLLIGSRKKRAGKEPKSDI-------NFQRDIVDCSDEDAVDQRLSSINDYLNTVITKDWEDDRFSVE-KVTGSNPNFAVKAKDRTFSLHERSKGCRWFFCFKVLTDIRTNRSKNIIFLLDEPASNLHIHPQEKILQSLQKLSDKNSVIYSTHSPYLI 372
222 7.000e-21gi|374585653|ref|ZP_09658745.1| hypothetical protein Lepil_1825 [Leptonema illini DSM 21528]  clstr ali  14  3IKSARIKNYRLLKNLTLTFDE--RTTVIVGRNNSGKTSLAEIFRSFLGPSGPKLRYEDFTQTCLCGFENGLAAFKEEKSEAEIRKLIPTIELELLLDYTNDKDEYGVLGEFIIDLDETLFE------TKVLVAYQLKDGKIKDFFQPLSVENRRKYFSDLKALINQHFEAVIYAIEPTNSENRVRLDFSKFKKLIL-SGLINAQRGLDDETHSERDVLGKSLGKIFNSANSSGATAEFKEKSEEVRRVAEELQEKVDTDFQEKVKALLPAL-----SIFGYPGLQDPNLNAVTELNVKSLLESNTKVFYQGEDYFTLPETYNGLGIRNLIFILFRIYEYTTPPKGHLIFIEEPEAHLHPQMQEVFIRQLDQIVQEVQFVVSTHSSHI. 394
223 7.000e-21gi|428679541|gb|AFZ58307.1| SMC domain protein [Anabaena cylindrica PCC 7122]  clstr ali  16  4.KQLKMQSFRGIGDLTLDFDEKEP-TVLVGINGVGKSSILDCLAILLSQMMMRIISPEIGGFGIPFPFIPS----------------------------THIGPRENARAIPGNPDIKLRSFGEQDIKNGSNETYQEIGILLESKLLNWSIKKNKISGSEDSKYKQLNTFTENLYLKWVENPRFNLPLAVYYSVKRSVVDIDLEIIDISSFKQIDAYDQALNGIKISFERFFQWFRSIE------------------DLESEMLRDNRDYKDKQLEAVKRAISLLIPEFYNLRV------RRYPTLRMTLQKNGEELIINQLSDGEKCLLAMVGDLARRLAIANPGLVLIDEIELHLHPKWQRMIIPSLTRTFPNCQFIVTTHSPQVI 346
224 7.000e-21METAHIT O2 GL0094509 [Complete] locus=scaffold1310_2:1922:2794:+  ali  14  9............................................................................................................................DKYRQKANSMKYSEYIKQIEIDSLWSGRRHIVWNLDRKVNILSGINGVGKSTILNKVIRGLSAGGEFPSHMLKGVRLTVEPEDARWIRYDVIRSFDRPLLNLDAVGKLNTDLTTELDLQIFFLQRKYLDYQVNIGNRIIASLQSGEADAALQQQISAPKTTFQNLIDDLFSQTGKKIVRTENEIRFSQIGETLTPYQLSSGEKQMLVIL--LTVLVEDQQPYVLFMDEPEVSLHIDWQQRLIDLILTLNPNVQIILTTHSPAVI 274
225 8.000e-21gi|29349460|ref|NP_812963.1| ABC transporter ATP-binding protein [Bacteroides thetaiotaomicron VPI-5482]  clstr ali  13  1..................................................................................................................................MEQQADYIRRIEIKGLWARFNIQWDLRPDVNILSGINGVGKTTILNRSVGYLEQLSGDIQLSGEMKSDAKNGVHLFFDNPAATYIPYDVIRSYDRPLIMDKNVKSELDWQLYLLQRRYLDYQVNIGNKMIEMLSSNDEEQRSKA--ATLSLAKRRFQDMIDELFSYTRKKIDRRRNDIAFYQDGELLFPYKLSSGEKQMLVIL--LTVLVQDNSHCVLFMDEPEASLHIEWQQKLISMIRELNPNVQIILTTHSPAVI 262
226 8.000e-21METAHIT MH0042 GL0047366 [Lack 3`-end] locus=scaffold115896_1:3:1499:-  ali  18  3LKKVSIHKYKSFLTEQSYEVEPQ-ITRIVGKNESGKTALLEALAKSNYFQANTEFRFNKDLDYPR-----SELIKVRNENPPALTCEYELSDEDISRVETAFAKGIIPRKNFCVTSFYDNTSKASGVEIDFTVFKDWLISFFGVGDQGKQLIRAADSF--SSLESVVSENAELPAMEQIQAQLGEIKTGAGDFEDRLEGYIYNTYLSPEIPKLWYFSDYFSLPCRINLDDFSAGQPTNNLSREEVKIANALFELSGLRVSDIQNESNFEAFKAQLEATSNSITDDMFEYWQNLEIRFEIEHRYLNIRIYNSKHRVTLPLKNRSKGFLWFFSFLVWFSKIQGDKKKYILLLDEPGLSLHASAQNDLLRFIEKLAPEYQVIYTTHSPFMI 392
227 8.000e-21gi|114766703|ref|ZP_01445642.1| ATP-dependent endonuclease of the OLD family-like protein [Pelagibaca bermudensis HTCC2601]  clstr ali  18  18..................................................................................ENYPRRFLADYEEKHEGEDAQVVETTWRLEASDIALLVEEFGNDVVNGNEVTIQKSYNQTATTWIVPINQKALLEKLIIRYDLTEAEAVSLKDCSSTSAAAYRLSKINERSNSQQELLDSLHKYRDQNAAKKLLKSGLPKFLYFSHYDRMAGEISINRLAHDKQNFLDFLEYAGTTLDELTGATKFEEMNAKCEAAANRITDQIFEYWTQNDLEIEVRLDEGKKRVKNNLHRVTVPFSERSAGFIWFFSFLVKFAQIKKHQGDVIVLLDEPGLTLHGTAQKDLLRYFKELEPKHQIIFSTHSPFMV 351
228 9.000e-21gi|296100985|ref|YP_003611131.1| ATP-dependent OLD family endonuclease [Enterobacter cloacae subsp. cloacae ATCC 13047]  clstr ali  17  3LERIEIQNFRGIG---TASINLENFTTLIGSNNIGKSTVLKAIKILVDTTNPTTEDWPFRQASDGELIIAYFIDIQDWERTKPAISNLILNDKLAIRVRATWDEDNNCISLPIYEAY-----CRREIIEGFTNKITEARRVPYLLEIIERLDVNSSEAYKANLQQVIEIIRTEYPDKVTTEEGWSSENINFKNSLQQALPHILYIPACFKIEDDLKSQKGTPFGHLFSNRIFPALQADSSFSGYLDSANYMQRKMKGEIDGETIEGLMELMDSISESLNKVM--DISSKVKLSVGEIDINSVFMKAAGLVIEDRLETQLEYQGSGVQRALAYALLIFEVSESRRSTIILYEEPELYIHPHLMRLLRDTLRSKSSGSQVIVSTHSPFLI 387
229 9.000e-21gi|422775091|ref|ZP_16828747.1| hypothetical protein EREG_01069 [Escherichia coli H120]  clstr ali  16  3LVRIDIQNFRGI---SSASINLENFTTLIGSNNIGKSTILKAIKILVDTTNPTSEDWPFRTPSNEEMIITGVFSDIDCEQNKPAISNLIHEGKLSIRVRAKWDHDNGCIGLPCYEAFYCKED-----IEDYTTSITAARNIPWLLNIINELNCNNAKSYKEMQSDIIGLIKQRHPEKVSSNLCWTSEGINFKNSLQQALPHVLYIPACFKIEDDLKSQKGTPFGFLFSNRVYPVLQSDPSFTQYTASLDLLHKKMKGEVDGEVIEGLHELMESITESLNQVM--DLKSKVKLSLTEIDINSALMKAATLVIEDKLETQLEYQGSGVQRALAYALLLFEVNTSQRSTIILYEEPELYIHPHLMRLLRDKLREKSTNCQVIVSTHSPFLI 387
230 1.000e-20gi|357014070|ref|ZP_09079069.1| hypothetical protein PelgB_31746 [Paenibacillus elgii B69]  clstr ali  11  4..................EVLFSDATFLIGENNVGKSSILSALNLLLND-----VKKISDEEFYSYMDGDMMRRGADKVVLTAEFRRVPEEAKQWMGFKGRVLKYINDDGNTELRVIYRKTFTPGSDCIVELRQQIKTVKTQFSECSTINQYIEAGLDLTSVEMKTSKIDRDKKLTKPERAIIEEVDELYDYDEEAEEWFKNPGGIPANVLSRLPKFLLIPAQDKAEELSGNTLVSTLVELFNDVRDSSENYKQAQQYLNQLAEELNPANAQSEFGQMMTELNLVMKDVFPNTGLKSDADKVIKPQFTISMFSNITTSVNLQGTGIIRSAVFALLRYRNLRNNRKTIIGFEEPEIYLHPNAAKQMRDTIYDLANNNQIVCTTHSPYMI 385
231 1.000e-20gi|400286766|ref|ZP_10788798.1| SMC domain-containing protein [Psychrobacter sp. PAMC 21119]  clstr ali  12  3ISKFFIRNFRNFESAELNFSE--GVNTIIGENGSGKTNLFYALRLMLDDTLPRYLKLTENDFSRQLSDWRGHWIILTLNFEALGFDDATQALSIHACGDVSSSNEINQTQGSYTLCFRPKRHIRQELYDYSKETNKNKDELQVLLDKITIDEYETVYLCKGSAQCSEDDFYDQYVGNFEGIIFPDPSQAETQVYGVYLPELNLYDEISCTFIKALRDVNSDLRSYSKNPLVSLLRGKEKTVEISIQSDLVNSINEINESISTLEEVSNVQKGIDSSLKQAVGTTYAPNIEVRAELPNEMDKLLQSLRLWVGDSDDEHRLSELSLGGANLIFLSLKLYEYEKIKTDNLLLIEEPEAHIHTHIQKTLFDNLSRHEHKPQIFISTHSTQ.. 392
232 1.000e-20gi|157375862|ref|YP_001474462.1| ATP-dependent OLD family endonuclease [Shewanella sediminis HAW-EB3]  clstr ali  14  3LKKLIINNFRGIG---FAEIDLENFTTLVGPNNIGKSTILNAIHLVLDNKKPKLEDWPAQQASEEVMDIICEFGDLE------DWEKRKSAISTLLHEDYLKVKMSACWNAEQTDYSYEYSVYCVETQYPWSELNFTKAKADEVCKPIFKELGITKAAEFNERQVELESYIAENLPELVSSVKDWHVKKFANSLQQAVPHVMYVPASFKIEDELKATNNSP----FSFLFTNKLFPKVKGDESYSAYIEKATELQDKLKGKAEDGSEIEGLGDALGEVSKTLNQILDFDSKVKLAVGDIDVEPLFMKTFLIDDEIETSLQYQGSGVQRALAFAMLEANAEVDQRTVVVLYEEPELYIHPHLMRRLKNTLRSESPKWQVICSTHSPFLI 387
233 1.000e-20gi|312966699|ref|ZP_07780918.1| recF/RecN/SMC N terminal domain protein [Escherichia coli 2362-75]  clstr ali  15  66LRRLTLKDFRRFSLLEIKFEE--DLTVIIGNNGKGKTSILYAIAKTLSWFVANILKEGGSGQRLSEL---------------TDIKNDAENRYADVSSTFFFGKGLKSVPIRLSRSALGTAERRDSEVKPARDLADIWRVINEAKTINLPTFALYNVERSQPFNRNTKDNAGRREERFDAYSQALGGAGRFDHFVEWYIYLHKRTISDISSSIKELEQQVNDLQRSVDGGMVSVKSLLEQMKLKLSEASERNDAAVSS-----KMVTESVQKSIVEKSICSVVPSISKIWVEMTTGSDL--------VKVTNDGHDVTIDQLSDGQRVFLSLVADLARRMVMLNPGIVLIDEIELHLHPKWQQEVILNLRSVFPNIQFIITTHSPIVL 432
234 1.000e-20gi|157962905|ref|YP_001502939.1| ATP-dependent OLD family endonuclease [Shewanella pealeana ATCC 700345]  clstr ali  14  3INKVEIENFRGI---TEAVIDLNNFTTLVGPNNIGKSTILAALNLVLDNKKPKADDWPSQKQTDDVMSITCTFSEEEWERNKPAISQLLNGDQLVLKMEATWAEDTDAPSCKYLVHHAPTTTPFTGKNISQARADEQLNAILVELEVTSAAIYKERKSEIDQY---------MVDNHPETIIRELDWHEKTFANSLQQAIPHVMYVPASFKIEDELKTTGTSPFAYLFKNKLFPKVKSDESYTLYIEKAQKLQEKLKGQAEDGTEIDGLSTALEAVSTTLNDILDFDTKVKLAVGDIDIEPLFMKAATFLIDEELETSLQYQGSGVQRALAFAMLESNAATEQRTTIVLYEEPELYIHPHLMRRLRDTLQTRSGSWQVICSTHSPFLI 387
235 1.000e-20METAHIT MH0052 GL0047960 [Complete] locus=C2596899_1:42:1844:+  ali  14  3LRKIKIQNFRKLNDVE---INLGDATFLIGANNAGKSSTLDVIEYLVTD------KKLDNSCRSRYLEDGEELTKTEEDVIIEGYFDNVDATIVNQRGFNSSRLNSYQDENGNEKYSFNYRVRLTADGKNHREIQMHQQKLKEEFVVCKKWQDFIDRGVDADVFSDIGDLNHTLSAKERKDLEDNYPMLFEVEESNGWFENPIPGNVLSKLPRFLKIKADVLEEEMETSKTGTLHDLLTYMFDDVRKGSDHYKKAVEELQELSREMDPTDEHGAFGQLMRDLNKTVDDVFPKATINIDTDLTKKPIFGVTISSNVTTDVSHQGTGLIRSAVFALLRFDKQRREQNSIIGFEEPELFLHPNAAENMRRVIYELASNSQIIATTHSPYMI 395
236 1.000e-20METAHIT MH0030 GL0006179 [Complete] locus=scaffold11615_2:703:2127:+  ali  14  3LNELHIQNFRCFNDYRITF--APGLTVLFGKNGTGKTTLIHAIHKALSFAFKRD-------------------KEEKALNLGAGFPDLKPRDYSKTEDLTRDPKTGMPFPFVNIHAYATFEGVSLDWSMYASTSTFKVQPSKFGEASLRLKNRIKETDQLPMFAYFSDGFPHVTKETKLSEKEMSLRNLGYLGWDEETAYSDIWINRLTKIWTLWDRANRTVDGEKKALENCENAKAQGIVNEEEYNEDIKLHKSRL----ENAEREKSRYDNEVQAIRNCLIKFSQGDKNIEVTDFFVSVYEESGLCLQTRDGSNPSFIKLPAGYKRLFFMVLDIAYRSLLLSNGIVVIDEIDLHLHPELEQSVLARFRKTFPRVQFIISTHSPLVL 372
237 1.000e-20gi|375258694|ref|YP_005017864.1| SMC domain-containing protein [Klebsiella oxytoca KCTC 1686]  clstr ali  11  3IDWLWIGEYKNLKNLTIDFAQGHLITVLIGRNGTGKSNVLEAATVLFRDLIMGEDGKGNKNKPSFAYRICYQIKDKYRIKLAPYDPDAEPPSAVITFEETPGEAMALSKLRDPDDGYLPRFVFGYYSGQSERMEKVFLKYLERYDRDLRAGKNPGLKRLFYALPVHSNFVLLSFIVNNAELTDKFLQEQLGLEEGGIESVLFVLRQ-----PSWTSNDGDPRFWNARGVVSDFLATLYDISLAPLRITRKEKVSLWNWRKLEFLYLFVKDLGALRKLAGGKSTAQF--FQDLESTYVSELIDEVRIRIKLRKNDGSVTFRELSEGEQQLLTVLGLL--RFTAEEESLFLLDEPDTHLNPRWSVEYLQHIRNFLNSSHVLLATHNP... 398
238 1.000e-20gi|403744933|ref|ZP_10953984.1| DNA replication and repair protein RecF [Alicyclobacillus hesperidum URH17-3-68]  clstr ali  15  3ISKVRIQNFRCFKDCTIEF--NDGLNVLIGSNNAGKTTVIKALELVFKRGTTK----------------------------SNSVDDFYKGVDLSTPPEVNITATLRSSKTDTVDDKAIVASWLTKLESPWEAELTYRFFLPEQYHASYLEEYDKTSNQKERWRLVERTLKRYVSRIYGGNIVNNIRAEADYLDKIHCETLDALRDVESKLSTGKNSLLRQLLEYFKDNHTESTDTNTGNDD-----------DFAEHSEILVRNLIGRVNQKEILDFAEKTGASVGGVPTLDGSLEESDVLSTLRLIVKDQTGIEIPIVNNGMGYNNLIYISMILSKFTVITSNDILLIEEPEAHLHPALQYNFLKFLKEQNVSRQIFITTHSTQI. 361
239 1.000e-20gi|398844747|ref|ZP_10601803.1| hypothetical protein PMI38_01155 [Pseudomonas sp. GM84]  clstr ali  22  33.............................................................................................................................................SKSLYELAPALITWLDTVYTKVDEKNADEESKDECDYALQYAKFMEYLDANKPTFVLYSNYFRVKPLLHLANLAERIRTNVLQDAYDYGNICLLNLLGFSAKELSDLGRAEEPASNTTELDKYREKLDRRAYQLNSASVELTQQIVKVWNQEVSKLRISADGQYLKVVVEDSGVEVELDQRSEGFQWLVSFFIVFFSEAKKHANTVLLLDEPGVSLHALKQREFRRTISQLAEDNQTIYSTHSPFMV 292
240 2.000e-20METAHIT MH0006 GL0219235 [Complete] locus=scaffold28_3:5667:6482:+  ali  12  3......................................................................................................................................NKGNYIKRIQIDALWSRRRGIDWTLRPDVNILSGVNGVGKSTILNRVVRQLI-GIDRLEKQMDGVILTFSPEDADTVDFDVIRSFDRPLVSSDLLGKVADSHLQSELDLQLYQLQRNYLDYQVNMSNRMVAIFTSQVPDAQKLASEVAQEKFMDLVDSLFKDTGKTICRDHNEIFFRSMGEEIPSYKLSSGEKQMLIIL--LSVLVQNRKPCVLFMDEPEVSLHIEWQQRLVGLVRDLNPNVQIILTTHSPAVI 255
241 2.000e-20gi|384410898|ref|YP_005527910.1| SMC domain-containing protein [Zymomonas mobilis subsp. mobilis ATCC 10988]  clstr ali  18  11.KKISIKNFRGIQNA--DFDFCNKVNLIVGINGAGKTSVLDSIALLLSWLINRTLNKNSSGQPINDLSIRNGCRE---------------------------AALSITVNYDNQDFNWMLVKTGRGLNARSQKSELSLLAALSKRFQIELDNKNDEASLPLFVYYPVDRAIVKVPIRRRRRQAFSQLSAYDEALNPNVNFKS----------------------FFEWFRFEQEKHNSSLANLLHSMDLSDTDSLLFKATKYRKTIKEILKELYNPLSSKGLKAVCQAIYEFMPGFSDLRVLYEPLRMVIEKEGVHLNLLQLSGGEKCMLALIGDIARRLVLANPSIILIDEIDLHLHPRWQKNIIERLNSTFPNCQFIITTHSPHII 355
242 2.000e-20METAHIT MH0057 GL0002443 [Complete] locus=scaffold122_2:56:1885:-  ali  15  1..................................................................................................................................MKKQADYIKRIEIKGLWGRKNISWNLRADVNILSGVNGIGKSTILNKSVLSLNALEGGALTNGVQPGVSFIFSPEDATYIHFDVIRSFDRPLISAGWLEKIGNQNVKSELDWQLYHLQRRYLDYQVNIGNRIIELLTSGVIEDQARAAQSRPKTEFQDMIDDLFSETGKKIIRKSNEIQFEQDGDVLTPYQLSSGEKQMLVIL--LTVLVQDNQPFALFMDEPEISLHVEWQERLVLLIPSLNPNVQIILTTHSPAVI 257
243 2.000e-20METAHIT MH0055 GL0049872 [Complete] locus=scaffold24143_8:959:1780:+  ali  14  3......................................................................................................................................KYADYIEKIEIDSLWSGRRHVVWELDRKVNILSGINGVGKSTILNKVAKSVGPGGDIASHLVKGVHISVCPADATHIRYDIIRSFDRPLLNADILGEVGANLVTELDWQLFKLQRKYLDYQVNIGNRIISVLQSATDAAAKAQAISEPKKKFQDMIDDLFSDTGKKIIRTENEIRFSQIGETLYPYQLSSGEKQMLAIL--LTVLIEDNQPYVLFMDEPEVSLHVEWQKRLIDLILDLNENVQIILTTHSPAVV 255
244 2.000e-20gi|392553490|ref|ZP_10300627.1| hypothetical protein PspoU_19656 [Pseudoalteromonas spongiae UST010723-006]  clstr ali  17  4LKQAKINRYKSYGNEQIVQIE-DDVTTVVGKNESGKTAFLEALAKLNYFTNDNDFEFDEVKDYPRNELKKYQRAGEQCEPIICKFQMDKNTIDEINEDLGNGVLTTDYFTVSSRYGSGRTWYHINCNEKKYIDNLQNELSVSSETKDILKNLKTILESNNEELQDFVAHIKNNIVNKAYDWKRKLIDAYVFKRYIAPRLPRFWYFDEYHSLPSRVNINSVRNETTSEELTKQQLDTAKALFELAMIDVEELINSSSESFIAELESTSNEITDQIFEYWSTNNNLEIEFKIESIHHPHQSPEKILDIRVKNRRHRITLPLKNRSKGFNWFFSFIVWFSKIQDDKNNNILLLDEPGLNLHASAQADLLRFINDLSDKYQVIYTTHSPFMV 398
245 2.000e-20gi|336236749|ref|YP_004589365.1| SMC domain-containing protein [Geobacillus thermoglucosidasius C56-YS93]  clstr ali  14  3ISKLYIKNFKCFSEFEIEFNE--GLNVIIGSNNSGKTTIIKAIEYIFNRSVSKTPSIDDFNKELDDLDNPP------------EIIISATLRSSHNDTLEDKAIVASWLTKLESPWEATLTYKYFLPESNWKEYKGAIKEAQNDKERWEILENFLKKYVSRIYGGKIENKIRAETEYLEKIHCETLDALRDVESKMFTGRNPLLKQLLTHFKDNEPNNEKSSDSLISSKQEFQKYSNKVVENIVSRLNRKEILRFAQNTGAAIGGEPDIDGRLEEADVLSILRLIIR--------------NETGIEIPIINNGLGYNNLIYMSLILAKFKMITSKEYGENAKTFPILLIEEPEAHLHPALQYNFLKFLKEEIDKRQIFITTHSTQI. 365
246 2.000e-20gi|317046280|ref|YP_004113928.1| SMC domain-containing protein [Pantoea sp. At-9b]  clstr ali  15  67.STLELVNYKGIRKTVKKITFDPHLNIFVGVNGSGKTSIIESLVKASTWLVNGIRNRANGKG-----------------------IDLIEINKAEDSKDCAITTTLSLDEKSTFTLELYKNKNSKGKSRGSLSEFKNLAEMYYSHNSNSQGLACLPLFCHYSVSRALEIKSDDQKNNSEIYAFSNLDGYNSSFEESKNFGQLLKWMLFCGAQNNGELDDIKNTLRSLEVKYNTTFDIYNFLAEETKENSQIAEKIRNELDSLRSEIKELQITLKTADSNIVTIVKEAIYKFMNIDNIRMKVDKTSVSILLDKNGITISATDLSQGEKALFSLVSDISRRLILLNPGVVIIDEIDLHLHPKWQQEIVGNLRDTFPNVQFILTTHSPQVL 440
247 2.000e-20gi|94313563|ref|YP_586772.1| ATP-dependent endonuclease of the OLD family [Cupriavidus metallidurans CH34]  clstr ali  20  3IQTVRIRNFRTLKD---VTIPFDSVTTFIGPNGAGKSTVLRALDWFFNGKP---------GSLTEE-DCSFGATDEDIEVQITFADLTEKDREALGKYAPEGVGTFTAWKRRSPDGADVLSANAKGFPDF-------NGIKAAGGATAKRELYASLRRDRPELDLPAANTGPAVEQSMTTWEAAHTDQLLDEALQTNFFGFNSGGKMSGLFDFVLVTADL-RASEESIDGKASIIGRILERSIDRTAADEAIAEIVAESRAKQQQVYEEKFKEQLGAITTQLNEVVTTYITVSPAEVELKAPRTTFDVAVLDGTTETAVERQGHGFQRTLALQLLAQSGAASAEGIICLIEEPELFQHPQAQAKVLRSLEDASKRIQVTYATHSPYFL 384
248 2.000e-20gi|168209004|ref|ZP_02634629.1| conserved hypothetical protein [Clostridium perfringens B str. ATCC 3626]  clstr ali  21  3IVGIRVKNYKSFLDSGKIPVDK-KLFSLIGQNNTGKSAIMDAVQCVFPSSKKSVSVLDFHKGTDDEISIE-------------------------------------IWFDGVNETYLEEKIYGDKILKQLEKVRNIQAGLGEN---PTQSKIKKLDAEKEKIEKIRSENYDAYTAKYNIKDEKFYVRLVSKKGKNVYKKFYIDNEI--EITEGDLKALLPQLKVIPAIRDPKLKELIQMLDDEIQTSIK--IEGNNITYKELNKVIAEETKARCKSIGESVTQFYNQAIGTEEYIVIIDSDGTTYTTKIRDINTGIESDYQSMIILSILETYVKI---SQKNSDYILLIEEPEVYLHPKLQRKMIDTLVTISNKNQIIFTSHSP... 361
249 3.000e-20METAHIT MH0017 GL0022001 [Complete] locus=C1493989_1:3940:5538:+  ali  13  3IKSVSISNFRSY--SKEVKIDFQDLTAIVGKNDIGKSTILEALYVFFHNG------KELIKLDKDDINISERSNGDQDIRISVVFDSLPQNVVIDESNKTTLKDEYLLNKEGDLEVVKVFKNASTTDKSIIVS----IKANHPTNPDCYDLLSKKQAELQKIVDQLGLSCEDKRKNASLRAAIWKHYEDEGALNLAESEIAVNAKDGDIKALWEKLQYYMPYYSLFQSDRKNTDGDDEIQDPLKIAVKQIFSDEELLKTLDDVAQKVRDKLQEVSDLTLTKIKEMNPDIANSLHPKVQELKWADVFKSLSITSDEDIPINKRGSGVKRLILLNFFRAEAERRQKEIIYAIEEPETSQHKDHQLLLIDALKNLSTKSQVIITTHSSDIV 388
250 3.000e-20gi|365972867|ref|YP_004954427.1| hypothetical protein EcWSU1_A032 [Enterobacter cloacae EcWSU1]  clstr ali  18  3LESFRVRNFRSVFDSGV--ITTEKLTAILGRNESGKTNLLLALKSLNPAEGFGKLNDIKDFPRNRKLSECWILTEQELTELNEIYPRVQNNTSVCRRYNGDLRYINFIGLNKFDYDAQKIKKEVRKIAAQTELFFDNQDNNTEECQADRQSIRDICNEQAKGKPLELRKYLIKYDIEMKSDSDDALDELEDSLEEIISDAARHKAARQWVLKNLPVFVMVDEYPELNGHEYTQRKQQSKQTNADINFEKLCKVAGIDPTELTANRNNSEVRNQLVNRAGAVVTTEIRRLWQDKPLKIRFNVDSDYFDTYVSDSNNEVNLDERSRGFKWFFSFYITFFADTKSAENAIILLDEPGLYLHAKSQADLLNHLTNDFEN-QIIYTTHSPFLV 422
251 3.000e-20METAHIT MH0046 GL0075139 [Complete] locus=scaffold83420_2:305:1135:+  ali  13  1..................................................................................................................................MEIQANYIRRIEISGLWHRYDIAWDLRPDVNILAGINGVGKTTILNRSVGYLEHHTMGQMKNSELAGARVFFDNPEATFIPYDVIRSYDRPLIMGDFTAHMADPNVHSELDWQLYLLQRRYLDYQVNVGNRMIELLNGDDEQRARAPQLSQPKRKFQDMVDELFAYTRKTIDRKSNDIAFYQDGERLLPYKLSSGEKQMLVIL--LTVLVREGTHSVLFMDDPEASLHIEWQQKLIGMIRRLNPDVQLILSTHSPAVI 256
252 3.000e-20METAHIT MH0052 GL0030725 [Complete] locus=scaffold1445_1:3093:5123:+  ali  19  3LIKARVQGYRSVIDSGWFDVESGK-TILVGPNEAGKTAILQALQKLNPPDGIELFDPLRDYPRAKYDEDHFFLEDNDKEKVPNAYRDAIYIFSEVEKDFLKMIAHFQDIAFKENVTQDLIDAIQTEYETAISGIDRSSIITVDQAKQLHSWLKRNIKYLDDNNSKENARYEKIESQIERPEVHAKVLASCKELLPKFILFSNYFRIKPVLHLRKLADRIASNSLDDSQYDYGNICLLKFLGFTPKELADTSAFNLNDPTQYERYKAQLDTRDYRLNAATIRLTQAICEVWNPDANKLRIKVDGQYLKVVVEDEGVEVELDQRSEGFQWMVSFYVVFFAEASDKKNAILLLDEPGQSLHALKQAEFRETLSKLSAKNQTIYTTHSPFLV 436
253 3.000e-20gi|239908256|ref|YP_002954997.1| hypothetical protein DMR_36200 [Desulfovibrio magneticus RS-1]  clstr ali  19  3LSKYKVNKFRSVKETE--WIEIDQLACFVGVNESGKTNLLLPLWKFNPADDATKIDLLLDYPRDEYFEVEANG------EIRKKEPFIEVLFKLNETELKSFSKKYEKYLAQSSGEDDQAEAGAEVAGRIVFTDYLLIKKNYNEDFYIYLSNDKGELLSEELEDVVGKDIFNVICEAMPRFVYYSEYGNLDSDLYLPRVIDDLGRIDALTGKERMKARTLKVLFGHLKLDPKEILDLGRETVPNNDPRQKAQPQI------EKESRNKQERFAKVTSAASRLTAQFKAWWTQGDYIFHFNADGEYFRILVSDIERPIELESRSKGLQWFFSFFLVFLSESEENKDCVLLLDEPGLSLHPNAQTDLIRFFERLADKNQLIYTTHLPFLV 379
254 3.000e-20METAHIT MH0022 GL0017630 [Complete] locus=C1744190_1:2462:3289:-  ali  13  3......................................................................................................................................KYADYIEQVEIESLWSGRRHVEWNLDRKVNVLSGINGVGKSTILNKLVKSVGITGDIYNHLLKGVHIKVNPADATYIRFDVIRSFDRPLLNADMLSEVGANLVTELDWQLFKLQRKFLDYQVNIGNRIIAALQSGEPDAALKQQLSEPKKKFQDLIDDLFSDTGKKIIRTENEIRFTQIGETLHPYQLSSGEKQMLVIL--LTVLIEDNLPYVLFMDEPEVSLHIEWQKRLIDLILDLNPNVQIILTTHSPAVI 255
255 3.000e-20gi|374383082|ref|ZP_09640659.1| ATP-dependent endonuclease of the OLD family [Desulfitobacterium dichloroeliminans LMG P-21439]  clstr ali  10  7ICKVHIENFRNFR---RAEFWLNEKQVVIGENAVGKSNLLYALQLILDPTLSDKDRMLEESDFWEGLDDPMTNGEQILIEL--WFANFEGNKNVLAQLTDATVMLDEKEALKLTYKFYPYRKVGETNEYSFIIFKGDDENRRFSYDDRKFLNIRVIKAIRDVESEMRNSKTSPLTQIIKQKYTISKDVLAEISHALEEKGADTLKIGQVEDLESRIQKLLNQMVSFSQDQFGVSLKTINIDATKLLYALRPLIDNRESGNTSLGINNLLYIALILLLIEDETIKTYKELYEELIEKDESDLIESCYSEVEEINGYALNDNVLTNCEKRDELYDFMSETIPTANGVTILAVEEPEAHLHPIYQRLLYRHVMNRSS-ASVIITTHSTHI. 389
256 3.000e-20METAHIT MH0050 GL0004276 [Lack 3`-end] locus=scaffold39057_2:108:1478:+  ali  11  12IKKLTVMKLHGLYDYTVRF--HDDLTFLYGENGCGKTTILNIISSIVTGELYSLSSYRFDTITLAYYDPSARRSHTLHIKSEANESLLRLNPQGKEERIPLLVVDPDYSENNSISSLRQKYMRSYEFPQLLRSTFSYLYLPLSRYFQGETGMGNTLSRYRYASYAEREFVGGNYLNDSLSVVRDLIRRSRLRISAKENDLDAEFRNAVLSSALKIASSSYDIKNLMESVADEESLKKIEQGREKYIEMLESIDEYDSTMQESIQNFFSEKKKEQVREPLFIFHSTINRFFRYNAGEKRVSINDGKLTVMDSQADRTVRLSQLSSGEKQLLIIFSFLLFGLSSDEHGIYIIDEPEASLHLAWQKIFVESIREAKPSLQLILATHSPEII 443
257 3.000e-20METAHIT MH0065 GL0048598 [Complete] locus=scaffold31986_4:178:2049:-  ali  13  3LHSLRIQGFRKHYDTTIVF---SDSTFLIGENNVGKSSILYALDYLLNNKQKVNPNEYFSCTTAEGENKRIVDEIILTAEFCDLPTEAKSWRGFKGRVIPSTENVDGQTGLS--FIYRKTLKMGSSAVKIETKEFKKEIKTNFQECKTVQDYLDNGLNEDSLTDEIKQVDKNKKLTAKEKKLFNSVDEIYEFDESEEVWVENPGGIPQNVLSKLPKYLLIPAQDKEDEITGSTLQKTLNELFSEIRESSENYKEAQKYLDKLSQELDPDDDSTEISKMIVELNNIVSEIFPGTGITTSANLSDADSVIKEMNSNISTPANLQGTGLIRSTVFALLRYKSLRDNRKNIIGFEEPEIYLHPNAINKMRDTIYNLAENNQIVCTTHSPYMI 401
258 4.000e-20gi|120601903|ref|YP_966303.1| SMC domain-containing protein [Desulfovibrio vulgaris DP4]  clstr ali  12  3LDWFWVEDFKNLKDVTIDFDESHWVTVVIGWNGTGKSNVLEALATLFRDNGSRKPTFKYKLVYKCQNNLIAIDADPDRAQNAYRISVRDLSEQLQPTLLTSNSEDYFEPIFKQGKILPLAQFIKRQEEYLPRNVFGYYSYLEKYDKELRGGKDPGFKRLFFALPIHSQFVLLAFVLKHEQMVKDFLEKLLFLDPVDGIESVLFVLRKPGWA-NSKKKGGDERFWRAEGVVKEFLVRLYDIALAPIRITREKQITLWNKSRIEFIYLFVKDMDALRTLVGEREPRSL--FRDIESTFVSEMIEEIRIKIRLRDGKGKVTFRELSEGEQQLLTVLGLLCFTAEDQ--SLFLLDEPDTHLNPRWSADYLEYLKRFVEHSHILFTTHNP... 408
259 4.000e-20gi|160875630|ref|YP_001554946.1| ATP-dependent OLD family endonuclease [Shewanella baltica OS195]  clstr ali  16  4LKKIAISGFKGI--SGRVEIPAKDFNVIVGKNDAGKSTVLRALDLFINGRQYQAEYLNNTTDQFSVIELYFSPNNTPIVIDENTTTTFEAEGLVDSDGYLHLTKKWDGTKTGKISPEYFVERLSFGDLDFFSLTEAKLIKLCQDNGLEAEPGLMTNPDTGEEHN--------------NAEKRNRLREFFVERGDESSYIAEKLPTSGASRLKKTESAVKLCLPRFEYFLADTPLSESDSTIQKYFKDMAFQVIQDQVNTEELEETVRGHLQTVLSAITSKINAVVPESEQVQAKVEFDWSKLITTTFDSDNGNGSVPLSARGDGFRRITMMAYFEYLAEQKSQNIIFAFEEPETFLHPSAQENLFEKLNDISAGYQVFLTTHSPVIV 379
260 4.000e-20gi|77360038|ref|YP_339613.1| hypothetical protein PSHAa1095 [Pseudoalteromonas haloplanktis TAC125]  clstr ali  10  3LAKAFIRNFRRLEEVEVDFEKSE--TVFVGPNNSGKTSATSIFRCFLSSRDFKIHDFSIQRISEIDHYSPEGDITLPSIELDLWFDFDPENISFG--------RAFALLSSVSIETYEVGIRCKYAVDDISKLWAEYDTIFPIDDDGKRKRSLSHFLGLDGNFKNHFSVQYSSLSRLDNDEIEETILKLSDGKRILNSLVRADFVDAQRNMNDDEEASRSSKLSTAFASFYRNNLDQVDINDAAIQIIDENNEKLTEHYDEHFGSLMGVLNNLGVPAAHERRLKIISSISADVALRGSTD-----LIYIDAETAHELPEAYNGLGFKNLVLMLQWLQTLENRPLCHLIFIEEPEVHLHAQVQQTFIGNIWNILNNLQLVITTHSSHVL 391
261 4.000e-20gi|270340138|ref|ZP_06007165.2| conserved hypothetical protein [Prevotella bergensis DSM 17361]  clstr ali  13  4..............................................................................................................................NEKPDNMEIYADYIQQIEIDSLWGNRKHIIWNLDRQVNILSGVNGVGKSTIINRVTKALAEGKRLGDNVIQGIHVKCVPEDTTHIRYDIIRSFDRPLLNAKTLNQINLSLVTELDWQLFQLQRRYLDYQVNIGNRIIQ--VLQSGNSDAAQQLSEPKKKFQDIVDSLFADTGKKIIRTENEIRFSQIGEELVPYQLSSGEKQILAIL--LTVLVQDNQNYVLFMDEPEVSLHVEWQKQLIDLILDLNPNVQIILTTHSPAVI 261
262 4.000e-20gi|167760229|ref|ZP_02432356.1| hypothetical protein CLOSCI_02602 [Clostridium scindens ATCC 35704]  clstr ali  12  18LSKIKIKNYRLLIDAELEVD--SKTTLIVGRNNTAKTSCFECIGKVLDGTPFSFNDYPLSKRENLYANITSFMAKEIAFEELCERLEPISIEFLVDYSLDDPEDNLGALSPFIIDVDIDTTTALIRAEYKLKADEKGIWKILEPNYYENGNFSPADDVHNAIISNFHKLFEMTIYAINPQKPDEKQSKKQAELADLFPFHIIQAERCLGEDGTQDNSLSSLISDFFDMSEDELDPSVAEKVKE-----LRAIVENANKNVQQQSDSILSALVSSAVGFGYPNGEELQLGVTTQLSIDDQIKNQTQLSYTAGTSKERLPSTYNGLGYKNLIKMEFLLAAFAKKVEKCLLFIEEPESHMHPQMQHAFAEYLKITSVGIQTFLTSHSAHI. 408
263 4.000e-20gi|303245771|ref|ZP_07332054.1| SMC domain protein [Desulfovibrio fructosovorans JJ]  clstr ali  18  3IKRLEVKGFKSLKDVVW---EPGSLTILIGPNGSGKSNILLALSFLQNIASGNLDNFIQENGGITRV----------------------AWDGSVRFIKVQLQSFFEIFALPTDTYYSLELALRNDTYRILKEICSEEYYDNDEKTNKLNTLIYREAGVSKITGS---NGLSDIAVKIKNRLESFLSIATTPHQYDTSLYILKENIADTKIYRHLDTQSQANIR----------RPLITRFNKQIDSDGQNLVNVLHTLYSENRDFENDINTAMRAAFGDEFDRLVFPPAADQLVQLRIRWKSL---------KREQSMLDLSDGTIRFLFLMTVL---CNPEPPSLIAIDEPETGLHPSMFPIIAEYAAEASKRTQVIFSTHSPQFL 340
264 5.000e-20gi|421082860|ref|ZP_15543740.1| RecF/RecN/SMC N terminal domain, putative [Pectobacterium wasabiae CFBP 3304]  clstr ali  17  66...IHLENYKGFESLIMDFSMKKGSTILVGNNGCGKSTILDAIQKGLTHLSSRLSTRSHNGDGIEKHELKTGKNYASIAI-----------------------NYDFMGVRFPMIIAMTEPGYEDSAKSNYSGINELGNIFKTAHSINPNASFPLIAMYTVERANDVSTKDIENSDEIKEAQIWDKFKAYNKSLTGKADFKLFFRWFKELIEIENSDNAEIKALRAEIRAKEKDLDNPLLKALLAENKNSDTTKKLLEDHENSLKFLRSKLNNYYSINSKTLHTVEDAIYSFLPGFNNLKLQRAPLDLIVDKDNVSLSVLQLSQGEKTILALIADIARRLTLLNPNIILVDEIDLHLHPSWQQNIIPRLEKTFKNIQFIVTTHSPQV. 435
265 5.000e-20gi|325981036|ref|YP_004293438.1| hypothetical protein NAL212_0323 [Nitrosomonas sp. AL212]  clstr ali  15  3LISAHITNFRSIEDSNQFEI--SDLTCLVGKNEAGKTAILQALYGVKPFGNFEYDKIRDYPRRYLSRFDERHPDGISKVIETE-----------WELSEADIRLISDRFGQEALKSSEIKVSKYIGTDTSYWTITHDGKACLNHLIHKYSLDAVEQNSLRDAKNAKDAIAALSALSTLSDKHQKLLDELNGLSDHSFSSA--MIKILSPVMPKFFYTSHFDRMSGEISINKIQADIQQNSVSQADKIFLDFLEYAGTSIEELKGADRYEDLKAKCEGASNDITDEIFQFWSQNQALRVVIDIGEKIRIENTNHRVTVPLSERSAGFVWFFSFLSQFKQLKKITGNAIILLDEPGLTLHGKAQSDLLHYIEELLPEHQVIFSTHSPFMV 391
266 5.000e-20gi|333029853|ref|ZP_08457914.1| AAA ATPase [Bacteroides coprosuis DSM 18011]  clstr ali  16  1..................................................................................................................................MEEKAKYIKRIEIKNLWNRLTVKWDLRPDVNILAGINGVGKTTILNRVISFLEEHEGEKVTPTEDIEGVNVYFDSPQAQYIPYNVIRSYDRPLMVKEVTSRVDRNVRSELDWQLYLLQRKYLDYQVNVGNRMIECLGSNDPDVRVKAIEIAHNKTFQDIVDELFSYTHKKIDRTRNEIVFNQRGKLLLPYQLSSGEKQMLLIL--LTTLVQDFDHFVLLMDEPEASLHIEWQQKLISIIRELNPNAQLILTTHSPAVI 257
267 5.000e-20gi|319408781|emb|CBI82438.1| conserved hypothetical protein [Bartonella schoenbuchensis R1]  clstr ali  22  15..........................ILMGNNESGKTTTLQGVYLLSQLCLGKQLTDEELASIRPKISATILVDEAEIEKLAKLNTLKKIKDDFSENNQLNLSSFVNSFCTEKRVMINNKDYGDKTVTTLLDYIQNHIPEIVYYDDFMFDVANKI-----RFLKTAAQDSNKELTQD----------SLLNDKKNLLWHNIFNDLLIGAHKHQTGGKTEL----------------------------------DINFQRXXXXXXXXXXXXQRLSSMNNYLNSVVTKDWEDITGGKTVTVTGSNPNFLVKANGRTFSLHERSKGCRWFFCFKVLTDIRTNRSKNTIFLLDEPASNLHIHPQEKILQSLQKLSDNNSVIYSTHSPYLI 354
268 6.000e-20gi|158520918|ref|YP_001528788.1| ATP-dependent OLD family endonuclease [Desulfococcus oleovorans Hxd3]  clstr ali  18  3LKKARVQNYRSIIDSGLFDIEKLK-TILVGPNEAGKTVLLKALQQLSKPSDVEGFDVLRDYPRSKYNDIYFELEDEDKELIPESFHNCQYKLYRNLNNKGYHSLINAPEKITFVEGDKEVIKPSDSFKAISSEWSDNKIIDDESAKSLKSWLDXXXXXXXXXXXXXXSRHAELLELIQNNAKHDEVLKILDKRTPVFILFNNYFKVLAQRVEQNILDDEYYDYGNLCLLKLLGFTPKELADLGNAQSPKINEKEALKEYKDKLDKRSYQLNAASVRLTNEICSAWLPDLKRSEADKLKITADGQYLKVVVEDDGVDIELDQRSEGFQWLVSFFVFFSEAMDKHDNAILLLDEPGMSLHGLKQREFRKTISRLAEKNQTIFTTHSPFLV 434
269 6.000e-20gi|323496668|ref|ZP_08101719.1| RecF/RecN/SMC family protein [Vibrio sinaloensis DSM 21326]  clstr ali  18  65LNSLSLSNFRRFDDLCLDFDE--KLTVIIGDNGAGKTSFADAMANIFSWFNNNLEKDSVNGNFVKLSDINIKATDYAELTCNFKLDQINRFEASLALPVQGYTGSKSNDVNVIKQFGAIYRSTAKNESITLPLLAYYSVERSDFELKTSVTEKASGDREGNRFSALKDSLKGNGKLDDFSKLYIELVNLAEGEETKEVKELNEQINTLQRTIDDVYQGEQP---------------------QENDPFTAKLNSLKGQLADLRKSTASAKYQRHLNFVNEAIETLVPDVK-----NLEVDRSTGKPRILVENFGNKVNIAQLSQGQKMLVALTGDLARRLVTLNPGIVVIDEIELHLHPKWQQEIIIGLQITFPNIQFIVTTHSPQVL 433
270 6.000e-20gi|397660884|ref|YP_006501585.1| hypothetical protein A225_R1p0660 [Klebsiella oxytoca E718]  clstr ali  15  3LHTLKINGFKRIHNAQVKF---GDATFLIGSNNAGKSSVLKAIEWLLSDKKRMASDCFCSEVDAETGENKISCKE---IILEAEFRNVPDDAKTWRGFKGRVFSYDPTDSGETGNSIFYRKSYTLG-EDVLIELKSLKRELKKEFENLKKPLDFIESGVDAAIITELFSSLEKNISGSEKSKLELIDDIWD-VTEEEIWDKNPGGIGGVVLSRLPSFLLIPAESGANEIEDKTLQKTLNELFKDVRGGSDNYKRAQECLNELAKELNPSDEKSEFGIMMGELNKVLCGVFPESKIYAFADLSNPDTFSIEMSSNIRTTVSNQGTGMVRAAVFGLWLRKRGEDARSLIIGFEEPEIYLHPSAANQMRDIIYDLSGSSQIIATTHSPYLI 396
271 8.000e-20gi|421353633|ref|ZP_15803965.1| hypothetical protein VCHE45_0973 [Vibrio cholerae HE-45]  clstr ali  15  19........FKNLKNVTIDFEEQEWITLVIGWNGTGKSNVLEALATAFETPSFAYDIEYICHGKYVKISADPDSKKAKYIISYKMADDAPAEQKELFENEDTYKKISLTDFTKQRDDFLPKYVFGYYSGHSERMHDVFLPYLEKYDENLRNGINPGLRKLFYAKPVHSQFALLAFMLNRDDFITNFLENHFGIDTEVGI--DSVLFVLNQPPWKSSAPDGDPRFWMSRGVVKDFLSNLYDIAIAPIRVKRKTQKSLWNSTELEHLYLYVKDLESLERLVGDKLPSEF--FQDLESTYVSELISEVRIRVKLKKNDGSVTFRELSEGEQQLLTVLGLL--RFTAEDESLFLLDEPDTHLNPKWSVDYIDYLNKFVNNSHIVLTTHNP... 412
272 8.000e-20METAHIT MH0021 GL0059498 [Lack 5`-end] locus=C2078259_1:165:1709:-  ali  15  6IKSVKIKNFRGYRDE--ICVDFDNLTVLIGKNDIGKSTILEALDIFFNEGNG------IVKWDKSDLNVQAIENGENETIISVCFTELPENIVIDSTVQTDLSSEYMLNAAKDLEIIKKF------------KASKPAVFIKALHPTNPECCDLLLKKNDDLKNIADILDIECENLSTNSKIRKAIWEHFNSNLNLKEVEINIAKEDAKKICENL-SSYIPQYSLFQADRRNSDDDSEVQDPLKVAVKEILTDQEIKDKLNSVADTVKERLQEVADRTLKKLNEMDSGIASTLHPVIPIDKWSDVFKNVSISGDEEIPINKRGSGVKRLVLLNFFRAEAERRAKESIYAIEEPETSQHNNHQRMLITALKELSPHTQILLTTHSAVLV 381
273 8.000e-20gi|328542327|ref|YP_004302436.1| hypothetical protein SL003B_0707 [Polymorphum gilvum SL003B-26A1]  clstr ali  18  3LKQFRIQNYRSITDSGLIHVG--QLTSLLGRNESGKSNLLRALHSLNPKDFPRHRRLEECSDTTPVVATLWELDNAD---------RTELGKLWARGGTAIAVRIGRAYGDRRTVGFEGVSAQEFDAAAIKSKIRKIVPAVKAKAAKLDEQVRTVLEAAADKFDADVANKAKPALAALRQAMATADAELTDTQDAHVAELEDLANTIAGDIEGEKNARQMPVFMYLDEYPELNLQRKEQNQQTPADVNFEKMCKVAGLRPQELQS........................................................................................................................... 288
274 9.000e-20gi|119509141|ref|ZP_01628292.1| hypothetical protein N9414_05050 [Nodularia spumigena CCY9414]  clstr ali  15  12......KNYKNLSLEQV--VELQKLNIFIGANNSGKSNFISCLKFLKSSLTKIPDENRGVSSFEDAISQCGGDRILDISVDSPARVRLAYCFEFPQNTQINTASKDSRILDIKIFVNKPNLKVSIGEEYLYNGVNLHDYNSSTPFYYYKFHDREFGKGAVSVYDEPGQTLRTHF------EGLEDIPSNSLGLATIPKLLEHSQYPPENTPVYKVRRELIELVSQWQFYNANNMDLNEIRLSEPKIGGSDIYLSQSGDNLPLVLDNLIQQDIEFEESINIALKAILPKSRRLRP--IRSGRLSLTLELYFQDIKEAFCLNELSDGTVR---MLCWATILHSPILPSLLVIDEPELGLHVSWMPILAEWIKKAARKTQVIITTHSPDLL 380
275 1.000e-19METAHIT V1 GL0049157 [Complete] locus=scaffold56153_5:1527:3350:-  ali  14  3LKSAVIKNYRGIKEETLVSF--QDFNCIVGKNDVGKSTLLKAIDAFLNENNPNIEDKNVYSDSN-------------FIEINLIFDSASSPIILDDTIPVSLFDEELVDENGLISVKKVWDVSQ----KTIKPKIFLCRKIYDADDFVMLSEKELRTLCAKFHIETAKANGEEYNNKEKREKLRAYHHEAGTSFHFDFEEMPATGTTRPKKIIEALKGILPTFEYFRADRSLSDSDTSVQKYFKDQAYKLLKSEIST---DEVEDSIRHHIEEALGKITQKINQVVPEDEQVEAQVEFDWSKLISTSFRCKKDEANIPLTSRGDGFRRIMSYFEMLAEEKHSGRDMLFGFEEPETFLHPETQQQLYSKLIGMKDNYQILVTTHSPNIV 371
276 1.000e-19METAHIT V1 GL0049601 [Complete] locus=scaffold50622_2:1318:3315:+  ali  14  3LEKIKITNFRCFDSAGIEACFNKGVNSVIGENNAGKSALIDALRIAFSAVPYQRDIYFKKSDFHVDLSGVQARE----AQFDLYFAEVPMELIEIWTPESDNHGEFHIRFY-LTKTAAGDEKVKFAAWGGSFEGNTLSSDLFDAIDISYLGALRDAEEGLRPSRNSRLAALLGTVADSPEKRQELINVLNNANQQLMEKEQIRKVKDIINSNLGGIEQEVLSQRIDIGFTEPRFEAIASTIRSWVGMKWVRISKTDVPAEQLVGLSAKPGYKQCIEVHNDHLLVNIPVLLQTAHLQGEDIADVEAALQRYQQC---FELQQNGLGYNNLIYMATILGDMSVAKEGILLLVEEPEAHLHPQLQELIYDYFQKQQEDIQIVFTSHSPTL. 386
277 1.000e-19gi|365967614|ref|YP_004949176.1| ATP-dependent OLD family endonuclease [Aggregatibacter actinomycetemcomitans ANH9381]  clstr ali  14  225IKTIEIKNWRSIKELR---ISAQDLMIIIGQNNHGKSNLLSAILFFFGEIKHQDLDFSQGAQELFVDIEFADLDIQDQTTFEKYL-----------TKQGTIRVRKSAYLGGSFEYKGWIQSCSEDFLKEENAGNYTKREIANSLPFYQYLPSTGKLSKAQVIEAQQKYIQSNILDLTFSYELEKTNFMGLKSVAKGIFGEVYFLPAVKNATDDFTSKDSSVFGKLLGEVVESM-SQYNEHWQVTKQQLVNLFSKFSKYIDGKENTDRPKQLLDLENALSQELSSWNAYFDIELNTPDIDSILKSNASVWINDGTRTDIARKGHGLQRAIALIQLIAKNRAVSKSRYFIFEEPELYLHPQAQRVLFDSFINLSEGSQVILCTHSSNLI 612
278 1.000e-19gi|399029397|ref|ZP_10730279.1| putative ATP-dependent endonuclease of the OLD family [Flavobacterium sp. CF136]  clstr ali  14  3IKTLEITNFRLLKHVVLSLEDH--TTVIVGRNNSGKTSLTEIFRRLIGDKNPSFSIYDFS---ISAMDGFIKALHSKLEGKDDDIREEIPYIEIRITIEYPVDLEDLGILGDFIIDLDPASNIVIIAVKYSLKNGRIDSLFEGVADMGEESIKSFMKSLKERIPSLFETHITAVDPTDPEN--TALIEYSKFRSVLGASFINAQRGLDDVTHSEKDVLGKVLAQLFKTSQSNAAPDDMKSSSAALKVVVDDIQSKVDTDFNTQLNKLLPALGLFGYPGLSD-----PNLSTETTIDISNILESHTKIRYGQGNNLFLPETYNGLGSRNLIYILFQLFEFFRRNSLDIIFIEEPEAHLHPQMQQIFIRKLYEIANEVQFVVTTHSTHM. 396
279 1.000e-19gi|260911229|ref|ZP_05917831.1| conserved hypothetical protein [Prevotella sp. oral taxon 472 str. F0295]  clstr ali  12  2.....................................................................................................................................EKYADYIKEIEIDSLWSGTRHIVWRLHKQVNVLSGVNGMGKSTILNRVVKCLPKGGDTNQNHVKGVHITMEPEDATCIRYDIIRSFDRPLLNAEIIAKLGLNITTELDFQLYQLQRRYLDYQVDIGNRIIHALQSGADAARVAQAHNEPKRMFQDMIDRLFAETGKTIIRTENEVRFSQIGETLQPYQLSSGEKQLLV--VLLTVLVEDRLPFVLFMDEPEVSMHIEWQKQLIDLILQLNPNVQIILTTHSPAVI 255
280 1.000e-19METAHIT O2 GL0040511 [Lack 5`-end] locus=scaffold31381_1:82:513:-  ali  23  20..........................................................................................................................................................................................................................................................................................KTLFQDLIDDLFKDTGTTIVRTENEIRFTQLGEMLVPYQLSSGEKQMLAIL--LTVLVEDQQNYVLFMDEPEVSMHIEWQQRLIDLILQLNPNVQIILTTHSPAVV 123
281 1.000e-19gi|398952634|ref|ZP_10674909.1| hypothetical protein PMI26_02664 [Pseudomonas sp. GM33]  clstr ali  12  3LHRLSINGFKRLH---TAEIEFGNATFLIGANNAGKSSVLKAIGWLLSNSKRMDIECFCSELDEETGETKTTC---DTVVLEAEFRNVPEAASTWRGFKGRIFS-YDPKDTGETGKSIFYRKTYKVLEDVKIELKSLKRTIKPEFADLQKPADFISAGATPELIAETFSVLDKKISVADRDKLELIDDIW-ETNEEEEWALNPGGIGSVVLSKLPSILIIPADAASHEIDQKSLQKILHELFKDVRESSANYKDAQACLSLLSKELDPSDAGSEFGKMMGELNTVLGGVFPESRIYAAADLSSPDTFAIEMSSNIRTSVANQGTGMVRAAVFGLLRFREGNDERGLIIGFEEPEIYLHPSAANQMRDLIYDLSQNSQIVATTHSPYLI 396
282 1.000e-19METAHIT MH0001 GL0011045 [Complete] locus=scaffold18649_3:647:2659:-  ali  12  3ISKLIINGFRGFKHTEIEFEE--GLNVIIGQNNGGKSTIMEALRLVL------------EYGSPKKLCAWDLCQKAELQALKDNPPFVEIAVFIKEQNDEGMTDDIALFTNYAIQTSPLLESCLTYVFSLPYSEVEKYKKDVAEVDEKYTLFKIIEDKYIRKYSHAIYGGPVSLQNQVQGEDLKKID----------LEFVNALRNVSDEIYGGKNTLLTDVLRYFLDYELNKDSNKEEKI----KSRHQDFLTKSTTVIQNIIKRIKDGKDSIIDYANKTGALFMNSDLNLEGEISEGDLLAIFNLLVSNGKEEKLPISLNGLGYNNLIYISLLLAQMQSNKAFSVLAIEEPEAHLHPQMQYHFLEFLRNNIFDRQVFVTTHSPSLV 376
283 1.000e-19METAHIT V1 GL0068634 [Complete] locus=scaffold29939_2:1235:2500:-  ali  14  2..RFQITDVGRIR---KADIKLDGITVIAGENNTGKSTVGKALFAYANADGDLERNIKEEVAAEIQ-----------LAMFTTQFDGQWGHPRFMRPIIDMMVDELIGTDVTVQSLGKWLRDMPISSPLLSEKASKAASDYLKKLGGRSRKAIAVRSRIVSLLTRSRQTWKNIILNKIMR-------HLFNEQAHSLLPESNEDYDLK--LFSKSEDESFSHCLLLDDPAQVALVASGFESEVFRKRMAFNSSISEGIYVMDASTIAYIIEHEEYSHSSEKIVNLLSGIY-DGSIGFNEQYEPMLREIFPTTDG--IKLVNASMGIRP-LVLLKSLVARGIMRSDLLIVLDEPEVHLHPAWQVVYAQALVNIYREYRFLVTTHSPYF. 361
284 1.000e-19gi|293115417|ref|ZP_05791371.2| conserved hypothetical protein [Butyrivibrio crossotus DSM 2876]  clstr ali  18  4IEYIRISNFKSIDNLEIKDIE--NALILVGQNNTGKSTVIDAIRAVCGDYKIQFDDFD-DSGANIEISIRLRIFDSDLANLQKMGLVSRCRRYEPWLREFG-------------------ERLPSYVPDGEEFDEPDGGVLSFTFYANRTGKVRWDDGFHK----------------NNQWISTIFPKIYYLDAERNLTVFSRDMLFLQENEEM-KCMKAGCCIFEHAKKCNHCFSCIGLINRKTVEELTAFETSKLLEYKTYQMNLDEFSAKVNRIYRRNGGQDTIVYSMNNDLESMLTVNT---EIHTDAGGFTRPVSYMGRGMRSIYMLSLLEADLDDSNYPCIIMMEEPEMSLHPTLQKKSGDILYRLSKKHQVIFTTHSPNLL 349
285 2.000e-19METAHIT MH0060 GL0045205 [Complete] locus=scaffold32117_1:1475:3397:+  ali  17  6...VRIKNYKCILDSETFTV--DQMTCLVGKNESGKSAILQALYKLNPVDKEDIYDALYEYPKMYQTDFEAGEIPDGNTVLISHWKFTENEITEIDALFGSGFITKSTIVTITNYDNHRSWSFEPNFEKLFTKKTADCAFGDPDRAQITKFDSISDIRTQLNQLSVLSDAEQSFKDWFDEAFPNDKLDTFSEKYLLKYLPKFSYFAEYQKLPGKIAINRFISRSNSGQLTKNEKVFEALLSLANSSVEEIKDSNRLEALINKTRGISSKITREIFSYWSQNKHLRVEFRYDMAKPGDEAPYNDGYIFIENTRHDSSVSFDDRSAGFVWFFSFLIWFNYLQKKEDNLIILLDEPGLTLHAKAQGDLIRFFKEITPKFQLLYTTHSPFML 393
286 2.000e-19gi|20090982|ref|NP_617057.1| hypothetical protein MA2139 [Methanosarcina acetivorans C2A]  clstr ali  13  14ISKIRMQNFRCFCDTSVEFYE--GLNVFIGENNSGKTTVLKALQLIFDNSVSKKLSIDDFYKGISSFDEPPQITITISIQETESEKIEDK----------------AVVATWLTKLNSPCEATLTYKYFLPETDLEEYKKELNERDQSLISEWDILERFLQRYVSRIYAGNPISKNRVESEYLEKFDCTFLDALRNVENSIYNGKNSLLKNVLNYFLDYNLKSSIKKLEQDLEDTDSKAKLDECLTKLECCRNEFRGQSKDLLDSIRGRLDTGHILSLVESTGASVCGKPDIEGELSESDILSTLKLIIKSNSGMQIPIFNNGLGYNNLIYISLVLSNLEIITSDHILLIEEPEAHLHPALQYNFLRFLKEEIKNRQIFVTTHSTHI. 395
287 2.000e-19METAHIT MH0031 GL0079479 [Complete] locus=scaffold45894_1:963:2201:-  ali  13  2IKSIKITNLYYIYSYDIDVVNESNVLILTGPNGFGKTTILQIINHLCSLKLWYFYLLPFDRIELSFVDGINISIFKSCKDEHGYGDVEFSMRIGEEIETYTLSKEFVEQKARQCSSIFRTSDNGKLDENLETYPNDDLIAFFNTRMSFTETQKCTMIEEQRLVIRKVLRNDAKYSRTVEEIQTKISEFYAEAQKAYNSASLKIDGSFVKRLSDIEPTNKVKHIKKEKIYKEVVQKIADYKKYDLVGELDVVSDLGVHYNEVLKLYLTDLNSKLSSIDRYYDKLSTFDRLVSGKRLAYKKLLFKDDKMQVVGDNGHEIPIRKLSSGEQNLLVLCHNLVFGL--DEKNVLLIDEPENSMHIAWLQNLLDDYISIAKGCQIIIATHSPAFI 393
288 2.000e-19METAHIT MH0065 GL0054731 [Complete] locus=scaffold75629_5:11762:13873:+  ali  20  3LKKFRVTNFRSVEDSG--WIDTERITALIGTNESGKTNIMLPLWKLNPANEGEINLLDDLPRDKKFIEACYMLDDNEAEDLANISGHQKSELEEVVVSKDYGGNLSWSFPYECDNKLAMKDRAREIIQSILSKIKSDETDSDEENPRTEVDRIQLVLNEEKLGSNTDNGTENTLATGIIKKLKELLDKMDRFPLEENEEVISHLSINMPKFVYYSNYGNLDSNIYLKARTVRVLFDFVKLNPQEILEMGKENILNNDPERTEIISRKKEERQVLLESASSNFSKSFNEWWKQGNYKFSFKADGDYFKIWVADSIESIELEARSTGLQWFFSFYLVFLVESQRHKNAILLLDEPGVTLHPSAQEDLFKFFDSLARDNQIIYTTHSPFMV 439
289 2.000e-19gi|402304176|ref|ZP_10823252.1| AAA ATPase domain protein [Selenomonas sp. FOBRC9]  clstr ali  20  3LTSFRVKNFRSIDDST--WVDVNDITNIIGVNESGKSNILLALWKLNPATDDGKINLLADLPRERYAELKDSCQKMDFIETYWDLSEDEGLLEKLVEYGPFEEEEFYTLHFGRYYSGRYFFNFPNLNIQEKRPSKKIQAALHQFLDSFSKDNISNIAKTETLTKEAAINLYNELSAFSEVNYGDSFDTLLDICETEKTILTKKDIIYSGDFFSKTLKPAIPHFVYYSNYGNLDSEIYLPTVISDMNRTLRILFSFINLKPQEILELKKNERTVLLDSASAKLTAKFRDWWKQGTYDFLLRADGYSFKIWVSDEKRKVDLESRSTGLQWFLSFYLTFLVETAETSNTILLLDEAGLSLHPLAQKDLVHFFQSLAENNQIIHTTHSPFLV 449
290 2.000e-19METAHIT V1 GL0081571 [Complete] locus=scaffold61000_2:608:1981:-  ali  19  176..............................................................................................................................................................................................................FLNYGTNRLVLDVPLRIRKKHSFSKRTALERALENRLDFRTFFEWFRNQEDFENEQ------KSIKRDWDYRDPALECVRKAALSMLDDAEEIKVRRNPLRMVVIRNDKEYRVDQLSDGEKCTLALLGDIARRVAMANPGIVLIDELDLHMHPAWQRKILSVLRKLFPNIQFLITTHSPQIL 360
291 2.000e-19gi|331005830|ref|ZP_08329186.1| hypothetical protein IMCC1989_2484 [gamma proteobacterium IMCC1989]  clstr ali  13  3IKSARIKNYRLLKD--VCLSLDDRTTLIVGRNNTGKTSLAEIFRSFLSSTGPKIRYEDFNQSCLAEFEKALNAFKDDQEGEAIRLLMPTIELELLIDYKDDESDFGALGYFIIDLDDTLFETCILVSYQLKDGKIKDFFQALDAANRKKYFSDLKCLISQFYEPVIYAIEPTNLNNKVRLEFSSFQRLILSGLINAQRGLDDETHSERDVLGKSLGNI-------FKSASSAGAPEAFKAKSDEVNAVVEKLQEKVDTDFQDKVKSLLPTLN-----IFGYPGLQDPKLSAATELNVKSLLESNTRVFYEGDDHFTLPETYNGLGIRNLIFILFRIYEYFISPKGHLIFIEEPEAHLHPQMQEVFIRQLEEIVGEVQFVVSTHSSHI. 394
292 2.000e-19gi|335436303|ref|ZP_08559101.1| hypothetical protein HLRTI_04387 [Halorhabdus tiamatea SARL4B]  clstr ali  24  100.........................................................................................................................................................................................................DLLRTLSNIDSPPNRIEDLPNIV--DQSKINLADSEYDLRADEDNPVLRGLFALNNINLEDYSSLDSPEFRKSLDTAVEQLSLYLNWFWETDSYRFEYELHEGTITLKLAEDETPPTPEQRSDGMRWIITFLLTIIAQQSGGRQTLVTLDDPGIHLHPEAEKQLFRAFFNVTNQAQIIYTTHSPALI 304
293 3.000e-19gi|374630211|ref|ZP_09702596.1| ATP-binding protein involved in virulence [Methanoplanus limicola DSM 2279]  clstr ali  15  163LEYIDIKGLFSKFNHKIPLENGEHISIVTAPNGYGKTTILRLLRAVFVGNIKEIRDIPFSSGFYTEEENSTERRVLTIEKSQDKPKGRKLPGKEMWSLHFKTCSAGKTLEYTVNPDNYSEDETSWELSRIIPPIPVKFISAQRLWQNSESGEKREDDLLTSHIPGAKRTYELTILNHSDDIKKRIQAMLNDYAASTQQLDATYPSRYMKLCYEMAEGLLPPAETIIQSLSNIRLEQKKLKKLEIFEIDEDEIKDETGVLAALTLYIEDTEKKYLIFSDLEKKIDLLIRIINALFLNLSFEIRADRGFYFTVGDSERIKPERLSSGEQNQLVMYYDLIFFT--DPGTLVLIDEPEISLHIVWQRQYLDYIKKIITGSEFIIATHSPQLI 563
294 3.000e-19gi|423326723|ref|ZP_17304531.1| hypothetical protein HMPREF9711_00105 [Myroides odoratimimus CCUG 3837]  clstr ali  14  3LHSIKLKNFRSYKEETEIIF--NDLTAFVGKNDIGKSTVLEALDIFFNDGKG---------------NYVVKLDKDDINKSALFEGDNTIYISAVFTNLPSSITIDATNPTSFQNEYLLNTEGNLEIIKKYQNAGVAKVSIKANHPTNSRCSDLLIKKNTEYRRIITQNEIQCDNQTINANMRTAIWNHFSDNLELEEIEIDTSKEDAKNIWEKIQI-YLPQFSLFQSDRKNSDTDSEVQDPLRKAVTQILADREINAMFENIAQRVSNHLNEVSSATLAKLREMNSDIANSLNPVINALKWADVFKNVSICGDENIPINKRGSGVKRLILLNFFRAEAERNSQSIIYAIEEPETSQHTDHQRLLIKAFKELSQNTQVLLTTHSSVIV 382
295 3.000e-19gi|154149264|ref|YP_001406217.1| hypothetical protein CHAB381_0630 [Campylobacter hominis ATCC BAA-381]  clstr ali  14  3IKSMKVKNFRGYSDE--IIVNFDDLTVIVGKNDVGKSTILEALDIFFNDG-----------------KGVVKIDKTDVNIAKSKNGEYETVISICFCDLPDKVVIDSSVETSLADEYLLNKNKELEIVKKFQNGGAAKVYIKANHPINKSCKDLLLKKNSELKKIIKEENIDYSDLSVNSIMRKEIWAKYSNDLQLDEIELDVTKEDAKKIWDKI-SLYLPVYSLFQSDRKNSDSDNEIQDPLKEAVKQIISEESLQNSLAEIAEVVRKKIEEVSNRTLEKIREMDSEIANTLNPVIKNLKWQDVFKNVSISGDENIPINKRGSGVRRLILLNFFRAEENSENANVIYAIEEPETSQHTNNQYKLIESLKKLAKKTQILLTTHSPNIV 380
296 3.000e-19METAHIT O2 GL0126134 [Complete] locus=scaffold17463_1:3395:4279:+  ali  17  21..................................................................................................................................IKLANYISKIEISSLWSGHKHIVWQLRPDVNVLSGHNGAGKSTILNRLIQHLRTIPTTGEIQGNTRFGVKIDFDPSDATGIHYDVIRSFDRQMVNFKNTSAISDTELDWQLYLIQRRYLDYQVNVGNRMISLLTSGDPEAREKATEAAN--LKTRFLDIVDELFAETGKRIDRQSNELSFIQYDEQLPPYLLSSGEKQILL--ILLTALTEDQQHYVLFMDEPEASLHFEWQKNLISLVRELNPNAQVILTTHSPALI 278
297 3.000e-19gi|315656642|ref|ZP_07909529.1| conserved hypothetical protein [Mobiluncus curtisii subsp. holmesii ATCC 35242]  clstr ali  11  6LSKIKIKNYRLLIDAELDVDA--KTTLIVGRNNTAKTSCSNCINTVLQGNDFSYNDYPISKRENLCNLFFQFMKKELSYEDLC---RGIQPISIEFVVDYSLDDQDTKLGALSPFIIDVDVDTTTALIRAEYQLKTDESKLRELFKDSCYSNAKFAPKAEDMHAMLASNFSRLFGLIIYAVNPKNLEDWQVKSHRELKDLFPYYPIPAERILGEDGTQKNESLSSLIADYFSLNEEDLTPDIAEKVKELRAVVDGANKNVQKESDRILSDLVSKAVGFGYPNVEELQLGVTTELKIDDQIKNQTRLSYSSGAGDESLPSSHNGLGYKNLIKMEFLLAAFARDVEKKLLFIEEPESHMHPQMQHAFAEHLEKFLDKIQTFLTTHSAHI. 398
298 3.000e-19gi|126665992|ref|ZP_01736972.1| ATPase [Marinobacter sp. ELB17]  clstr ali  16  92.............................................................................................................................................................NLAKVRKGYSKKDLASVLISASEAAKRIQGAITENVGDVNIPLFAYYPVNRAVLDIPLRIREKHQFELLSAYEESLTSGANFRTFFEWFREREDLENEHRKYRDDLIKPDDFQFPDPQLAAVRRALEIFMPDFT------ELTVRRNPLRMEVLKKGRRLTVNQLSDGEKCLMAMVGDLARRLAIANPGIVMIDEIDLHLHPKWQRLVVPRLMEVFQNCQFLISTHSPHVI 325
299 4.000e-19METAHIT MH0026 GL0010526 [Complete] locus=scaffold28830_1:2729:4771:-  ali  13  3ISKIHIIGYRNFKDKTV--EFHEGINVIIGPNNAGKSNLLRALDLVLNTDTSKKLTLFDFCRNCTIKELKTAAPKVRIEVFFXXXXXXXXXXXXLAMVALCLTKLEHPYEAQITFDFFLPQEEETEYLQSVSEVSEPDKVWNIIRDEYLR---------RYVSRMWAGDPINQARLDGGTVDKIDFEFLGPIRDVERDLFSGKSPLLREVLNFFIDYEIKFDTTKSKDVQNSELKDRHLDFTNSVEPSLTKINERLTKGKEQILDYAKQTGASDFHGAVPDFSGTLSEPDFLAALQLMIKHETGIDVAATHNGLGYNNLIYMSLLLAKMQANADEGYYRQNAKVFSVLAIEEPEAHLHLSLQYKFLKFLINEQVNRQLFVTTHSTEI. 382
300 4.000e-19gi|333925201|ref|YP_004498780.1| hypothetical protein SerAS12_0309 [Serratia sp. AS12]  clstr ali  22  3LESFRVQNFRSIFDSG--LITTDKLTAILGRNESGKTNLLLALESLNPATGFSELNNIKNFPRNRKLSDNWTLTKEEREKLAENITSVSISRNYNGNIRYFGFHGLNTFTYDAPKIKKEIRTIIAQIDIFFEREENNTEANQAELKLIRDVCSAMLPIPERPLGWSAKAKGKPQELRKLLLKNSIEIKDSSESALDEIEDILEEIISDDARQAEARKWIKSKLPVFVMVDDYPELNGHQNMAEYNQRKQQGNMSKADINFEKLNKNNSDIRNQLVNRASAVVTQEIRRLWKDKPLKIRFNVDNDHFDTYVSDTNHSYNLDERSRGFKWFFSFYITFFADTKNAENAIILLDEPGLYLHAKSQTDLLNHLSNDFAN-QIIYTTHSPFLV 422
301 4.000e-19gi|167760899|ref|ZP_02433026.1| hypothetical protein CLOSCI_03287 [Clostridium scindens ATCC 35704]  clstr ali  14  5........LKNIGKIGTASVEINGITVIAGENNTGKSTVGRALFAVFNSFCNVQKQIENERVDSLENLLDRM--------YMNGSSRFMRIANTNEVAKTIVAHIDSYRQAELSDMQKEIGDLLVQYDEGKIESFDENTIAETVSRIKDVLNVSGMDFLKSVLERKLDAEFNEQVCNIFSGDDGEIQLQIKDTSITVSVENEGAVDIRNPGDISLHTEVVYIDDPFVLDDPSMFFRRIPSTSADHRYHLRKKLFWPDTESNVFDEIIAKDKLNSIYEKISSVCS-----------GDIIRSKRSVLGYQRKGSDKVLNVRNLSTGLK-TFVILKMLLTSGAIEHNGTIILDEPEIHLHPEWQLLFAELIVLIQKGVHVLLNTHSPYFL 366
302 4.000e-19METAHIT MH0040 GL0060349 [Complete] locus=scaffold100586_1:79:2169:-  ali  19  3LLKFRVTEFRSVLDSG--WIEVENITALIGTNESGKTNILLPLWKLNPAD---EGEIDLQDDLPRDKYHEYRNSKPMPTFITAFFKLEDKEASHLSNLTGLEAESFSEVCVSRNFDGEYSWSFPAADEKPATSVSELENTLNQYVRSLSEQGEMPKAEVQRREKVVSAIRLAEECLIGESSLINEIKNALEELLSDNDKVIGYLKDTMPKYVYYSNYGNLDSQIYLPQVLQNLSRDNLGLKDAAKARTLKTLFRFVGLDPKEITEMKKKEREILLSSASSSFTKAFKEWWKQGDYAFEFQADGDFFRIWVSDKPERIELEARSTGLQWFFSFYLVFLVESERQRNAVLLLDEPGVTLHPLAQKDLFAFFESLSTKNQMIYTTHSPFMV 440
303 4.000e-19gi|365163203|ref|ZP_09359319.1| hypothetical protein HMPREF1014_04782 [Bacillus sp. 7_6_55CFAA_CT2]  clstr ali  14  3ISELTISNFRSF-NKKTTLNFNDGINVIIGQNNAGKTTVIKALDILFNNSSSKRLNINDFNRSASIEELKVCPPKIYISAKLQESENEGEYSDELVTVATWLTTLNKPYEATITYEYFLPEKEVAEYTNLMKKI----------------SIEDINHYWKAIEHNFLKKYVHRVYVGNPEFKNSVQNDEINRFDFQFLTAIRDVERDLFKGNNSLLREVIDFFMDYDIKSNSEL--XXXXXXXXXXXXXRDFSVESKKIIESLQQRMRNGEEQILKYVNNTGAGIDESKPSFDGEILDTELYSALRLIVEKESGIKLPAISNGLGYNNLIYISLLLSKMQKDASGSILAIEEPEAHLHPSMQYKFLQFLKENKDSNQIFITSHSPNI. 382
304 4.000e-19METAHIT V1 GL0120958 [Complete] locus=scaffold27028_2:253:1581:+  ali  12  8LLSVSVGGFRNLAYTT---IELGGITALVSPNNYGKSNLLDAIRFAFQFIESGNKRRNNLMRSTNCIPLSPSLSNDDF--------RFSIEFDDPSLGEYRFVRYGFSFSWPKDDGSGCKITGETLEINAKRSGTWTNYLRRNRGQYKKGHDTRSFRSISLDDSQLAIDVLTAVEDIEINPAIRSIFDITYAICDSLETENRFHSTPLEFGETMDDSTAMFN--------DVDLPRALYRLKQSDPEHYDIFQSAIYTLFPEFEHISVNSYELRPEDHERLSQALKKDDIPEENIPFHIRDDLYRLMVKSANLNQPVDISHMSTGTKRIIWLVANTIIAGANSAGCI-GIEEIETSIHPRMMRELLEVLNENIGSTSLLLTSHSPFLI 375
305 4.000e-19gi|325264520|ref|ZP_08131250.1| hypothetical protein HMPREF0240_03527 [Clostridium sp. D5]  clstr ali  20  3ITSLRIRNFKYIRNMYIEDI--DNALILVGQNNTGKTAVLDAIRAVGGSYQIQPEDF-QENNSNIEVFVSLEFLEEDLVRLQKN---------------------------GVVSQYRRFEAWKEDFRKKLPSFDD-----------------KGVLTFEFIANKDGRIRFNDGVKKNNAYIKEVFPQIYYMDTQRDLNQLQGDLLMLQE-DALLKRMRSDCCIFDQAKICNHCFACIGLINQKKPEELNAFETA--------KLLDYKLYQLNLNDFARKVNENFRKNGGQEEIIYSMNRDVERMEIRGREKNTNWPVSRMGKGMRSVYMLLLETYTEGEDRVPSIIMVEEPEIFLHPRLQKVSGEILYRLSRKNQVMFSTHSPNLL 340
306 4.000e-19gi|171912561|ref|ZP_02928031.1| hypothetical protein VspiD_15315 [Verrucomicrobium spinosum DSM 4136]  clstr ali  19  2...............................NEAGKTVLLKALE--------KSADALSLEEFDPVEDYPRKELSAYLKRQVENPDVATELTYQLTPRELAVVNAMCHVELGKDFEFTVAHLYNNKTRTQIELDEKPALRALVS-SVGLSTDAKTAISAATAVREVPEALSGVELTDVDSEVLSQLKERINKSERVSVVEHEVWQWL---------ERRLPQFLYFGDY--DLLPSKINLQDLKSRNVLALIRMADISIDDFADASGYEPLKAKLEAVSISLTDQIMEFWKQNELEVEVDIKSDYLRIKNRRHGVSTPFGQRSRGFIWFFSFLVWFDSRFREDSSLILLLDEPGLALHALAQSDFLRYIDELSTKHQVLYTTHSPFMV 376
307 5.000e-19gi|374383457|ref|ZP_09641029.1| SMC domain protein [Desulfitobacterium dichloroeliminans LMG P-21439]  clstr ali  13  3ISKIRMINFRNFKNTEI--EFNDGVNVIIGHNNAGKSNLIKALSLVLDSQVSR------------------QLDIDDFNKYISLDELKADPPKISIAITINQSIDEDLNSDDLVTVGNWLTQLNEPYESLLTYEFFLPEKEKSNYLNIITTAIDLNMAWKIIKHDFIRLFAYKVWGGDPITQTVADSESLQKFDFQFLDAIRDVERDMLTGKNTLLRNVLDFFMDYEIKSDVTKSEEDK--RKEIEKKKQDFSDHADALLLDLQERMKQGKDQILSYAKDTGASFNKAIPNFEGSISDVEMFSALKLIVEYETGIKIPATHNGLGYNNLIFMSLLLSKMSNAKVFPVLAIEEPEAHLHPAMQYQFLRFLKKNKKVRQIFVTTHSTHI. 380
308 5.000e-19METAHIT MH0025 GL0071210 [Complete] locus=scaffold17160_2:1051:2472:-  ali  14  3LTEIFFQNFGPFVKIKANENPTKNVAVFIGENGAGKSSILEGITILLSWLVARIR-----SDKNSGSPIPELKIYDNASFSNLSISLNAQDEDRKWNIVRTQKGKKREIESNLKELHTLAEIYRSALSKDDNASLPLIAYYPTERYVLDIPRKIRKRHQFKQINGYETALTKGIDFRVFFEWFRDREDSRNEGKISFDEISWYVDFEKFITAVKERQAAIPFDDIYSFLDMNKLHENDQDLYRRVINRETLLNDPQYFAVLHALEIFMPGYSNLRIQ------------------------RKPRMRMMINKGKQQLDILQLSQGEKSLLALVGDIARRLAMKGEGIILIDEIDLHLHPHWQRNIVRRLRETFPNCQFILTTHSPLVI 374
309 5.000e-19METAHIT MH0014 GL0155330 [Complete] locus=scaffold50081_1:94:915:+  ali  12  2......................................................................................................................................KYADYIEQIEIDSLWSGKHHVVWNLDRQVNILSGINGVGKSTILNKVVRGLVAGGEFANHMLKGVRLKVVPEDAKWIRYDLIRSVDRPLVNVEAMSAINATELDLLIYHLQRKYLDYQVNIGNRIISVLQSGSPDAAEKARE--ISAPKKRFQDLIDDLFEATGKKIIRTENEILFTQIGETLLPYQLSSGEKQMLAIM--LTVLVEDNRSYVLFMDEPEVSLHFEWQKRLIDIVLELNPNVQIILATHSPAVI 257
310 5.000e-19gi|70729404|ref|YP_259142.1| hypothetical protein PFL_2023 [Pseudomonas protegens Pf-5]  clstr ali  13  5IQSLSIRMLHNYLDIDLSFNE--GLNVIYGKNGKGKTTVLHIIANILELDFSRFSHIKFESISVTSSTGDTLYIAQDNTNSIYVVFNDSLMGTDIDSIYPTLTQVEEETIRAAFGGRPVYLPAYRAILEKVKSTSQYETSRNRDYDIIRKNELSEISKESPSYIRSRDEQRANMVAIRYPGLAEVVDSISEEYSEAQMSSSRAQSQMLNSIFIGVFNSITSKDETPSDGEVEPLLERVKTALDDSQTDSRLYDNDATKRVLKLYADMLERLKHENQIAFRKLRNFENAVNKFLDGKKHNNKRWRDYASIRTSQDNTYPLTVLSSGERQILTMLFS-ASRMSTASTGIFLIDEPELSLHIDWQRIILANLEQQAASRQIIACTHSPEV. 433
311 5.000e-19gi|148380046|ref|YP_001254587.1| hypothetical protein CBO2090 [Clostridium botulinum A str. ATCC 3502]  clstr ali  14  3ISKLEINNFRCYEDVDIEFNE--GLNIIIGENNCGKTTIMRALEYIFNRSRVSTPDTNDFNKELVNKALEIGEQPPEITIIATLKSSSSDKLEDKAVVASWLTKLETPWEATLTYKFFLPESDIKEYKEEIKSIKKSQKNYIQKRWNIFE---KYLKKYVSRIYGGNSESKNKVESEYLNKFHCELLDALRDVESKMFTGKNALLKEVLGYFKDSHIEIEDGDEFSEEDKKKLIEKEKKDRKKEFDEYADKIVKNISKRVGNNDVLDFAEKTGASIGGIPTLGGNLEENDVLSVLKLMIK-NKTGIEVPIINNGMGYNNLIYISLLLSKFKMITSDEYGENAKVFPILLVEEPEAHLHPALQYNFLKFLKDEVSNRQIFITTHSTHI. 387
312 5.000e-19METAHIT MH0055 GL0025353 [Lack 5`-end] locus=scaffold45211_3:439:873:-  ali  20  13..........................................................................................................................................................................................................................................................................DAREKATALASAKQRFQDMVDDLFSETGKKIDRTSNEIRFEQI----GETLLPHQLSSGEKQMLVIL--LTVLIEDRQSYALFMDEPEVSLHVEWQQRLIGLIRELNPHAQIVLSTHSPAVI 128
313 6.000e-19gi|334129154|ref|ZP_08503026.1| ABC superfamily ATP binding cassette transporter [Centipeda periodontii DSM 2778]  clstr ali  13  5........LKNFAKIKEAEIHFDGLTVIAGNNNTGKSTIGKVLFTLFHALRNMPQQVLEERKNVIRDFFSVLLRRDSERFQLLRMMEMEGMPKL---------------FHGLDTNVKSVQSWYEHLLHNIEEELHIDLLEEEKQDLRFKIEDSLEPSDSEIEKSLVGNAFSRIFAGQINSVYDDVEAEISLYVQGKSKNVMFHRNECKAYRSEIELLEDAIYVDDPFLIDKCFQMRLAVLGIENNPLREGLLKYLETDERPGVIEGLEIKRKMAEIFS----------MFQRIVPGNLTRNRRRFVLETEGQDQPLNVENWSAGMKS-FAILKRLLENGTLHEKGVLILDEPEVHLHPEWQLRYAEILVLLQKNLTVLITTHSPFFL 360
314 6.000e-19gi|336316861|ref|ZP_08571750.1| hypothetical protein Rhein_3173 [Rheinheimera sp. A13L]  clstr ali  13  3LDKLWISEFKNLKNIEIDFDEDELVTVVIGWNGAGKSNVIEALVIIF-----RELDLHKSPTFSYRLEYLCRGNRITVEALATEIKKEQYNIKVVSKEGKLVTDKAGEFFDDEQRRFLPSNVFGYYSGPSDRLATHFYDHQRIFRDQLLYPNKYGLDEKTLPLRPLFYAQKVHSNFVLLAFFLSSDEKVTKFLKEKLFIEGIESVLFVLNKPDWTSKEGDSRFWNANGVVMPFLDRLFSASLAPMRKTIKHPMKKSPENVDALFLYLKDLSALKQVGKDTSDKDFFKLLESIYFSNLIFEVRIRVKIKNKNGSDDSLTFRELSEGEQQLLTVLGLL--RFTRDDESLFLLDEPDTHLNPAWSMEYINFLQEVADNSHIVLATHDPIVI 399
315 6.000e-19gi|359455895|ref|ZP_09245100.1| hypothetical protein P20495_3879 [Pseudoalteromonas sp. BSi20495]  clstr ali  15  70MKKLNLSQFRQFEKISVEFEP--QVTILVGDNGSGKSTIIDAIAKSL------------------------KYLAATIIKENASRSSLDDRDINVDELADIATAINLLAVEDGQYFEHTLSKGKRSKGESNHAPITILGDIYRNFDRV--NNQSNLPVIAYYSIDRANEIAVDISKTAEKKAEKLSWSKFDGYADALKNSQNFTNFLAWFILCDKMAKQAEVPLARITQLHDELKTINEDILKADGNLLTYLEKDRQKKQKELSELELSVVNSEAGLCLNMTNQVISAIFIPEINSISIVHANGGIDMKIEKSGAMISVFQLSQGEKSLLALVGDLAKRMIMDGNGIVLIDEIDLHLHPRWQQQVVSKLLTTFKNIQFILTTHSPQVL 440
316 6.000e-19gi|421743690|ref|ZP_16181733.1| putative ATP-binding protein involved in virulence [Streptomyces sp. SM8]  clstr ali  13  28LQHYTVSKLFGHYNH-RFSLDANEPTLLTGANGTGKSSILRSIHWISRGMLHQLTKIDFEIMRLEFEDATLTIKKEWNLEVRLDRPGRRPTIWLHSPDMDDSRRSEMDYMRLREELGEDWDEMNPATRRRLITRYTWVRKLHRSFPALFISDQRLTPERRRRPKIRGEGDTIGTVAAIEAAVAHINDEVQRYKSLYGTASQNLDRDFPRRVFRAISSQRLEEFQQVQAIRSSLDTGLIGPAEIEDSITDLPLNNADLVALIATYLDDTKKKLATFEPLRLRLEPFMDFLRRHYKGKEVWIDDENGFKIQSTRTREDIRPVHLSSGEQQMFILAHKLLFESAP--GTLVMIDEPELSLHVLWQSTFVDDLTEISSGTYFLLATHSPTLI 434
317 6.000e-19gi|209549897|ref|YP_002281814.1| ATP-dependent endonuclease of the OLD family-like protein [Rhizobium leguminosarum bv. trifolii WSM2304]  clstr ali  18  8IRELSIDNFRCFSAETINLAVPNGLTLFVGNNGTGKTSALEALDYLFGGRY----------------KAENKLSIKDFNDFVKPISIAGKTDRFSIKSELEYYKGKYFNCVGLKFSAEPRDRKQPGKLLSSTISAKSHFSLDENA---YYNESDGQPHLQTRTGDTKNVDPRELTLDTGKVGPNGVNVFYFDKNRARHLVSGTYRTTFDAICDDLNWRYQKKLREEEASADYASKVTKEIFVWALDTAQKG------------------TGAKLSEQFSDFFDNAHFKNLRLELLSLLEPFSSAFLAVRAEDQIQQVTTRSLGSGVELVLALLLQRLLSDTAKGDKILLIDEPEMHLHPTAQKKLADLLLEEAKTSQIVVSSHSPYLL 363
318 7.000e-19METAHIT MH0080 GL0053745 [Complete] locus=scaffold92609_1:3045:5036:+  ali  16  3IKKLTIKNFRAFDEDGITLQFNKGVNAIIGENNSGKSAVMDAIRIAYSTVTYKKDIFFTRADFHVSEDG----NAADFALFDIYLEEVPTRLVEIWNPESVGGQGGEFHIRFERVIAANGIEKVRAIHWGIGTEGNPLSSDTFDAMDVMFLGALRDSENEMKPARNSKLAQLLRSLVPDEVTRAELVDILNSANKTLLEKEELKKTRKTINDNLARIEQDFLSQHVDIGLIEPRFDSIASSLRAWVKPKWILVSISDGEYSRAQQYAREHED------NRKIQQNENGIYFETSILENVEDMALELVTRINEISSSFELYQNGLGYNNLLFMSAVLGDMAIERGGHLLLIEEPEAHLHPQLQELVHTFLSDTNQNIQIIFTSHSPTL. 386
319 8.000e-19METAHIT MH0074 GL0108857 [Complete] locus=scaffold12702_3:11737:13185:-  ali  14  3LNKIEIENFRCFQHF--ALEFAPGATVLIGRNGTGKTSLIRSITNALSF-------IFATSKDPKINEVLVAGNPDLKIANISPSEVWWDETERTSAGFVSIKSEANFEGEELSWELMKPSTSNSGLRTGLYQNAYNAFVKRYNITGKWPLLAFYSDSFPNVVSRISKFAKDMLAKDGISLRNFGYYQWDDETSCSSIWQIRYQNCYTKWLTNKQQEELVANEIKVLKNLDKYTVVELEKKEKELAALRTETEGNFREWNTILTCLKRFSEVKTGYTDSTFEVKSLQS-----------EQRGTEWKLVIKMDDKSIIFDQLPAGYKRLYYIVFDIAYRSNADSSGVVLIDELDLHLHPSLEQEVLQRFMNTFPNIQFIVSTHSPLVI 375
320 8.000e-19METAHIT MH0081 GL0105276 [Lack 3`-end] locus=scaffold8221_3:1572:2624:+  ali  15  1...........................LIGKNDVGKSTILEALDIFFNQSKIDSVDRNVFHTGEETVIGCVFDDLPAEITLENVTTSFSKEYLINRDGNLEVLKKYPTNG------------------------KTTIWIYANHPSNDGFNDLLLKKNNELKAMIRAAHLEDGVNLSINSAMRAALWASLGDTITFEVREISADQADEKKLWPKIE-PLLPSYRLFKADRPSSDEDQEAQD--PMQHAMKTALEEQSEQLNAIANEVQRKVSEVATNTIQKLREFDPELAATLTPKFKKEPTWEKAFSFSLTGENSIPLNKRGSGIRRLVLFSFFRATTESEGKNIIYAVEEPETSQHPDAQRMIVNTFKEMTEKNQIIITTHVP... 336
321 9.000e-19METAHIT MH0069 GL0014364 [Lack 5`-end] locus=scaffold3806_2:318:722:-  ali  23  14..........................................................................................................................................................................................................................................................................................KTRFQDLMDELFSETGKSIIRKSNEIQFVQDGDILTPYQLSSGEKQMLVIL--LTVLVQDNEHCTLFMDEPEISLHVEWQQKLISLIRKLNPNVQIVLTTHSPAVI 117
322 9.000e-19gi|384068669|emb|CCH01879.1| hypothetical protein FAES_3873 [Fibrella aestuarina BUZ 2]  clstr ali  34  3IKKFNVKNYKSIVDSGDCYLEA-DMTILAGKNESGKSSILEALHDFNVSNSIDRSSVPLDKRPEDLAISITFLASENEIKDYLGIRAVSFENGWLEITVTKDFYDRYFIQKDLLSFLKLVDIHSPEYLKKEKELLQDSYNEFKDIYEEFATSINLTDLFRENLQSEIEALVGLKEEDNDDTTQSTLSSYIKILSNFYNVLSIVLDQEQSNKEQWDKFLSFLPNFIIFKSFEDILPNSISFEKLKESPFIQDLASVSSIDVELLLSSDTRRKIKHKGDINFNINTTYSTYWNQDKTELKIDWDSNDLTFWVEEESELYSPTQRSKGKQWHLSFYLKTSARTIDNKTNILLVDEPGLFLHAKAQRDIYDRLLNTNQNIQSLFTTHSPYLI 401
323 9.000e-19gi|387131968|ref|YP_006297941.1| AAA ATPase [Prevotella intermedia 17]  clstr ali  15  3ISKLKLKNFRSYRSVEISF---ENLTAFIGRNDIGKSTILEALDIFFNEGKGVVKLEAND------LNTEAKGQDEQYIEITVCFNDLPTEITIDSTYLTTLEDEFLLNEDKELEVIKRYP----------LKGLKEQVYLSAYHPSGQNCSDLYTKKSSDLKKIIKDADILCENNSVNAIMRSAIWKHYDASQHRKLRELDLAKEDGKNIWEKI-KEFLPQYSLFQSDRKNSDNDSEVQDPLKEATKEIISSSNLETQFNQIATEVTKKLREVANSTLSKLKEMNPDIAEGLEVKIPEVKDLKWFKSVSIEGNDGIAMNKRGSGVRRLILLNFFRAKAEEDNRTLIYAIEEPETSQHNEHQKILIDALKNLANNRQIMLTTHSGNIV 378
324 9.000e-19METAHIT unmapped GL0190773 unmapped_[Lack_5`-end]_[mRNA]_locus=C220014979_1:1:489:+  ali  18  1................................................................................................................................................................................................................................................LFQLQRKYLDYQVNIGNRMIQLLQSGEPDAAAKA--QALSQPKKLFQDIIDDLFKETGKKIVRDANEICFSQIGEKLLPYQLSAGEKQMLTIM--LTVLVEDGQPYVLFMDEPEISLHFEWQKQLINLVLRLNPNVQMIMTTHSPAVV 144
325 9.000e-19gi|422696339|ref|ZP_16754301.1| RecF/RecN/SMC protein [Enterococcus faecalis TX4244]  clstr ali  22  3ISKIKLTNFRCFQGTQTLEF-CEGMNFFVGNNNSGKTTIFKAIEFIQSGKTKENWISK--DKSSEHVSVEIEFRGDDLDSLIQNSSLKKYSSYLSEDKKLIIMRSSEPEWTDSKGKTKCLELKNIRIFNPSTKIFENPSGIDSTITALFDAQF----VYSDLKNEDYQDGKTKIVGKLINEVTKDFQQ--DESWRRLQEAHKNAFGINGLASTLKKIQKQLEEILEDQYGKTKVEFDFGL------PGIENFLKTGNILLE--------------------------------------------------ENGVKTSVSEKGTGMQRALALYSQIDRNNKESKPILFFIDEPETFLHPQAQDKLLDSLTEIANTSQVFITTHSPYLL 333
326 1.000e-18gi|424043424|ref|ZP_17781062.1| hypothetical protein VCHENC03_4022 [Vibrio cholerae HENC-03]  clstr ali  15  3ITKLSLVNYRNFNNVK--LLFNKGINTIIGENGSGKTNLFRAMRLLLDSSMPRFATKLAEGDFCRALGDWWIIISLEFDDIAGDEASQSLFLHGVGNAEDEVVSTYNLIFRPKAYVRQALAQLPIGELAALESYLGTITIDDYETVLTGKSVANFNDPSVYKSIVGDFERVDFPTALNNPAVGIRLPNILNMPNEVSFTFIKALRDVVSDFNSNRTNPLLTLLKSKSGDITQSDFQPIADLIGTLNNEIEGLPD--------ICAIRDDIVTTVGDTVGDTYSPNSISIRSSLTDESDQLFQSLKLFVSESSDGYEGAIHEMSLGGANLLYLTLKLLEFKYQKANNFLLIEEPEAHIHTHIQKSLFDNIN--YENTQIIYSTHSSHI. 386
327 1.000e-18gi|225871678|ref|YP_002753036.1| RecF/RecN/SMC N domain protein [Bacillus cereus 03BB102]  clstr ali  15  3ISRLTLKNFRTFKNETTV-QFHEGTNVIVGHNNAGKTTIIKALELLFDANKSKRLSIDDFNKNTTCDQLKESAPKITISATLVESEKEEIYSDDLVTVSTWLTKLEKPYEAKLTYEFFLPEKELEDYYNDIRKIEGT----------------NINDYWNEIKNNYLRKYVHKIYVGNIENKNLIDTDSINKFAFQFLTAIRDVERDLFTGSNTLLKEVIDFFIDYEIKTDISITDXXXXXXXXXXXXL--FSKGAQSLIQSLQDRMREGKKHMLQYVENTGAAFDKMQPSFEGGILDTELYSALKLIVENETGIKLPAVNNGLGYNNLIYISLLLAKMQKDASGSILAIEEPEAHLHPNMQYKFLKFLKQNRETRQIFITSHSPSI. 382
328 1.000e-18METAHIT MH0043 GL0125175 [Complete] locus=scaffold74688_20:3:1313:+  ali  15  107.............................................................................................................................................................ETLSLRKDYIKAKPGKAPRVIPYKDLYDSFVEKFTATYLSEGSENNMPIFVNYGTNRSVLDIPLRIRTNHEFSQLAALERASENELDFRSFFEWFRNQEDIENETKTETKNFDYEDVS------LGCVRTAVCSMLDNVSDLKVKRSPLRMTVKKNGLEMRVDNLSDGEKCTLALFGDLARRIALANPSIVLIDEIELHMHPSWQRKILGALKSTFPNIQFIITTHSPQVI 340
329 1.000e-18Oral.Meta HOMD ptan_c_2_256 Prevotella tannerae ATCC 51259 [94618 - 95484] ABC transporter, ATP-binding protein  ali  12  4...........................................................................................................................NSATKSIMKYAEYIKKVDITSLWSGRKHIVWTLRPDVNVLSGRNGEGKSTILNKLVHYLHEAPQTGELQHVTRQGVRIDFHPQSADSVRYDLIRSFDRQIVQSEALSKITDQKLTELDWQLYLLQRRYLDYQVNVGNRMIALLTKSPEARQEAEEAAKIKTRFQDMIDDLFAETGKTIDRQSNELQFQQYDETLSPYVLSSGEKQILL--ILLTALTEDRQPYVFFMDEPEASLHFEWQKQLISLVRELNPRAQIILTTHSPAVI 268
330 1.000e-18gi|307353163|ref|YP_003894214.1| ATP-binding protein involved in virulence [Methanoplanus petrolearius DSM 11571]  clstr ali  14  165..EIEIFGLFGKFDYRIPLENPGNISIITAPNGYGKTTILRLLRAVFVGNLGEIRDIPFKALKILFGITGTVSEPEKMTTLIIEKLNFRLEKSGNSVLEYTVNPDNFDEAETSWELSRIIPPVPVKLISAQRLWQNAESDILREGDLLASHAGGIRRSYELTVLNYSDDIRMRIQAMLNDYAASA-QELDSTYPERFMDLCQELDNGVLPGAQQIIEKLSKIRLEQKKLREVGFLSYEPGEWQDNFITGEDIEGDTGILAALQLYAEDIEKKCLIFGDLERKIDLLIMIINSLFLNLSFEIRADKGFNFMVADNEPVAPEKLSSGEQNQLVMYYDLIFST--DPGTLVLVDEPEISLHIVWQRLYLEFIRKIITGSGFLIATHSPQLI 566
331 1.000e-18METAHIT MH0040 GL0119707 [Complete] locus=scaffold26589_1:1485:2822:-  ali  12  3IKRITIGNFKNLAETT---LDLTRMIALVSTNNYGKSNLLEAIRFGFDFISASPKERNTMMRWRRGIPLSPELAGKEYKFV--------VEFDDPELKQYRFVRYGFSFIWYNDQETGAVITDEQIEMRATESVRYTAYLKRDKGQYRAGKPKTGFRKIALAEDVLAVDIISSFDDVEITSVIRKIKKLGYRMCNTLELDRSFRPN-----PIEFEFDAKSELAFDDNDIPRALSVLSKERPEQFNLFIETIYDLFPEFEQVELSAYSLKGQTQAFKAYIVAPSGDEAVEAQEELPYHVKDELYRLIIRSKYLNQPISMEHMSTGTKRVFWLVANAVFGGSYHTN-VLGVDEIETSIHPKMIRRLLEALSEILEGTSLIVTSHSPYLV 374
332 1.000e-18METAHIT MH0077 GL0151898 [Complete] locus=scaffold84393_2:3926:5827:+  ali  16  3LKKVTIHKYKSFLTEQTYEVE-SQITRIVGKNESGKTALLEALAKSNYFEDNTEFKFSKDLDYPRGELTKVRNENPAAITCEYELSDEDIQKIEDDFESGIIQKIFSVTSYYDNTRTTTGVSVDFSVFKDWLIKTFGVGDQGKEFINEADSFSNLEDTVTENSTLPGMKEIETELEKIKDASGGCKNSLEGYIYRTFISPAIPKLWYFSDYFSLPCRINLNDFATGKPTGSLSSEEYKIAKALFELSGLQIDDIQSESNFETFKAQLEATSNSITDDMFEYWTTNQNLEIRFDIEHAANNVRYLNIRIYNSKHRVTLPLKNRSKGFLWFFSFLVWFSKIQGDKNKYILLLDEPGLSLHASAQNDLLRFIEKLAPEYQVIYTTHSPFMI 392
333 1.000e-18gi|86130660|ref|ZP_01049260.1| hypothetical protein MED134_07054 [Dokdonia donghaensis MED134]  clstr ali  14  3LHRIKIQGFRRLKDVDITF---GDATFLIGHNNVGKSSVLKAIGILLSGSKTLDSSEYYSELDEESGESIPIAKK---IVLEAEFRNVPIEAKTWRGFKGRILNYESEDETGLSLVYKRTYPIGGTAIPELQTKVRTLKEEFKK-CVTWQDYIDVGVPQEVVEGESDDLTKKVGKSAKALKSLENFDEIWDVSNELAWVTNPIMPIVINKLPRYLLIPIDTSIAELQGSGTGVLSKTLKSLFDTVRDKSDNFLEAQKHLKLLSDEMDPNDEGSEFGKMMIELNSVLSSVFPDTALHASTDLSNPISSIVEMSSNIRTSIENQGTGMVRAAVFGMLRFHEDAQDRSLIICFEEPEIYLHPSAANQMRDAIYELSSNSQIIASTHSPYLI 398
334 1.000e-18gi|427703025|ref|YP_007046247.1| hypothetical protein Cyagr_1764 [Cyanobium gracile PCC 6307]  clstr ali  11  3IDWLWIDEYKNLRDLTINFSQDHLITVLIGRNGTGKSNVLEALTVIFRDLLTNEKIPTIKYRIAYEIRDRWMFIDADPKVSYKAKTIRKSDQQKPYPVGASFDDLGGAPISRSKLVGEKSEHLPQFLFGYYSGENKRIKPLFYPYLRGYDFKLRGGINPKRMFFAEPVHSNFVLLTFIVNNKRQTEDFLQKRLGLEEGGIESVLFVLKQPYWYKKNAADGDKFWNSRGIVRDFLARLYELSLAPIRIRRREVYSLGRSRTLEYLYLFLKDIDALKELSKEKTFAEF--FRDLESTHVSDLIDEVRIRIKLKKNDGSVTFRELSEGEQQLLTVLGLL--QFTSAEESLFLLDEPDTHLNPRWSVEYLQDIRDINQTSHVLLATHNP... 395
335 1.000e-18METAHIT MH0036 GL0040565 [Complete] locus=scaffold23700_4:753:2951:-  ali  11  21LKYIQIVNFKNLK--TARFEFAKGANTIIGENDSGKSNALTAIRILLDDNYYYNTKRLKETDFSYALGDWRGHW-IIISAFFDEISSEDKSNEFCAELTPEQENIDFL----KSYIRCADKEFGTVSLFIRPCRAKRAELAEAAQNGTFEAVRSQIKLSDYEFYYTSRSQADFTDENVYKSIVGDICAGQYVNPEDDDQSVLGSKIDIMNVWQHISTVFIDALRDVESELRKPKNPIRQIIDTIEGNIEETDIDDIKRKISELNQKISHIPQDIGSQVNKKLLEMIGAIYSEIKLESRLKEDFATLRYLTISPSNQKDIDLLGLGHLNILYILVEFEVNRNRELLNIMIIEEPEAHIHTHIQKTLFNNLQVTHTYTQVVMSTHSTHL. 407
336 1.000e-18gi|223040583|ref|ZP_03610854.1| SMC domain protein [Campylobacter rectus RM3267]  clstr ali  17  42IESISIKNLLSFNNEG-ISLRLNKFNVLVGSNGCGKSNFIEAISLLQSAPGYLASPVKDNGGI---------------------ITWLYRGETKPTAYIEVVLDIKGAKHDIPIRHHIAFNETGNKFDLQDESIEDSRSYDGSKDRPYFYYRFRHNHPLLNVKGKERKLQRVDIDPE-----QSILSQIKDPDQYPEITQ----------ISKEYQKIRIYREWTFGRYAMPRQPQMADMRNDYLEENYRNLGLILNKISAHPLLKKKLLEKLRALYPRFE--------------DYGVIIEGATVQIFFNEKNYSIPATRLSDGTLRYLSLLAVLY---NPYKPSLLCIEEPELGLHPDVLPIVAQTLKEVSEDVQIVVTTHSDEII 375
337 1.000e-18gi|119357962|ref|YP_912606.1| SMC domain-containing protein [Chlorobium phaeobacteroides DSM 266]  clstr ali  16  2IQSIRLDNLLSFA-SGSPALELKNLNVLIGTNGSGKSNLIEALALVRPRTSSNDDFQRTISRGGTISEWIWKGDANRPATIELVLDNPYATQ-----------------------------SNHKQPLRHSFTFKGEQQRVIFVDERIENKAPYPDQPFNQYFYYRCYKGNPLINSAIGGERKLGRDSVSSELSILAQRRDPEQYPEITWLADQYEQFSFYREWTFGRNTVFRNPQRGDLRNDRLEEDFSNL------------GLFLNRLKTHKPKAKSEILNGLKELYNGVD-DFNVNIEGGTVQLFFTEGEFAIPATRLSDGTLRY---LCLLALLCDPDPPKLLCIEEPELGLHPDILPKLADLLIEASQRTQIIVTTHSDILV 345
338 1.000e-18gi|57641330|ref|YP_183808.1| ATP-dependent endonuclease [Thermococcus kodakarensis KOD1]  clstr ali  16  3IVEIEVNNFRSLR---AVKMPLDELTVLIGRNGAGKSSLLQALDLFFNPNAKYSEEDFYNRDTSKPIRIAIKFRLEN-DKEREEFQKYVINEDNDHDYIKVVKIMKFPASKSNQSYHGVVKSIPQ--FSNLPSRKEDLIERYKGLQKEFPDLPHLGSKTKKKILEALEEYKNSHPEKWEETLQEDQFFGYKEVGHGKI------DKFIKFLLVPAVKSVSEETEYKKGSIITELTQLIIEEHIRSIPEFNRLEKRYKHLLKSLEAHRKTGKDKLFSELSNELTQILEKFAPNTQANIDFKIPLPVPTVLVTEDGFETSAERVGHGTQRLLQYMTAKRHELNKMKNVGRDSDEKDLYQHPQRQKHLHKLFKDLAGNIQVMYSTHSPFLI 409
339 1.000e-18gi|326385841|ref|ZP_08207469.1| ATP-dependent OLD family endonuclease [Novosphingobium nitrogenifigens DSM 19370]  clstr ali  20  3LKTAHIQNYRSIRDTGVFEIEAGK-TILVGPNEAGKTAVLQALQQINPPKGIRDYPRAKYNDISPVATVTFTLDEDDLAALPESMRGI--------------TGYSYTRYISNNGSHFL---IGAPALPTVGAIRKDAVRLAAHVDGRTPVAEGAAPSTAQVLNSLLQEWRDELSSELSGALKQWVDALADDSEDARIDRLLAAFSIAGDRNAALLQKRIPVFVLFSNY--FRVRPLIHLGLL................................................................................................................................................. 249
340 1.000e-18gi|423201808|ref|ZP_17188387.1| hypothetical protein HMPREF1167_01970 [Aeromonas veronii AER39]  clstr ali  24  4ISELEIKNFRSCKNTK---IKLEKFTPLVGYNNAGKSNILKCLDALVRGKGQTDSSFNDTKKPIEIIARLVGLSDKALSHLSEKVSLEPYIVDDSLDIRFFQEKPGTAKNAVVLGIRSPLNPNGEGLPQAVTTLFPEPTFINSMEDSAEDVSKFKV---GNTIGKLISNLQKEILKTKGEEINTALSAIGKKL-------------------NLNGDERLQEFSEFDDSINGKIGDFFPGLRLNLDIP----------------------------------TPDISDLFKQGNIKVTETGNQRSTDFSDMGHGAQRAIQ---MTLIRHLAEITK--DVSKEGKTNLLLIDEPELFLHPQAIEQIRGSLKVLAEKYQVVFSTHSPFMI 335
341 1.000e-18gi|407016433|gb|EKE30152.1| hypothetical protein ACD_2C00035G0001 [uncultured bacterium (gcode 4)]  clstr ali  21  3ISKIIIENFKSIEDIKKYWTSYT--TMLLWVNESGKSNILEAMSFLDTPKSEFDYNSIHSQKDEKNSPLDFERDDTYQDVIKKEVINGWSLSFKIDNVIKNIYQDWETYFSENIDF--EIKNLNKNLFIKQVQKNEVINGQTTTINKYEISEKNDTLTYKELTDVLFKNYFGDI-----------IIKLIKKFEPKVSFWKPSDKYLISDVDLNVFKDDID--------SNIPLKHIFALWGYIWKEKIKEIEKIANDLI----------RRKLMSSLSKAVTKYVKEIWK-HKIEIDIEIKNEKCVVCIKDEGENYKMNARSEWFKQFMSLILSLSIETKKNKNKLILIDEPEAHLHPSGIRDLKEELLKIGENNYLFVSTHSPFLV 377
342 1.000e-18gi|421182740|ref|ZP_15640212.1| ATP-dependent endonuclease of the OLD family-like protein [Pseudomonas aeruginosa E2]  clstr ali  18  3IQSVRIKNFRTLKD---VTIPFDSVTTFIGPNGAGKSTVLRALWFFNGKPGSLTDKDCSFGAIDEDIEVQITF-ADLTEKDREALGKYAPEGAATFTAWKRRGSDGAESLSANSKSYPPFNAIGKGSAAEKKAAYNELRTSDASPGLPAWSSVDAA-------FQAMTAWEADHIDQLVEA---------PESLQTNFFGFNSGGKMSGLFDFVLVTADL-RASEESIDGKSSIIGRILERSVDRAAADEEIAKIVEESRAKQQQVYEEKFKEQLDVITTQLNEVVASYVTVSPADVELKAPKTTFEVAVLDGATETAVERQGHGFQRTIALQLLAQSGAASAEGVICLIEEPELFQHPIQAQAFAKVLRSLAEDIQVTYATHSPYFL 384
343 1.000e-18gi|294648808|ref|ZP_06726265.1| ATP-dependent OLD family endonuclease [Acinetobacter haemolyticus ATCC 19194]  clstr ali  23  4ITEVAIRNFKSCRET---VLKLESFTALVGYNNAGKSNLLKCIDALVRGKA---QDGNSFYDLKKPIEIVALLE----GLGDESLAHLSEAQVNSLKPYLEEGKIRIRFFQEKEGTGKNAVVMGVQRPSQNDDNWNNPNGLPQAITTLFPE-----PTFINSMEDAAEDVSKYKAGNTIGKL---IAILQKEIIATKVDVINDALQVIGSKLNVDGEERLKDFEEFDKSINEKIEDFFPGLKLNIDIP----------------------------------TPDIADLFKQG--KIKVTEDGSQKKTDFNDMGHG---AQRAIQMTLIRHLAEITKDVSKDGKTNLLLIDEPELFLHPQAIELLRASLKSLSNKYQVVFTTHSPFMI 335
344 2.000e-18gi|408370535|ref|ZP_11168311.1| hypothetical protein I215_06502 [Galbibacter sp. ck-I2-15]  clstr ali  17  3LNKLKLKNFRSY--SLETEIDVSDLNVIIGKNDVGKSTILEALEIFFNGKPDKHDLCISNDNSQIEITCVFDDLPDTLILDDTIETSLKDEFLLNVSKKLEIKKKFPVSAAGSISEESVIICEYPDNENLTDLLSKKRTTLKLQFEELDINPEGVNRRRSKELRNAIRNHFFTDGKIITQTTEIKIDGKLDNEDNRKKIWAG-------------LKKYLPIYSLFFVDKPLTDQDSDIQDPMRQIIKEVLKRDHIKPLLEQLKEAVQNASTSLADDTINKLNELDSSLAETLRSNFPKEPTWNSIFKLTLEDDRGVPLNKRGSGMRRLVLLSFFRARRTANAPNIIYALEEPETSQHPDFQLMIVNALGELSENAQVFFTTHNSNL. 380
345 2.000e-18gi|428313490|ref|YP_007124467.1| putative ATP-binding protein involved in virulence [Microcoleus sp. PCC 7113]  clstr ali  17  3INKLHIQNFRCLKRIDFNF-TPDNIVVIIGINGAGKSSVLDCIASLL----------IQLETRIIKIEPFEYSEIDSININQKINSFLTVDDINDNAKQVDVSIEISTDFNDSISWKVTRSLIEKGLEGDYNQLNHYIEYLRRKLESNSNFNLPLMIYYRTRRITLDSKSRIILDTK------------------------SIDLDNLDSKVYPFKINQLSAYSGSFNPEVNNFQRFFTWFRQEEDYENEIRLREDDKYRNPNLEVIRKALERFLEGFPSSHFSNLRVVRSTSQRNLNFNHSRIPSFLTITKNNQDFKLEQLSEGEKMLLMLVTDLARRLSIANPGIVLIDEIDLHLHPQWQRMVIPSLTQTFPNCQFIVTTHSPQVL 365
346 2.000e-18gi|260773571|ref|ZP_05882487.1| hypothetical protein VIB_002045 [Vibrio metschnikovii CIP 69.14]  clstr ali  12  5..KLHIRSFKNLENVTVDFDEDHLMTVVVGRNGSGKSNVLEALVAIFRNL-----DLGEVPPFSYELVYRLGEPHKPKQPSERWLEITIDADPTRGTTAKQYQVHVRDLLADDTDDDMFGEKPSGSAIPFSKVKRDKEGKAPYLPNYVFAYYSGPSDRLENHFKKHRTDFYRRLLKDELDLKGDIRPLFYAKPHHSQFVLLAFFLSEQDSAEKAFLREHLDIEGLDSIHFVMRQPGWAKQKGELFWGARGVVRRFLDELIKYTLSPVKVTRQEDTSLTGSNIRNEFFHLFLSDSTLLSEIISEVSIRVKVSSSKEPLTFRELSEGEQQLLTVLGLLKF--TGGKDSLFLLDEPDTHLNPSWAVKYLKFLSEFVPNSHLLMVTHHP... 405
347 2.000e-18gi|427706917|ref|YP_007049294.1| AAA ATPase [Nostoc sp. PCC 7107]  clstr ali  12  3IKQISVNGLFGIFDHVIPLNMDERITIIHGPNGFGKTAILRILNSFLKSRDSELLTIPYKNFRIEFXXXXXXXXXPNNVDNAEDFPGEFKRYNILFNLDKNSKMVDLQQKPESLEELKKNINIRLIESQRLLNSVPKRSRRQSAETHSMVSTVSAYSDELARLMQRKFREYATISESLDRTFPIRIVKHKPSADVSNEQLRHKFSELEATRSRLVAVGLLDKDENSEVQIQPQDIDESTKNAL-----------LVYVEDMEKKLSVFAEIASKIELLKKIINNKFAYSYKEINFSKEKGFIFTTFYNSSLSNSKTLSAMDLSSGEQHELVLLYELLFKVQPK--SLVLIDEPELSLHVGWQVQFLKDLREITQDLDILMATHSPDII 379
348 2.000e-18METAHIT MH0033 GL0057156 [Complete] locus=scaffold3317_1:1530:3119:-  ali  14  3LKRMTLENFRGYK--SPVSVTFDNMTAFIGKNDAGKSTILEALDIFFNDGKG------LIKLDKKDINIDNQGTDLNEIRISLSFSELPKKIIIDETNETELSKEYLLNKYGELEIIKLL--------KPTDGKPTVKTFIRANHPANPNCKDLLLKKNKELAKITTELGIECNKVKNAEMRAAIWKYYHDDLQLEEYEIDVSTKDSDIKSVWEKLQTYLPYYSLFQSDRKNTDSDDEVQDPLKEAVKQILSSEELREQLRHIAEKVKRKLQEVSDLTLEKIKEINPEIANTLHPNIPESLKWGDVFKGLSIYGDDIPINKRGSGVKRLILLNFFRAQAEKKKDEIIYAIEEPETSQHVEHQNMLIDALNSIANDIQVILTTHSANIV 383
349 2.000e-18gi|300777524|ref|ZP_07087382.1| SMC domain protein [Chryseobacterium gleum ATCC 35910]  clstr ali  11  3ISQIKITNFRNFENTTVDF--NDGINVVIGHNNAGKSNLVSALSLVMDNSKSKRLNIDDFYKLIP-----TAHLLTSPPKVSIEITIKKGSYETEDDLVTVSTWLTRLEEDYEAKLTYEFFLPEKHVENYQTLVREIPENENQNKNIWNTIKHDFLRLYVVKIWGGNVVNQSTADVDSLQKFDFQFLDAIRDVERDMLTGRNTLLRDVFDF-------------FMDYDIKIHPTKTAPEKHMDIKERKIEFSEKAEELVGLLHRRIASGKEEILSYAKDTGASFNNAVPDFEGVISETELYSVLKLIVEYETGIKIPATRNGLGYNNLIYMSLLLAKMQVNNDFSMLAIEEPEAHLHPAMQFKFLKFLDENKTKRQIFVTTHSTHI. 382
350 2.000e-18gi|254507673|ref|ZP_05119805.1| ATPase [Vibrio parahaemolyticus 16]  clstr ali  14  94IKEINIENFRNF-DSLFLSDFDPNINVIVGTNGAGKTTLLDAIDTSLS----------------------WLRNSILKTGGSGNYISEKDINLYSDIPYATISSVIEVNHKIDVPLEISKSREGTAKRRNQLLAHRTIGEFYKIANEKNPTFNFPLLAYYNVMRSYDVNPRDISGHDEVIGFDKFEGYRNSLNGKTDFQSFFNWYKRLDDILARRESNVSKATVLKELGLTPSLFEKLEILAEHDEETRESLEVIRSKFPDEVDDILDEDYAKQAKLMVNQAISSFMTGYSNLEVQLE-----PFVDLLIEKNGRKISVLSLSQGEKTLLTLIADLTKRLIQLNPSLILIDEVDLHLHPKWQRKIANNLKKTFPNCQFFLTTHSPLVL 462
351 2.000e-18METAHIT MH0081 GL0104402 [Lack 3`-end] locus=C3746399_1:1:1179:-  ali  17  3LIDVRIKNYKCILDSEAFSI--DQLTCLVGKNESGKSAILQALYKLNPVDKEDTYDALYEYPKMYQTDFEAGLIEDGDTVVISHWTFTAEEIELEKQFGTDFIGDSTVVTISNGYKNKRTWDFDANFHALFEKKMEEFGFESSDRAQIPSYDAIGEVRAQLKSISTLSEAEQEFKIWFDAAFPNDRLDAFAEKNLLQYLPKFSYFSEYQKLPGRIALNNFVRKSSEGKLTANEKVFEALLSLANTSVSEIKESNKLEALINKTRGISSKITREIFTYWSQNKHLKVEFRYDMAKAGDEPPFNDGYIFIENTRHDSSVSFDDRSAGFVWFFSFLIWFNYLQKVEDNLVILLDEPGLTLHAKAQGDLIRYFKEIIPKFQLVYTTHSPFML 393
352 2.000e-18METAHIT MH0014 GL0038222 [Complete] locus=scaffold76339_3:1062:2342:-  ali  14  5........LKNIGKVEKASVEINGITVIAGENSTGKSTVGRALFAVFNSFHNVQKQIQNARVDSIENYLDRMCMTVGLRSIE--------VFPTNEIAKEIVSHIDAYRDLDLHDLQQKLVSLFSQYDEDRSKVIDRFIRDEIISRIKEILEVSDNSFLKSLLERKLGAEFNEQVCNIFSENDGEICLQIKDKPITVSIENTGTVDFRNSESLSLHTEVVYIDDPFILDNLREPRWRDSFSSMNHRYHLRAKLMQPKAETNVIDEIIVQ----------DKLNGVYEKLSSVCSGDIIIKERGFTISYRRKGSEKELDVRNLSTGLK-TFVILKMLLLNGTIEPNGAIILDEPEIHLHPEWQLLFAELIVLIQKGVHILLNTHSPYFL 367
353 2.000e-18gi|422869938|ref|ZP_16916441.1| RecF/RecN/SMC protein [Enterococcus faecalis TX1467]  clstr ali  18  3ISKIKLSNFKSFRGKHTIDLS-KGVNFFVGNNNCGKTTIFKAIEFIQSGKNKFDF-------------------------------------------------ITKGFETENVSVEVEFKGDDILSLLENKGLKKYENYVIDNGDGTHSIRILRSSEEKEIIQGTKKISLDISKIRVYNPCSSESEELNKFENPTGIDKTISALFDAQFIYSDLKNE---------EYHDFGFTKILGKIITDSTKGFQKGEIWKDFARAHNKTFGNEGLGNILAEVEVEISNVLKEQYGDGEVKFEIDSFYKTGNLLMADNGNYTTISEKGTGMQRALALYSGIAKNEIGSKPIMFFIDEPETFLHPKAQDKLIDSLNRLADKSQVFITTHSPYLL 341
354 2.000e-18gi|409095222|ref|ZP_11215246.1| RecF/RecN/SMC N terminal domain [Thermococcus zilligii AN1]  clstr ali  15  3LKKLVVKNFKSLRN---CEVELGKFNVLVGPNASGKTNLVEVFKLLRKIYFENDTNPFLEEELPITVEMFFDVGGYDVYFETTSFRILREVLEVRGYFRIEKEGRTLRVFHDAEFIKRALPKLKTKTPKGLTEAYDYFVKLDTEELLHLEAQLPSNYAGETLFPWPWRASAIFDENYETAYIITQILPLISPVVQGKWGTEPLAFELGGLLHETILPTLVLRQIYVQNVKEPKFSRKETTLSEDASNLVPFLYNIWLRE----------------GRLPDEIAKPLSMAFPHTRVFFQLTEDG-RVMMKVFDGDLELAPPGISDGFYKTLAILTAAYL-----KPPLLVIDEIENSLHPETLELIFDVLRE--SESQVIITTHSPVVV 388
355 2.000e-18gi|414077436|ref|YP_006996754.1| RecF like protein [Anabaena sp. 90]  clstr ali  16  7IHKIKLQNFLSYGNAGE-EIELQPLNVLIGANTSGKSNLIEAIGILK--ATPTDLPVPFRKSGGINEFLWKGNKDTPIAEIKITVDYPQKSESLLLDYTLSFTTYNQRFDLVDEFIEPETRKEGFQFY-YLNNYNGFRSFTVRDKDPLSGQERRSEQLLELHSIKSDQSVLSQIKDPNRYPELSYLSTEFSKISLYRYWQMGRDSEPRKAQPT-----DLPQHPLLEDTSNLGLFIKDLQHRIGIRKVIECLKK-----------------------------------FYEPAEELDVTIYGGTAQIFIREEGVPIPATRLSDGTLRYL---FLMALLLDPTPPPLICIEEPELGLHPDILPTIAELLIEASQRTQLIVTTHSDALV 349
356 2.000e-18gi|418018395|ref|ZP_12657951.1| hypothetical protein SSALIVM18_07751 [Streptococcus salivarius M18]  clstr ali  19  3ISKIKLVNFKSFKGEHVIEFS-EGVNFFVGNNNCGKTTIFKAIEFIQGGKNKLDFVTQGFETENVSVEL----------------------------------------------------EFKGADLSEIVNDENLNLSKYSDYVIDNEDGTYSLRVLRSSQECEVTQGRKTVSLDISKVRIYNPNSTEEDDIKRFENPTGIDRTITALFDAQFVYSDIKNEDYQDFGKTKIIGKIINDITKDFQKDDIWKEFQDAHKKTFGDEGLGKILKGIATKISKVLKEQYGDGEVQFNFGLEIDNFFKTGSLLLSDNGITTSVSEKGTGMQRALALSLIQVYEATPSKPIMFFIDEPETFLHPKAQDKLIDSLNKISEKYQVFITTHSPYLL 345
357 2.000e-18gi|222529581|ref|YP_002573463.1| ATP-dependent OLD family endonuclease [Caldicellulosiruptor bescii DSM 6725]  clstr ali  22  3ISKMRIRNYKSFLDSGEIMLD-EKIFAFIGQNNTGKSTILDAVKVFFP-------------------------------NYKKQVDKKDIHRGINDSIIIEMWLGGVESFFEN----TRTDEVDRQVEKLLSKADDNSLYIKLVLNIEDGTNKNIRKYFDKDGEEIKEATLKKLLPELV-----VIPAIRDPEKESTADRKSYLRSLIDILDSEYKTDIL--------IKDEGVEKRVNYSQLN-DILTKEARKRCESLSQKITEYYNSTLGNNNFRINLEPTVDIYSATKYNTSIVEIIGNEK-----IENDILNFGTGYQSVLILSILQTYVEIARSVGK---YIFVIEEPEIYLHPNLQRKMIETLINISERNQVIFTSHSP... 329
358 3.000e-18gi|282860277|ref|ZP_06269347.1| conserved hypothetical protein [Prevotella bivia JCVIHMP010]  clstr ali  14  4.......................................................................................................................................YANYIKEIEIDQLWSGTHHIKWKLHRKVNVLSGVNGVGKSTILNKVVRGLMHSENLMEQMPPGVKLKVDPSDATTIRYDIIRSFDRPLLNFESVAKMDANLTTELDWQLFQLQRKYLDYQVNVGNRIISILQSGDADAAQKAQEVSLKKRFQDLIDDLFAATGKKIIRSENEIRFLLLNETLFPYQLSSGEKQILVIL--LTVLIEDNLPYVLFMDEPEVSLHIDWQKRLVDMILELNPSVQIILTTHSPAVI 255
359 3.000e-18METAHIT V1 GL0014415 [Complete] locus=scaffold66057_1:65:1420:-  ali  11  5.....IYKLLGYHAVKEAEIKLDGITVLSGINGCGKSTLSRWLYYLING-SRDFDIFLLRDYKAKIDNLINRMRFACMDLGRFSQKSGLLEKGSLNTLLEVTEKMKQTRVHSYEQIEIVQDLFLQALYATENFLSEALTENLSEARKVRILNYLSVHNKQEDVRQSIENFVGQNNRLITQLTNQLVKNMNERPRSTYLKLIEKYFDIQHDFPLGIQLEEDEVNLLEDTHVSTLFNLQRAIYIDTPMAVEVEDTENIFWNDLREMMLDDKSGKNLSMGERKFLVRVKDLLNGETVLEEDDVFDEKSLRYISKDKKVNISLKDAATGFKA-FSYLQRLLENGNLNQETLLMIDEPEAHLHPQWIVEFARLLVLLNKGLKIMIASHNPDMV 387
360 3.000e-18gi|157368360|ref|YP_001476349.1| hypothetical protein Spro_0111 [Serratia proteamaculans 568]  clstr ali  16  3LESITVTGLFG-KSEVVHYEFHHDLNIITGRNGSGKTTILKLAWLIMSGNIYWA-----------------------LKEINFKICKLVTNEYTCVVTKTANMYCRIELHTSNGENHLFEDDGPNGENEWIESSENQAAPYLIS-----SGSSIFFPTFRRIEGGFSLDVTSRIKNRASNRPGGDIDEALTSLSKKMSNEEHLF--VAAISSQDINSILLKKFASLSEQINIFQAEVSRRVIDKIKHHQKLSSHASDADTILTETRIEIEKIETFRAESMRPLDAVRMLVEKLFQHAGISFDR---RFSFGDAAEAVTSDVLSAGEKQMLSFIC----YNAFHQNAIIFIDEPELSLHVDWQRQLYRILKKQNPTNQFIFATHSPFI. 351
361 3.000e-18Oral.Meta HOMD NCBIABEE_c_1_457 Parvimonas micra ATCC 33270 [433435 - 434991] ATP/GTP-binding protein  ali  14  11ITSMKINNFRGYN--KEINIKFDDLTVIVGKNDVGKSTILEALDIFFNDG-----------------KGTIKLDKNDVNNCEAKDGNNEISIGVCFEDLPESVIIDSAVETNLESEYLLNNEGQLEVIKKYQNGGSAKVYIKAKHPHNGKCSDLLLKKNPELKKMIKEEDINCDNLSVNSLMRKALWNKYSDDLQLKDCEIDVSKEDAKKIWEKL-TLYLPVYSLFQSDRKNSDTDSEVQDPLKEAVKQIIKDESLQKKLSEIADIVRERIKEVSSRTLDKIKEMDKDIANSLNPIIKDLKWQDVFKNVSISGDENIPINKRGSGVRRLILLNFFRAEENNDNANVIYAIEEPETSQHTNNQCKLIDSLKALSPKTQIIITTHSPNIV 388
362 3.000e-18gi|414078033|ref|YP_006997351.1| RecF/RecN/SMC domain-containing protein [Anabaena sp. 90]  clstr ali  20  3LHSLEIKNFRAIKDISLDFTDPRSINLIVGPNGSGKTSILDAIHVVV---------KVFENPQNPELREGLEYNVQQLVRGRANIAQITFEYSIEKDEAEAINDVYSSLGLKQNFNLSKSVAPLESPAKVIWYFPTRIPNNLCDHDISPKGSIRVLGARGRASQAISKNRQTSQ-----------------------------------------IFDRIGGVCYLDQRRTVRLFKSFNKQNIEDQNAH---SDVLSWLIEYYRKHRTWSEEKYGESYWKRVQRLFNKICFPSEL-IGLESGPDSDTLILKRKGVEYDLLQMSSGEHQILRILVGLAADT--AKNSIVLIDEVELHLHPAWQKRLIQVLREDDSNNQYIFTTHSPTV. 337
363 3.000e-18gi|406984222|gb|EKE05313.1| hypothetical protein ACD_19C00360G0002 [uncultured bacterium]  clstr ali  21  3LYSFQIKGFRSIIDTGECKVEIDNIVVMAGQNEAGKTAILEALDFFRNGPSESFVKYQKRLSCDRTEVIC---------------KFVLEPDDLHFNDDIVDKDKIDKYVNDNKYISFVRESLKEKVEN--IKITDESRLLLKHLFHEEKVEPPKTEVDSAASPSPAPSALPTSEELFDNTLSYLIESIPPFSLYTAFTDLLPSEILVTDLEQSNAVKDFEKVFSVNLAEYAQVTD-----PRDRKIKLEALENLATDDFN--------------QSWKQTISSIKDEKKYTFSIEIDNAEPKKIIFMIKGKDGTPLYLEQKSSGFRWFSAFHLRLRSLMKDSAPFIVLIDEPGQNLHDIAQKDVKKILEETAKNIQIIYSTHNPNLI 367
364 3.000e-18gi|289679652|ref|ZP_06500542.1| hypothetical protein PsyrpsF_40517 [Pseudomonas syringae pv. syringae FF5]  clstr ali  20  4LSKIHIKNFRSCK---QVILPLGDFTPLVGQNNAGKSTILDAIRLVLAPKAFAKTDANDQTQPIIISACVSGITEELIAQIPEAKHQAAITPYINGDLWIRISASGSTKPTTEVWGNADIDEQGLP-----TSWRSYPTGLPQAISALLPEAL------------HIRAMDDVQEDLGKGKAGSTIRGLLDEIMAPILTAHQEVQDALTAVRNILGSDGENRSPLLNEFDTSATNAL--------SSFFPGL--MLNLDVPSI---------------------DVKEFFKSGDLNVTDEISGQTRRF-----------DTLGSGAQRAIQMLIRLLADIRKTRDRLLLIDEPEVFLHPQGVRGLREALHVLSKSYQVVFTTHSPLMV 337
365 3.000e-18METAHIT unmapped GL0421693 unmapped_[Lack_3`-end]_[mRNA]_locus=scaffold296417_1:27:1244:+  ali  23  3LTELRIRNYKSISD--LLITDIENALILVGKNNTGKTAILDAIRVVTGSCAV------------------------EMDDFQEDYANIEISVCL---------------LLSDNDLKMLHAAGQISTYRRFDKWFQDFKRKLPSYD-----EAAQALSFTFIANRDGKIRYSDGYQKNNNWIPRLLPPVYYLDPQRNLRQFQDDLLLMQ--EDSLLKQMRSGCCLFDSAKCTHCFSCIGLINQKTPAELNAFEAARLLDYKL--------YQLNLDDFSRRVNANYRKNGGQHEIIYSMNRDIEQMEIADEKQKTLRPIEHMGKGMRYMLSL-LETYAEDDNPTPGIIMVEEPELFLHPKLQKLSGDLLFRLARKNQVIFSTHSPNLL 341
366 4.000e-18METAHIT MH0077 GL0135620 [Complete] locus=C4569077_1:526:1797:+  ali  13  12....................................................................................IVDKTFMTELRINHVRHLKDITIPLSNSQPKHLVLTGKNGSGKTSVLKSVVDFLAYVVSSNFYSQAACLESVTFNQKRLQELDNSEQDKQNREGIERDIASWTRFLDHWEYLSYADLREKYLKGEYILAYYGDDREIKVQISKNIEKVDLQDVYSLQDHPSKQLVKYLVNLKTTEAFA-KTNGNEARAAEIHAWFDRFQNVLRSIYSDDTLELKFDIETFAFTICQAGHD-PFDFTTLSMGYAAVFDIIGDLIMRMESKHEGLVLIDEIETHLHVDLQKKIVPILTQLFPNIQFVLTTHSPFIL 323
367 4.000e-18METAHIT O2 GL0088956 [Complete] locus=scaffold13884_1:1979:3952:-  ali  11  7ICRVHIENFRNFHS---ADFSLGEKQVLIGENAVGKSNLLYALQLILDPTLSEKDRMLEESDFWDGIENPM----DNGHYILIEIYLANFEDNKNLLAQLADASVMVEGKETLKISYKFFKKDATKPDYSYIIYKGNDESRAFTYEDRKMLNIRVIKAIRDVEAEMKSSRTSPLTQIIKQKYSVSKSVLLEISKALDEKGADTLQIGQVNDLENRLQRLLNDMVSFSADEFSISLKTMNIDATKLLYALRPLINSRETGNTSLGINNILYVALILLLIEDDTIKTFLDLYRELIKQDHEHLLERSYEKSASSDDYALNLAALQDATLYDGLYAFFSDFVPTANGITILAVEEPESHLHPIYQRLLYRHIMN-KTNTSVIITTHSTHI. 387
368 4.000e-18METAHIT MH0046 GL0099845 [Lack 3`-end] locus=C3114851_1:3:779:-  ali  15  2..................................................................................................................................KKQADYIKRIEIKSLWGRRKNISWELRPDVNILSGINGIGKSTILNNSVHMLDILEGKALTNHSQPGVSFVFSPEDATFVHFDVIRSFDRPLIDAGLLEKIGNQNVKSELDWQLYQLQRRYLDYQVNIGNRIIELLTSGIPDGQTKAAESYPKTKFQNLIDQLFSETGKKIIRKSNEIQFEQDGDILSPYQLSSGEKQMLVIL--LTVLVQDNQNYTLFMDEPEISLHVEWQQQLISLIRSLNPNVQIILTTHSPAVI 258
369 4.000e-18gi|423609785|ref|ZP_17585646.1| hypothetical protein IIM_00500 [Bacillus cereus VD107]  clstr ali  14  3IKEFTVRNFKNIGHAEPCTITFSDFITVIGENNIGKSSLLEALKLFLPDTPNTPTIDMFPFKEAPVSPAMYMEILVVFDDFNHADRNNRFIKPYIFDNEIRIRRIWTAPNLKDGDVPFEVYIPKRYISEIDMHTTWNTKVFDSVSDDLQEQYENYCHEKGITNGTIAKAKKDDFIEYVFLNKPALITEGEIEWMKNPNGFASNIRSVMPKVIYVPAVKLIDEEADANKNKSNQITSALFEHHLNQTPEIQEFRTALQSLKNIFNEETRHTEVLSLEGKLSRKLNRLMDIEANVDFDVPEVMEKLHLSIYLKHNNLVTLPSQQGNGVQRMLILSLLELMAEQLTQNSLFLVEEPEIYLHPHLQRKMRDSLVQISKHAQVICTSHSENFI 423
370 4.000e-18METAHIT MH0035 GL0030766 [Complete] locus=scaffold14662_3:1861:3204:+  ali  16  11LQSLELNNFRGVSHA--ILPFEGKSAVIYGINGMGKSTILQACNLLFFRIMCSITVSTLGSERVLQIEDSDIKIGEIFSKISMDVN--------------------------------------------IEEKNYHYFRKAEQNGKRVHSRAGAEELAKQIVCSYLGTYESVEEEETDDTDKGAQKKLVLNRNNMPIYALYGVNRYVADRINNKLERDDKLFGKLEAWRDTFDPTINFQLFFEWFRGRQELENSRKVEEETF-----------FDPQLSAVRNAILRILDNDFSDIKIKISDEDAQMVAIKHNTELSIAQLSEGEKCILAMTGDLARKLAIANPSIVLIDEVDLHLHPSWQGRIMPLLFRTFPNVQFIVTTHSPKVL 350
371 4.000e-18gi|365538910|ref|ZP_09364085.1| hypothetical protein VordA3_04278 [Vibrio ordalii ATCC 33509]  clstr ali  14  19........FKNLKNVTIDFEEQEWITLVIGWNGTGKSNVLEALAVLFRDLIMGKNDNGEKDKPSFAYTLRYFCHHKEIEKIENTTLQVDLFSELTDDATLVGLKFNEFKKRQDQFLPKYVFGYYSGHSDRLQSVFRPYLQQYDKKLRNSKSEDPGLRRLFYALPVHSQFVLLAFVLNQDDLVRHFLDTQLGLETDENAESIDSVLLELNEPSWNLNKGKAPKGTYGACKDKPDIFWGAEGVVRDFLNRVHKVATAPIKISRKDDATLWNKKDREYLYMFIKDVTRLTEFRDLESTYVSELISEVRIRVKLKKNDGSVTFRELSEGEQQLLTVLGLL--RFTAEEESLFLLDEPDTHLNPKWSVDYIDYLNKFVNNSHIVLTTHNP... 431
372 4.000e-18gi|239828524|ref|YP_002951148.1| hypothetical protein GWCH70_3230 [Geobacillus sp. WCH70]  clstr ali  12  6........FTNIGMVEKAEIELNGLVCIAGENDTGKSTVGKLLFSIVYALNHFE--EMFEQDRTHYLLNQAELFYFRLRRLIRLSDEDRLFFGVEFQHELSHWLNSEENVTEKLTATIEKRLLKLEHLHLDEEGKNLLADMLTETIDFLNVARDEEKIKQEAVEMVMRSEFQKSISRLNNENAESLVSITENHQEILRLALKNNRLTEFKLGDLYYKDVIYIESPFVFYFIDLLQRFMARRLMQRTNRDQSIPYHLKDLFEKLKSKNPQMFSMSEHIAKDASENSLYHSQLESLMGGKMYYKEMEDEFVFQRSGEKFALMNTATGIKAL-GIFQLLLQSGWLTKRTLLIIDEPEVHLHPSWQIEYARILVELAKGVHILVNSHSPYFI 388
373 4.000e-18gi|117620939|ref|YP_856566.1| RecF/RecN/SMC family protein [Aeromonas hydrophila subsp. hydrophila ATCC 7966]  clstr ali  16  72LSEINLVNFRRFDSIKVRLE--SNVTVFIGGNGIGKTTIIDAISKVLSWIVSGIEKEGKNGSPIKY----QEINNNEQCYFSDVNALFEFGIKTKVNGTISRSKLGTAEKRDSNVVELKSIANVWRVINSINPINLPIFLCYS------------------IARSHPAKRSNRPIVKEPSLLRKSRFDAYSGALDGAGKIDDFIEWFIELHKKTSNNGFFDIDLLEAQVRKLKILSSMDADFIEMYDQKIIDLSLAKNNMQDGEFENNLKQMRTVVDAVVKVVPSIENIWVETSSGSD--------EVKVRNDGGIVNFSQLSDGQRVLLSLVADLARRLVMLNPNIVLIDEIELHLHPAWQQGIVLALKDAFPNIQFILTTHSPQIL 436
374 4.000e-18METAHIT MH0067 GL0101568 [Complete] locus=scaffold11397_2:227:2068:-  ali  23  6...FKIKNFKGIEDTTINLNSNSNIYTLIGLNESGKTTVLEALNYWSYSQESKETV--ECLGFQTIQDDYELIPIGETSNFSKQISVSA------TLKLSENDELDIKKYAEENCNFILTEKIDKITITKSKTFANSQSTGSSNYWTIRLMGKTKGSRSKKVIDLSSKEKEWQCITLYIRD-----NLLPTILYFPNFLFDFPERIYLEDFDEDSKKQKEHLFKKIIQDLLDTLNQDLDIQTHIVNRKRSGNDNDENSLKKVLLDLSRELNNNILGAWNEIFKRKISNKRILVEAKLDRTVNKVYLEFMIEDDGY-FSINQRSLGFRWFFAFLLFTKYRSRKSNNILFLLDEPASNLHTTAQHRLQKSLAEMAKDCKFIYTTHSQYLI 381
375 4.000e-18METAHIT O2 GL0124896 [Lack both end] locus=C3325494_1:1:699:-  ali  30  1....................................................................................................................................................................................................................................................................KLAKITDNREKNSILSEIEKHLNNKLTEDWEKNKLKIKLDVNNNQLNIQIKENDRFFDVVDRSKGFLWFYNFIMKVRFNAKANKDTIFLLDEPGSYLHLNAQDKLCSNLKKISEDGIVIYCTHSHHLL 144
376 4.000e-18gi|406901810|gb|EKD44380.1| hypothetical protein ACD_71C00156G0001 [uncultured bacterium (gcode 4)]  clstr ali  31  1...........................................................................................................................................................................................................................................................METILNVFFSRIARTETLQRGTIVDEHNKKLSANFSKVFKQSEVSISYAIDGEEFIFFSVQDGEPLPLRLRSKGLIWFLSFWLVL--ESMKDQNRVILIDEPDNSLHVNAQSDLLNVLDEIAQTYQIIYATHSPFLI 163
377 5.000e-18METAHIT MH0009 GL0116956 [Complete] locus=scaffold12907_2:8948:10213:-  ali  13  2IQSLKITNLYYIYSYEINFAHDENVLILTGPNGFGKTTILQIINHLCSLKLWYFYLLPFDRIEILFDGTYSLFINKLNSYDNNYGDVEFVMLNKSEDICESFKLDKRIVEHMARRHFSVFRTFDTGRLDEYLEAYSNEESIEFNMIQFLRTQKCVMIEEQRLVVKKVSRSNFEYSRTVEDIQKKISSFYTEAQKTYNSASLKIDGTFVKRLSDIKPSHDVKHIKKERIYREVQKKILEYKKYDLVGELEVVSELGVHYNEVLKLYLTDLYNKLSSIDKYYDKLSTFDRIVSGKHLAYKKLQFKGDEMKIIGSNEHEIPIRKLSSGEQNLLVLCHNLVFGLDDRN--ILLIDEPENSLHMAWLQNLLDDYIKIAKGCQIIIATHSPAFI 395
378 5.000e-18gi|118580293|ref|YP_901543.1| hypothetical protein Ppro_1874 [Pelobacter propionicus DSM 2379]  clstr ali  15  3ISCLSIRNFRNFKSAQLHF--RKGINTIIGENGSGKTNLFFSLRILIDNTLPRYFKFYQTDFNRVLDSGHWIIISITFDGLDTSEEAQALAIQSSGHMETATQGSYSVYFRPKYQFRKELYEYSQVEGKDSAGLKLLLDKLAIEDYETVYLDFSIDDIYKKYVGDFDKIEFPDPDDKEELIFGTWLPKEINIHNELSCTFIKALRDVESDLRSYSSNPLISLLRGKEKTVEITKQHEIIESIDQLNEQISSLDEVMEVKNGIDKSI--KETVGTTYAPNIDIKSELPNEMEKLFQSLKLWIGDPD------EDGHKGRISELSLGGANIIYLSLKLLEYEKVKTDRILLVEEPEAHVHTHIQKTLFNNLKE--NKTQVIVSTHSTHI. 387
379 5.000e-18gi|159897075|ref|YP_001543322.1| ATP-dependent OLD family endonuclease [Herpetosiphon aurantiacus DSM 785]  clstr ali  15  3ITDVIIKNFRSIEHAQLN--GCGDINVLIGKNNAGKSNILLAITTFFEFMERGKLFTFIEDSKDTINFFNNSEDSIIEISIKFNISQSDIDNLKIYKPENNTKNTYTKLSITIVNLLDKKSKVNAKILKNITEGDKSNHELLDIINNNLSNLVQYHIILNYISSETLILNEIKEKNKSGFEQAISMLNNIIKSNNREHFNDIKKGAKNQELLDNLIEERIKSNNNDELSVIEGILNTTKHSNIDLEKLILSLKEIVQRISNHFHHIKERRPELDINDANVFLELKKKKASKNMVLGITIDAFVEDDNSDPVLDVDNFLIQVNGYGVKEALRIIFDY----EIHRPKVVLIEEPELHLHPSLEMNLMRYLKEISAECQIFMTTHSTNFI 395
380 5.000e-18gi|119510679|ref|ZP_01629807.1| ATP binding protein [Nodularia spumigena CCY9414]  clstr ali  15  16...............................................................................DLTLDFNQNEPTILIGINGVGKSSIIECLAILLSRFTSSIQHSTPSGRLFTEEDITNGEKETHNEVNISFDSEE---ITWSLTKVKKGRNKDTSSNLSAMTKVAENIKENLHISHIFNIPIVVYYSTNRAVLDIPLKIRTKHSFEQIDAYENALTGNAITGLGSEFRIFFEWFRRQEDLENELRLENNAAYRDKQLEAVRQAISSLIPDFSN-------LRVRRSPLRMTLQKQGEELIVNQLSDGEKCLLAMVGDLARRLAIANPGIILIDEIELHLHPKWQRGIIPDLTRTFPNCQFIVTTHSPQVI 323
381 5.000e-18gi|251798284|ref|YP_003013015.1| hypothetical protein Pjdr2_4307 [Paenibacillus sp. JDR-2]  clstr ali  16  3IEKVKIKNFRLLHDAEITLDE--KTTVIVGRNNSGKTSFTEVFRRLLSDTTAKFKLEDFSIPVHEDFWRAFLLMKEEDQQIREVLPYIQVTLSLKYDIETDNFGPMGEFVIDLDDSTHCVTLLRYQLSDGKISSLYGDIEYTGEPDKTEIEKMNFYRVIKERVPLLYSTSVYAIDPQDSSNQKKLDLTLFRELLQTGFIQAQRGLDDTTYKDRDILGGIVERMLDIAKSDNSKSADNTTVSLLESAVKEIQLKIDSDFNQHVNKLLPALSLFGYPGLSTLPLLTETTLDVKRLLENHTKVNYPGINGVNLPEAYNGLGSRNLIYILFHLFEFFKMYKARKTAANFHLIFIEEPEAHLHPQMQEVFIRKLTEIADEVQFVITTHSTHI. 402
382 5.000e-18gi|256838545|ref|ZP_05544055.1| SMC domain-containing protein [Parabacteroides sp. D13]  clstr ali  11  15IKEIKISNFRNFRDASVPF--HEGVNVIIGHNNTGKSNLLRAIGLVLGYSDGRRL-----GTCDLFYETDVVTLQQQSPRIKITLIFHRSQGEALDSAEMGLFSGMMTDPALSEEAKLRYEFKLADDQEDNYKADVAGVTTAKEIWKIID--RDYIRLYRSSRSGGNQAAGISVNDALGQMDFQFLDAIRDVSHDLYAGYNPLLRDVLNFF--------------IDYSVKNDATKTEDEIKEQLKALRNDFVQQSSPLMQTLQDRLHNGKNVFLKYALDTGATFNGAVPDFDGEVTENEMFAVLRMIIKYTVGIEVPATYNGLGYNNLIYMSLLLYMKRNAKVISFLAVEECEAHLHPAMQYKFLQFLQDNKANRQIFMTSHSTQI. 391
383 5.000e-18METAHIT MH0056 GL0115588 [Complete] locus=scaffold132076_1:1591:2871:-  ali  14  3.........................................................................IKEITISNYKSIREMNIKFQPGVNLLIGDNGVGKTSVLEAITVAFGDFMNGISGVSKKGISTTDVRIDTKMISDVSQGIVHCTPITIKSTFDTEEGIKQGEVTRRDETAKSKTRFIGKEVSDYANRKVNDLSEELPLFCYYSTSRLAPPKREDFGTASKNKLNDRRCGYIGCMENNLDIKALKAWCLKMEMLAFQRQKPIAEYQAFKEIVANFMWKMNELEEKPEVMYSRAFEDIVYIENGETIPVNYLSAGYQSLLWMVMDMAFRMANLNPGIVLIDEIDMHLHPKWQWKIVESLQECFPKIQFILATHSPIII 326
384 5.000e-18gi|352085416|ref|ZP_08953036.1| AAA ATPase [Rhodanobacter sp. 2APBS1]  clstr ali  19  4ISQIHIVNFRACRD---VSLSLGDFTPLVGQNNVGKSTILEAIKIVLTPRTFQKTDPNNPDEIISIAACIDGISPEIIALIPEAKHQTAITPYCVEGRLWVRVSSTLGTMKPVQEVWEPAKHVGEG---TPTEWRKYPTGLPEAVNALLPEALHVIA-----MEDVSEDLGKAKAGSTIRGLLDEIMAPILEAHAEVQQALDSVRGLLASN----GQQRSPLLRSFDANATIALADFFPGLAIDMDVPSID----------------------------------IKEFFKVGDL---------HVTDDVSKDRRRF--DQVGSGAQRAIQMLIRYLADIRRGGAEILLIDEPELYLHPQGVRRLREALRKLSEGFQIIFSTHSPLML 338
385 6.000e-18gi|416067731|ref|ZP_11582413.1| hypothetical protein D18P1_0517 [Aggregatibacter actinomycetemcomitans serotype f str. D18P1]  clstr ali  21  3LTSVTVYKYKSYDQQQSFPID-DDITIIVGKNESGKTAILEAIAKTNYFSDDSDFKFNPTHDYPRKEKKKYDKSGEIGKAISCTYLLEQEEISEIEKYLGCSVISKWEFTVTTKYDNSRTVTHPEVDTNKFLEFIGNKYNLSSENLNILKTLTSEEKILD-----AIDGHKSEEDDPEKEKLSKALIHIKDNYFTDLNWDDWLAAYLWQRHLKPIMPKFMYFDEYYELPSKINLETIIKSTTQDAKTAKALLELADVDLDDLKSPDSYEDFKAELEATSSEITQYIFKYWKNNTGYPNTIEKYLNIRVWSDKHHISLPLSNRSKGFNWFFSFIVWFSRIQEDKSNYILLLDEPGLNLHAAAQSDLLNFLDDLSKEYQIIYTTHSPFMV 399
386 6.000e-18gi|336124823|ref|YP_004566871.1| hypothetical protein VAA_01211 [Vibrio anguillarum 775]  clstr ali  14  19........FKNLKNVTIDFEEQEWITLVIGWNGTGKSNVLEALAVLFRDLIMGKNDNGEKDKPSFSYTLRYFCHHKEIEKLENTTLQVDFFSELTDDSTLVGLKFNEFKKRQDEFLPKYVFGYYSGHSDRLQSVFRPYLQQYDKKLRNSKSEDPGLRRLFYALPVHSQFVLLAFVLNQDDLVRHFLDTQLGLETDENAESIDSVLLELNEPSWNLNKGKDPKGTYGACKDKPDIFWGAEGVVRDFLNRVHKVIKISRKDDATLWNKKGREYLYMFIKDVTRLTELVEFFRDLESTYVSELISEVRIRVKLKKNDGSVTFRELSEGEQQLLTVLGLL--RFTAEEESLFLLDEPDTHLNPKWSVDYIDYLNKFVNNSHIVLTTHNP... 431
387 6.000e-18gi|119485602|ref|ZP_01619877.1| putative excinuclease ATPase subunit [Lyngbya sp. PCC 8106]  clstr ali  14  3IKEISVKNLFGMFDHVIPMNLDERITIIHGPNGVGKTILLKILNSLFNSQYYFLHTISFTEFRLDFDDESYLVITKKQENKKIKKLSFSYYQVDSETQETLNGSEIFERFGDSLFSVRFSNNRFNRLVKGQPEEDKWLSELKEKIKVGFIEAQRLFSFSSNRTPRSIARSMVPSVATYSQELSEQIQETLTELSQSLDRTFPVRVVNQKSSSNFTEDALRDQLSKLEEQRNQLIDLGLLEKDENPDFQVEQEIDDKTKSILSVYVEDVEKKLKVFSEISSKIA-VFKKIAESRFSYKKMSITKEKGFTFTTLNGNPLSPTNLSSGEQHELVMLYELLFNVEP--NSLILLDEPEISLHVAWQVEFINDLQDILKNFDVLIATHSPDII 433
388 6.000e-18gi|146301397|ref|YP_001195988.1| ATP-dependent OLD family endonuclease [Flavobacterium johnsoniae UW101]  clstr ali  12  3LKSITVKNFRRLKKTQIDLEKDDSI--FVGANNSGKTSATYLLYRFLEDQKAKFSLHDFSSHCWKIFDDLGNSETLLKASEFPSISLDLWFQIQSSDLHRVLDLLPSLEWQNAPVGARVEFSVKDVSTLMENYKQAKSKAVANKKEQYHPWPKNLSDYLRKNLNQEFNFKFYKFDNDFNQEEGYEPLTLGNDTDRSGSKIIKSIIKVDILNAQRHLTDNNSARSEDLSKRMNRFYERNLRKKENDYEAMRALDNSEKELTAHLSEVFAPTLQSLNNLGYRGFNDPKLLIKAALNSEMIASQTKLHYALSDDPELMALPDQYNGLGFKNLIYMVIEILDEENRAPLHLVIIEEPEVHLHAQLQQVFIREIRKVIQKTQVVISTHSPHII 409
389 6.000e-18gi|323483397|ref|ZP_08088785.1| hypothetical protein HMPREF9474_00534 [Clostridium symbiosum WAL-14163]  clstr ali  18  3LVRLRIRNYKVIRDMEICDIE--NALILVGKNNTGKTSVLDAIRVVSGVEELTKADFNEAK-QNVEIEVTLEITPED----------------RRMMHRAGIVSRYKRYEIWENDFYRKLPSCKGDLLEF-------------TYTANYEGTVRYTDGIKKDNPCIREVLPRLHYINTARELQAFQNDLLLFHDNRIMNQLRSGRCLFDAAKE-----------------CRHCFQCIGLINQKKPEELDETRKLLEYKLYQSNMGDLVGRINDNFHKNGGYDDILYELRCDIDQMFQIE-----VKTYNSERKEVDTVEHMGKGMRSIYMLLLETYIEGENRMPSIVIVEYPELFLHPQLQKVSSEILYRLSKKNQVLFSTHSPQLL 339
390 7.000e-18METAHIT V1 GL0071378 [Lack 5`-end] locus=scaffold77630_3:13:1560:-  ali  15  4IKSVKIKNFRGYRDEMRVDF--DDLTVLIGKNDIGKSTILEALDIFFNETSGVV------KWDKSDLNVQSAEKGENEAIISVCFTELPANIIIDSTVQTDLGSEYMINADKNLEVIKKF------------KTQKPAVFIKALHPTNPECSDLLLKKNVDLKNVANKLGIECENLRTNSKIRKAIWEHFNSDLNLKEVEIDIAKEDAKKIWENL-SSYIPQHSLFQADRRNSDDDSEVQDPLKIAVKEILTDQEIKDKLNSVADTVREKLQKVANRTREKLKEMDSGIASTLHPVIDTNKWSDVFKNVSISGDEDIPINKRGSGVKRLVLLNFFRAEAERRNTGIIYAIEEPETSQHNNHQRTLIAALKELSPHTQILLTTHSAVLV 379
391 7.000e-18gi|427735525|ref|YP_007055069.1| putative ATP-binding protein involved in virulence [Rivularia sp. PCC 7116]  clstr ali  12  2.................................................................................KIKRIEMQSFRGIGDMALEFQEDEPNVIIGINGVGKSSILECIAILLSRYTKPVQFPTTSGRLFQEEDISTGSEETRNEITVETDEGEVTWCLSKQRKKRSKTVGSDLSELRKLIDETHEQLKNDSEFNLPVIVHYGVNRAVLEIPLRGRKKNSNERASAYEQSLDSVQINFNSFFQWFRKLEDLENEQRLDDSNFVNHQLEAVRQAIYSLITGLSNLRIRRSPLRMTVKKQDRELNVNQLSDGEKCLLAMVGDLARRLAIANPGIVLIDEIELHLHPRWQRDIIPALKKTFPNCQFIVTTHSPQVI 317
392 7.000e-18METAHIT MH0006 GL0130026 [Lack 5`-end] locus=scaffold20970_3:3:1280:+  ali  13  6........LKNIGKIGTASVEINGITVIAGENNTGKSTVGRALFAVFNSFCNVQKQIENERVDSVENLLDRM--------YMNASARFARIANTADVARTIVAHIDEYRQIELPDMQKSIIDLLSQYDDGKIESLDENMVADTVFRIKDVLNVSDVDFLKSVLERKLDAEFNEQVCNIFSEDDGEIQLQIKDAVITVSVENEGAVDIQNPG----------NISLHTEVVYIDDPFVLDDLRMFYRRMPRASSDHRYHLRTKLFWPDSEANVFDEIIAKDKLNSIYEKISSVCSGDV-IRSKRSVTGYQRKGSDKVLNVRNLSTGLK-TFVILKMLLTSGVIERNGTIILDEPEIHLHPEWQLLFAELIVLIQKGVHVLVNTHSPYFL 367
393 7.000e-18gi|414343582|ref|YP_006985103.1| ATP-dependent endonuclease of the OLD family-like protein [Gluconobacter oxydans H24]  clstr ali  17  6...VRIKNFRALKD---VTIPFDSVTTFIGPNGAGKSTVLRALDWFFNGKP----------GTLTEKDCSFGATDEDVEVQVTFTDLSEKDREALGKYAPEGVSTFTAWRRRSPDGSDALSANAKGFPRFAASAAGTKKSLYAELQRVQPELNLPAVKTGPAVEEAMTAWEASHTDQLAE---------VPESLQTNFFGFNSGGKMSGLFDFVLVTADL-RASEESVDGKSSVIGRILERSVDRAVADEEIAKIVEESRAQQQKVYVEKFQAQLETMTTQLNAVVSSYVTVSPAEVELKAPKTTFEVAVLDGATETAVERQGHGFQRTIALQLLAQSGAASADGVICLIEEPELFQHPIQAQAFAKVLRSLVEDIQVTYATHSPHFL 384
394 7.000e-18gi|390165914|ref|ZP_10218188.1| ATP-dependent endonuclease, OLD family protein [Sphingobium indicum B90A]  clstr ali  17  3LERARIKNFRSLRD---VEVEFGAHTALIGGNGAGKSSILKAIEMF------------YSTSKTCSADDFFGRDQSQPIAIELTFHRLSEQEATAFEDRVRDGKLVVTRIFDQSSSSGRYHGVVPQVADFLA-IRAHATATSKRAAY-------------NELRENNPAYAGLPNAGSQAAVDQALLEWEANHPEQLVLLPDDGQFFGFQNNSRGKLQRHTSFVFVPAVREASADAADGKASVKLLELLVRSQILQRPDVQAFKATMTEAYQAELGALAGTLTADLRGLYQDAEVSLEMPVPLPMADVFLKDDGFGGPVDRQGHGLQRAFIFLLQHLARTTVPESDILAIEEPELYQHPTKQRHFADVLRGLSSGTQIIFGSHSPMFI 411
395 8.000e-18gi|429158681|gb|EKY01218.1| hypothetical protein HMPREF9151_01076 [Prevotella saccharolytica F0055]