current user: public




Query: PF13175.4; I1YS32_PREI7/1-378; AAA ATPase domain, from PfamA30U

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .
# E-value Template Links and tools%idFirst MKISKLKLKNFRSYRSVEISFENLTAFIGRNDIGKSTILEALDIFFNEGKGVVKLEANDLNTEAKGQDEQYIEITVCFNDLPTEITIDSTYLTTLEDEFLLNEDKELEVIKRYPLKGLKEQVYLSAYHPSGQNCSDLYTKKSSDLKKIIKDADILCENNSVNAIMRSAIWKHYDASQHRKLRELDLAKEDGKNIWEKIKEFLPQYSLFQSDRKNSDNDSEVQDPLKEATKEIISSSNLETQFNQIATEVTKKLREVANSTLSKLKEMNPDIAEGLEVKIPEVKDLKWAELFKSVSIEGNDGIAMNKRGSGVRRLILLNFFRAKAEEKASRDNRTLIYAIEEPETSQHNEHQKILIDALKNLANNGRQIMLTTHSGNIVLast
1 0.000e+00 GL0009249 [Complete] locus=scaffold46291_1:476:2035:+  ali  49  1MRLTTLKLKNFRGYRETVVGFDDLTAFVGKNDVGKSTILEALDIFFNDKNSVAKIEKGDINKQSQQDGDTDICISACFSELPERIVIDSSNETSFSAEYLLNESSELEIVKKY-PNGGTAKVYVRANHPKNPMCCDLLSKTNAELKKLLNEQHIDCDDRTKNACIRTAIWRHYSDDLQLEPTEIELSKGDGKSIKEKVLSQLPAYALFQADRKNCDGDSEIQDPLKVATKTIMQSPEVADKLAEVANLVRSQLRDVAQRTLDKLREMDQDVANSLTPVIPD-DTLKWWDVFKSVTITGDNDIPINKRGSGVRRLILLSFFRAEADRARETDNQSIIYAIEEPETSQHAHNQQVLINSLKEIAQSGVQVILTTHSGFVV 379
2 0.000e+00gi|652768146|ref|WP_027081520.1| ATP/GTP-binding protein [Luteimonas mephitis]  clstr ali  45  1MKIKAVTVNRFRGYSKVVVGLDDLSVLVGRNDIGKSTILEALDVFFNEGKGCIKIDKEDINKSCLARGEDQIEVSVEFTELPAEIVIDSTNRTTLASEYLTTAQGTLHIVKRFSPSG-KERVFIRASHPTADGCGDLHQKKITELRKAVDEKGFTCSDKTRSAELRKAIWAG-HSDLALSECEIEIAKEDTKAIWDQLKAKMPLFTLFQSDRKNAESDDEVQDPMRVAVREILGDAAIRANLREVADKVRARLEDVADRTLEKLRELNPQLAASLEPQIPDSDALKWSDVFKSVGISGDQGIPINKRGSGVKRLVLISFFRAEAERRLAGANRHVVYAIEEPETSQHPEHQRGLTAALKALSTQATQVLFTTHSPEVV 379
3 0.000e+00gi|517426551|ref|WP_018597650.1| hypothetical protein [Blautia producta]  clstr ali  53  1MKIKSMKLQNFRSYKSETIELGDLTAFVGKNDIGKSSVLEALDIFFNDSKGSIKIDKDDINKTAYNADDKEIIISLIFEELPSKVVIDASNETTLENEYLINTNGELEIIKRYPNAG-TAKTYIRAYHPTNPDCSGLMLKKDTDLRKIIEKNEIPCSDKTRNAVMRAAIWDFYKDDLQLNEIEIDVSKGDTKSIWEKLQTYLPLYTLFQADRKNSDGDNEVQDPLKEAVKEILNNESLKSILDTVAGEVEKKLKEVSERTLDKLREMNPDVANSLNPVIPAAKSLKWADVFKNVSITSDENIPINKRGSGVKRLILLNFFRAEAERRQESNTTSIIYAIEEPETSQHTENQKKLIKAFLELSAPNTQIIITTHSANIV 380
4 0.000e+00gi|667763980|ref|WP_031385044.1| ATP/GTP-binding protein [Halomonas zincidurans]  clstr ali  53  1MKISQVKIANFRGYKDETIDLDELTVFVGKNDVGKSTVLEALDVFFNESKGVIKLDKEDINKQGLAEENSAICIAVVFEDLPTSLVIDSTNATTLQDEYLLNRQGKLEIVKTYPSAG-KEKVSVKAHHPLNPACADLLLKRQKDLQAIIKKDSILCDDQKKNSVMRKAIWQHFSEDLQLQDIEIDVTKEDAKNIWDQLKNYMPLYSLFQSDRKNSDGDSEIQDPMKLAVQEILKDTSIQSSLNKVAIEVDFKLKEVADRTLEKLKEMNPEIANSLNPVIPSAETLKWADVFKNVSISGDEDIPINKRGSGVKRLVLLNFFRAEAERRKKEKNVPIIYAIEEPETSQHPDHQKKLIDAFIELSKQHTQIILTTHSPSIV 380
5 0.000e+00gi|652599070|ref|WP_026981677.1| ATP/GTP-binding protein [Flavobacterium suncheonense]  clstr ali  56  1MKIKTIKIKNFRSYKDVEIEFGDLTAFVGKNDIGKSTVLEALDIFFNDGKGIIKLDKEDINKQALAAGDTETVITVCFEELPTKIVIDSTNETTLENEYLLNSNGQLEIIKKYTNAG-KEKVFVKANHPTGNNCADLLQKKNTELQKIIKENSITCSNQTINAVMRTAIWQHFTIELDLSEIEIDVTKGDTKSIWDKLQTYLPLYTLFQSDRKNSDGDSEVQDPLKEAVKQILNDPALKTKFDEIADEVKTKLQDVATRTLAKVQEMNPEIASSLNPVIPETNSLKWNDVFKSVSITGDEDIPINKRGSGVKRLILLNFFRAEAERRKEENIPSIIYAIEEPETSQHTEHQKKLIKAFLELSKINTQVIITTHSGTLV 380
6 0.000e+00gi|651391635|ref|WP_026503459.1| ATP/GTP-binding protein [Bifidobacterium boum]  clstr ali  58  1MKIAKLKLSNFRSYQDTEIDFDDLTVFIGKNDIGKSTVLEALDIFFNDGKGTVKIDNADANVNNAKGGDHDICISVIFKDLPEKIVIDSSVETTLKDEYLLNSDSELEVMKKYS-GGKSPKVFIKAQHPSNPNCSDLLLKKNSELKKIVKNENIECQNQSVNAFLRKSIWEHYSSDLKLAETEIDASKEDAKQIWEKLSYYMPVYSLFQSDRKNSDADSEIQDPLKEAVKEILNDENLKTTLNQVADEVHSKLNDVSIRTLAKLKEMDPAIANSLTPVIPPTDSLKWADVFKAVSI-SGDDIPINKRGSGVRRLILLSFFRAEVERRRENDNSGVIYAIEEPETSQHNENQRKLIEALKKLAAPNVQIILTTHSAYIV 379
7 0.000e+00JGI.Meta 7022940149 C3746347__gene_199459 hypothetical protein [Human Tongue dorsum microbiome from visit number 1 of subject 763840445]  ali  73  1MKISKLKLTNFRSYKSVEVELNDFTAFIGRNDIGKSTILEALDIFFNEGKGVVKLDPSDFNIHADREAEGFIEIAVCFRDLPEKIIIDSIYETSFKSEFLLNDRGELEVIKRYALGNLKEQVSLWAYHPSNAHCSDLYTKKPADLKKIIKDEGITCENNVINAKMRAAIWNHYHATDACELKRLDLTKDEGKNIWDKIKEYLPQYSLFQSDRKNSDTDSEVQDPMKAATKEIIDSQGLNEQFKAIATEVTKKLKEVADNTLAKLREMNPDLADGLEVKIPEVKDLKWAELFKSVSIEGNDGIAMNKRGSGVRRLLLLNFFRAKAEDSISSNGRTLIYAIEEPETSQHNHHQDILINALKSLAVAGRQVLITTHSGNVV 383
8 0.000e+00gi|737702732|ref|WP_035671580.1| ATP/GTP-binding protein [Flavobacterium sp. 83]  clstr ali  57  1MKIKKVKIKNFRSYKDVEIEFDDLTAFVGKNDIGKSTVLEALDIFFNDGKGVVKLDKDDINKQAAADNDNEIIISVCFEELPTTIVIDSTNETTLQAEYLLNSNNQLEIIKKYPNAG-KEKVFVKANHPTNDNCKDLLQKKNTDYQKTIRENAITCTNQTINAIMRTAIWTHFSSDLQLAEIEIDVTKGDTKSIWDKLQNYLPLYSLFQSDRKNSDGDSEVQDPLKEAVKQILNDTVLKQKFAEIALEVENKLREVSTRTLEKVREMNPEIANSLNPVIPPVESLKWADVFKSVSITGDNDIPINKRGSGVKRLILLNFFRAEAERRKEENIPSIIYAIEEPETSQHTDHQKKLISAFLELATTNTQVIITTHSATLV 380
9 0.000e+00gi|938265057|gb|KPQ00280.1| AAA ATPase domain [Bacteroidetes bacterium HLUCCA01]  clstr ali  52  1MKIKKVRIENFRGYEETTIEFGNLTVFVGQNDVGKSSILEALDIFFNENKGTIKIDKDDINKKCRINGNNEIKISVVFEELPDSLTLDSTNPTTLQDEYLLQPDGTLEVVKRYPNAG-KEKVFIKANHPNNPDCAELLLKKNSDLKKLLTD-EIECEDKTKNAVIRKAIWNHYSDDLQLEEIEIELAKLDAKNTWEQLKNYMPLYSLFQSDRKNSDGDSEVQNPMKIAVQEILKDDTLKTSLDKVAEEVEKKLIEVSTKTLEKLNEMNPEIADSLTPVIPSPDSLKWIDVFKSVSISSDEDIPINKRGSGVKRLVLLNFFRAEAERRKSQENIPIIYAIEEPETSQHPNHQRKLIEAFIELSKDNTQVLMTTHSPSIV 379
10 0.000e+00gi|495666692|ref|WP_008391271.1| hypothetical protein [Clostridium sp. SS2/1]  clstr ali  53  1MKIDSMKIKNFRGYKDTEIKLNDLTVLVGKNDIGKSTILEALDIFFNDGKGVIKLDKTDVNVKSRTEENLDIEISVCFSELPEQIVIDSTVETSLQDEFMLNANGQLEVIKRYKN-GGSAKVFIKAKHPTNDKCAELLLKKNRDLKRIIQSENIECENQTVNAEMRKAIWNKFSDDLQQDIIEIDVSKEDAKKIWEKLSNYLPTYSLFQSDRKNSDGDNEIQDPLKTAVKQILSDTELQATLAEVAVEVENKLKEVADRTLTKLREMDSTIAASLNPIIPSADSLKWQDVFKNVSISGDEDIPINKRGSGVKRLVLLNFFRAEAERRCEEQSTGVIYAIEEPETSQHSDNQRIMIEAFKTLSAANTQIILTTHSSYIV 380
11 0.000e+00 GL0031622 [Complete] locus=scaffold40842_1:5489:7039:-  ali  53  8MKIKNFKIRNFRGYKEVTIDFDNFTAFVGKNDIGKSSVLEALDIFFNDGKGIVKQDKDDINKQALAEGDTDIVITACFEELPERIVIDATNETSLAEELLLNEEGQLEIEKRYPNAG-SAKVFIRAYHPTNAQCNGLLQKTDKDLRKIIDDNGIACDDRTRNAVMRRAIWEHYRDDWQLGLTEIDVTKGETKSIWDKLQKYLPVYSLFQSDRKNTDSDSEVQDPLQEAVKQILSEERLQEELAAIAMEVERKLEEVSSRTLEKLREMSPEVANSLNPVIPSASSLKWSDVFKKVSISGDEGIPVNKRGSGVKRLILLNFFRAEAERRADNANASIIYAIEEPETSQHTENQKKLIEALLELSEVNTQVIITTHSANVV 387
12 0.000e+00 GL0066573 [Complete] locus=scaffold59143_2:17:1552:+  ali  52  1MQIKSLTLQNFRRYSNVTIEFENLTAFVGKNDVGKSSILEALDIFFNDGRGCIKLDKDDINKIEASRGNNEVSIAVCFENLPDTVVIDATNETTLESEYLLNESCQLEIVKKYPNAG-SAKVFIRAYHPTNPNCSDLLLKKDSDLRKILSSQSIACEDQTRNAVMRKAIWERYSDDLQLETIDIDVTKSDAKTIWDKLQKYLPLYTLFQADRKNTDGDSEVQDPLKEAVKEILADESLAATLRSVADEVERKLKEVSSRTLEKLREMSPDVANSLNPVIPSSTNLKWTDVFKGVSITGDNDIPINKRGSGVKRLVLLNFFRAEAERRQERNAPSIVYAIEEPETSQHTENQRKLIHAFLTLSEENTQIIITTHSASIV 380
13 0.000e+00gi|949001001|gb|KRO12019.1| hypothetical protein IV77_GL001657 [Olsenella uli DSM 7084]  clstr ali  49  15MKIRSVEITNFRGYSETEVAMDDLTVFVGKNDIGKSSVLEALDIFFNDGKGAVKFDKSDINVENQKGGDQEASIAVVFADLPDEIVIDTTAKTNLKDSYLLNGEDKLEIVKKYKGTGA-PKVYIKALHPTNSGCCDLLLKKNADLKKLVKQYKLEEEDTKSNVSMRAALWSHFSDDLKLQEIEIDISKEDAKAIWSKLSTYMPVYSLFQADRENSDSDSEVQDPLKESVKEVLNDLALKEELDEVAQKVREKLQEVANRTVDKLKEVDPEVASSLDPVIPATESLKWADVFKNVSITGDGDIPINKRGSGTKRLILLSFFRAEAERRAESETNGVIYAIEEPETAQHTENQKKLIEALQELSKDGVQVILTTHSPYIV 395
14 0.000e+00gi|652812991|ref|WP_027104869.1| ATP/GTP-binding protein [Lachnospiraceae bacterium V9D3004]  clstr ali  55  1MRIISLKIKNFRGYKDVEIRFDDLTVFVGKNDVGKSTILEALDIFFNDGKGVVKLEKSDVNVDERKMDNNETIISVCFGELPDKIVIDSTVETTLQDEYLLNSDGYLEVVKKYKNGGA-GKVFVRAYHPTNPKCNNLLLAKNTDLKKIVKTENISCENQSINTLMRRAIWSKYENELQLMDCEIDVSKEEAKKIWEKLVLYMPAYSLFQSDRKNSDGDNEVQDPLREAVKQILNERRLQETLFEIANEVEKKLKEVSERTLQKLREMDPDIANSLNPVIPSADSLKWQDVFKNVSISGDDDIPINKRGSGVKRLVLLNFFRAEAEKRAQSEGGTMIYAIEEPETSQHSNNQRLLIEAFKTLSNEATQVILTTHSSVIV 380
15 0.000e+00JGI.Meta 7046533748 SRS050752_LANL_scaffold_50330__gene_105207 hypothetical protein [Human Stool microbiome from visit number 1 of subject 7  ali  55  2.KIDSIKIKNFRGYKDTKIELNDLTVFVGKNDIGKSTILEALDIFFNDGKGVIKLDKTDVNVRGKKEEDLDIEISVCFSELPEKIIIDSTVETSLQDEFMLNADGQLEVIKRYKNGGA-AKVFIKAKHPTNGKCAELLLKKNSDLKKIIKSENIECENQTVNAEMRRAIWNKFSDDLQQDVIEIDASKEDAKKIWEKLSNYLPTYSLFQSDRKNSDGDDEIQDPLKTAVKQILSDTELQETLAEVATEVENKLKEVADRTLTKLREMDPAIAASLNPIIPSADSLKWQDVFKNVSISGDEDIPINKRGSGVKRLVLLNFFRAEAERRQEQGNTGVIYAIEEPETSQHSDNQRILIEAFKTLASVNTQVILTTHSSYIV 380
16 0.000e+00 GL0103951 [Complete] locus=scaffold2475_4:2299:3864:+  ali  53  1MKIESIKIKNFRSYKEETIIFDNLTVLVGRNDIGKSTILEALDIFFNDGGGIIKIDKSDLNIQAARNGDSETVISVCFSELPESIIIDSAVQTTLADEYMLNADGLLEVVKKYKN-GGKASVFIHAKHPMNPDCKDLLLKKNAELKSIIKGMGIECENQRINTTMRRAIWEHYEGSLDLQDMEIDVSKEDAKKIWDKLSSYMPVYSLFQSDRKNSDGDSEVQDPLKEAVKQIINDEELQQTLASVAEVVETKLKEVSSRTLEKLREMDPAVANSLNPVIPTADKLKWADVFKAVSISGDEDIPINKRGSGVKRLVLLNFFAEAERRAAEGDSTGIIYAIEEPETSQHSNNQRVLIKALKELAQANTQILLTTHSPVIV 380
17 0.000e+00gi|503793929|ref|WP_014027923.1| hypothetical protein [Acidithiobacillus ferrivorans]  clstr ali  50  1MKIKAITVNRFRGYSSVTIEVDDLLVLVGRNDIGKSTILEALDIFFNEGKGCVKIDKDDINKDCFAQGQDCIEIGVEFTDLPANIVIDATNQTTLQEEYLLTSAGTLHVVKRYPNAG-KEKVFIRANHPVNPECADLLLKKNADLKKILEGAGFDCADKTKNAELRKAIW-LGQANLQLGDCEIEVARIDAKSIWEQLKAYMPLYTLFQSDRKNSDSDDEVQDPMRIAVKEILGDPQIQAGLAQVTDTVKARLDQVAQRTLEKLREMNPAIANSLDPQLPDFSSLKWPDVFKNVSITGDDDIPINKRGSGVKRLVLISFFRAEAERRQNEANLPIVYAIEEPETSQHPEHQRALTDALIALSAQNTQVLLTTHSPEIV 379
18 0.000e+00 [KEGG:K07459]|[eggNOG:NOG70858]  ali  54  1MKIVSLKIKNFRGYKDTEIKFDNLTVFVGKNDIGKSTILEALDIFFNDGKGTVKIDKTDVNVQEAHDGNQESIISVCFGELPEKIVIDSVVETTLQDEYMLNTQGQLEVIKKYKN-GGTAKVFIRAHHPSNPKCANLLLKKNNDLKKIVQVEEIECENQTVNALLRKAIWNKFEDDLQLEDMEIDVSKEDAKKIWDKLAGYLPVYSLFQSDRKNSDGDNEVQDPLKEAVKQILTDSRLQDTLSEIAKGVEEKLKEVSNRTLEKLREMDPGIADSLNPVIPSAESLKWQDVFKNVSISGDGDIPINKRGSGVKRLVLLNFFRAEAERRFQTENGAVIYAIEEPETSQHSDNQRMLIEAFKSLAEENTQVILTTHSSYIV 380
19 0.000e+00gi|921241540|ref|WP_053185976.1| ATP/GTP-binding protein [Sunxiuqinia dokdonensis]  clstr ali  52  1MKLNQIKIKNFRGYRETIIPIQNLNVFVGKNDVGKSTILEALDIFFNENKGVVKIDKEDVNKVALANAENEIIISVIFDELPERLVLDATNETSLVSEYLLNSDGRLEVVKTYPNGSGSAKVFVKANHPTHEICADLLQKKQADLRKIIKEQGIDCENQTRNAVMRSAIWYHFHGELQCEEREIDVTKGETKDIWEKLKIHLPLYSLFQSDRKNSDGDSEVQEPMQFAVSQILKNPELQTTLDGVAEIVTQKLNKVAEITLAKIREMNPEIADSLTPVIPSPDSLKWKDVFKNVSITGDENIPINKRGSGVKRLILLNFFRAEAERRRTEHNIPSIYAIEEPETSQHSQHQKQLTKALIRLSEANTQIILTTHSPVIV 381
20 0.000e+00 GL0131241 [Lack 5`-end] locus=scaffold76311_11:2:1570:+  ali  53  10MKIKSITIKNFRSYAETTIHFDDFTAFVGRNDIGKSTVLEALDIFFYDGKGLVKLDKNDVNVSERAGDKTDISISVCFCNLPATIIIDATNETTLQDEHLLNKDGLLEITKRF-PNGGSPKISICAMHPTNPDCCDLLSKKDSDLKKLIKAKSIPCDDYARNASMRTAIWQYYAEDLRIEPVEIDVTKGDTKSIWDKLQKSLPLYSLFQSDRKNSDTDSEVQDPLREAVKEILCDEALRSTLDEVAATVETKLQDVASRTLEKLREMNPDVANTLSPIIPSADALKWADVFKSVSIAGDESIPINKRGSGTKRLILLNFFRAEVERRQTEQTSSVIYAIEEPETSQHSENQKRLIQALSELAKHNVQVIITTHSATIV 389
21 0.000e+00gi|511030252|ref|WP_016284397.1| hypothetical protein [Lachnospiraceae bacterium A4]  clstr ali  54  1MKIESIKIKNFRSYKEETICFDDLTVLVGRNDIGKSTILEALDIFFNDGSGVIKIDKTDLNIQASRNGDNETVISACFSELPESIIIDSAVQTTLGSEYMLNSDGYLEVVKKYK-SGGKASVFIRAKHPTNADCKDLLLKKNADLKRIITGKGIECENQSVNATMRRAIWEHYADDLNLQDIEIDVSKEDAKKIWDKLSSYMPVYSLFQSDRKNSDGDSEVQDPLKEAVKQIINDEELQQTLASVAEVVETKLKEVSSRTLEKLREMDPAVANSLNPVIPTADKLKWVDVFKAVSISGDEDIPINKRGSGVKRLVLLNFFRAEAERRAEEDNTGIIYAIEEPETSQHSNNQRVLIKALKELAQANTQILLTTHSPVIV 380
22 0.000e+00gi|504521532|ref|WP_014708634.1| ATPase AAA [Prevotella intermedia]  clstr ali  100  1MKISKLKLKNFRSYRSVEISFENLTAFIGRNDIGKSTILEALDIFFNEGKGVVKLEANDLNTEAKGQDEQYIEITVCFNDLPTEITIDSTYLTTLEDEFLLNEDKELEVIKRYPLKGLKEQVYLSAYHPSGQNCSDLYTKKSSDLKKIIKDADILCENNSVNAIMRSAIWKHYDASQHRKLRELDLAKEDGKNIWEKIKEFLPQYSLFQSDRKNSDNDSEVQDPLKEATKEIISSSNLETQFNQIATEVTKKLREVANSTLSKLKEMNPDIAEGLEVKIPEVKDLKWAELFKSVSIEGNDGIAMNKRGSGVRRLILLNFFRAKAEEKASRDNRTLIYAIEEPETSQHNEHQKILIDALKNLANNGRQIMLTTHSGNIV 378
23 0.000e+00JGI.Meta 7049396370 SRS051031_LANL_scaffold_3323__gene_2537 hypothetical protein [Human Stool microbiome from visit number 2 of subject 7644  ali  54  50MKIKNVAIKNFRGYSD-EIDFEDLTAFVGKNDIGKSTILEALDIFFNDGKGATKLDKADLNVESKARQETDISIRVCFTDLPEKIVIDATNETSLSAEYLLNSDGLLEVVKRYPNAG-TAKVFICAMHPTNPECADLLSKKDSDLRKIIETRGIPCGDKTRNSAMRTAIWSYYGDDLQVNSVELDVTKGDAKPIWEKLQKYLPVYSLFQADRKNSDSDSEVQDPLHAAVKEILQDEDISRTLDHVAGIVEGKLQEVATRTLEKLREMSPDIANTLSPVIPPASSLKWADVFKSVTISGDESIPINKRGSGSKRLILLNFFRAEVERRKDEANAPIIYAIEEPETSQHSENQKKLINALIALSESNVQVIITTHSAVLV 429
24 0.000e+00 GL0012358 [Complete] locus=scaffold39635_2:5675:7327:+  ali  55  36MKIKNVAIKNFRGYSD-EIDFEDLTAFVGKNDIGKSTILEALDMFFNDGKGVTKLDKADLNVESKARQETDISIRVCFTDLPEKIVIDTTNETSLSAEYLLNSDGLLEVVKRYPNAG-TPKVFICAMHPTNPECADLLTKKDSDLRKIIETRDIPCEDKTRNAAMRTAIWSYYGDDLQVNSVELDVTKGDAKPIWEKLQKYLPVYSLFQADRKNSDSDSEVQDPLHAAVKEILQDEGISQTLDHVAEIVEGKLQEVATRTLEKLREMSPDIANTLSPVIPPASSLKWADVFKAVTISGDESIPINKRGSGSKRLILLNFFRAEVERRKDEANAPIIYAIEEPETSQHSENQKKLINALITLSESNVQVIITTHSAVLV 415
25 0.000e+00 [KEGG:K07459]|[eggNOG:NOG70858]  ali  55  36MKIKNVAIKNFRGYSD-EIDFEDLTAFVGKNDIGKSTILEALDIFFNDGKGVTKLDKADLNVESKARQETDISIRVCFTDLPEKIVIDTTNETSLSAEYLLNSDGLLEVVKRYPNAG-TPKVFICAMHPTNPECADLLTKKDSDLRKIIETRDIPCEDKTRNSAMRTAIWSYYGDDLQVNSVELDVTKGDAKPIWEKLQKYLPVYSLFQADRKNSDSDSEVQDPLHAAVKEILQDEDISQTLDHVAEIVEGKLQEVATRTLEKLREMSPDIANTLSPVIPPASSLKWADVFKSVTISGDESIPINKRGSGSKRLILLNFFRAEVERRKDEANAPIIYAIEEPETSQHSENQKKLINALIALSESNVQVIVTTHSAVLV 415
26 0.000e+00JGI.Meta 7062582902 SRS017227_Baylor_scaffold_73161__gene_91098 hypothetical protein [Human Supragingival plaque microbiome from visit numbe  ali  77  1MKISKLKLKNFRSYRSVEMSFENLTAIIGRNDIGKSTILEALDIFFNEGKGVVKIDSSDFNNEARGQNEEFIEIVICFIDLPTEITIDSTYKTNFQDEYLLNKDGELEVIKRYRYKGLKEQVYLSAHHPSNPNCSDLYVKKSADLKSIIEREEIKCDNLSINAEMRSAIWKKYKDDLQLALRELDLAKDDGKNIWEKIKEFLPQYSLFQSDRKNTDNDSEVQDPLREATKEIISSNELDVQLDRIAEEVTRKLREVSNKTLDKLREMNPELADGLEVKIPEVKELKWADLFKNVSIEGSDGIAMNKRGSGVRRLLLLNFFRVKAEEQASQNQRTLIYAIEEPETSQHNEHQRMLIDSLKVLAEKGRQILLTTHSGYIV 378
27 0.000e+00JGI.Meta 7062474088 C5403290__gene_297286 hypothetical protein [Human Supragingival plaque microbiome from visit number 1 of subject 1605829  ali  93  1MKISKLKLKNFRSYRSVEISFENLTAFIGRNDIGKSTILEALDIFFNEGKGVVKLEANDLNTEAKGPDEQYIEITVCFNDLPTEITIDSTYLTTLEDEFLLNEDKELEVIKRYPLKGLKEQVYLSAYHPSDQNCSDLYTKKSSDLKKIIKDVGIPCENNSINAIMRSAIWKHYDVNQHCELKKLDLAKEDGKNIWEKIKEFLPQYSLFQSDRKNSDNDSEVQDPLKEATKEIISSNNLEAQFNEIATEVTKKLRKVANSTLSKLKEMNPDIAEGLKVKIPEVKELKWAELFKSVSIEGNDGIAMNKRGSGVRRLILLNFFRAKAEEKASRDNRTLIYAIEEPETSQHNEHQKILIDALKELGNKGHQILLTTHSGHIV 378
28 0.000e+00gi|740128389|ref|WP_037976761.1| ATP/GTP-binding protein [Synergistes jonesii]  clstr ali  52  1MRIKSLTIKNFRRYSSVTIEFENLTAFVGKNDVGKSSVLEALDIFFNDGKGCIKLDKDDTNKTESENGNNEISIAVCFEELPDNVVIDATNETTLESEYLLNENHQLEIVKKYPNAG-SAKVFIHAYHPTSPNCSDLLLKKNSELQKLISSQSIECADQTRNAVMRKAIWEHFSDDLQLATTDIDVTKNDAKTIWDKLQKYLPLYTLFQADRKNTDGDSEVQDPLKEAVKEILADESLTATLHSVAEEVERKLREVSSRTLEKLREMSPEVASSLNPVIPPSTSLKWTDVFKGVSITGDNDIPINKRGSGVKRLVLLNFFRAEAERRQERNAPSIIYAIEEPETSQHTENQKKLIRSFLTLSEENTQIIITTHSASIV 380
29 2.000e-98JGI.Meta 7001886172 SRS022725_LANL_scaffold_3893__gene_9712 hypothetical protein [Human Supragingival plaque microbiome from visit number 1  ali  55  7MKIKSMKVKNFRGYSDETINFDDLTVIVGKNDVGKSTILEALDIFFNDGKGVVKIDKTDVNIAKSKNGEHETVISICFCDLPDKVIIDSSVETSLADEYLLNKNKELEIVKKFQNGGA-AKVYIKASHPTNKSCEDLLLKKNSDLKKLIKEENIECSDLSVNSIMRKGIWEKYSNNLQLDEIELDVTKEDAKKIWEKISLYLPVYSLFQSDRKNSDSDNEIQDPLKEAVKQIISEESLQNSLVEIADIVRKKIEEVSNRTLEKIREMDPEIASTLNPVIPAAKNLKWQDVFKNVSISGDENIPINKRGSGVRRLILLNFFRAEAERRAENENANVIYAIEEPETSQHTNNQYKLIESLKELARPKTQILLTTHSPNIV 386
30 1.000e-97gi|739691972|ref|WP_037546466.1| ATP/GTP-binding protein [Spirochaeta lutea]  clstr ali  53  1MKIKEVRISNFRNYKDTTIDFNDLTVFVGRNDIGKSTVLEALDIFFNEKNGIIKIDPEDINKENKSQGNNNIEISVIFQDLPDSITIDASNPTTLAEEYLLNNDGYLEIKKRFPNAG-KEKVFIIASHPTNPDCSELLLKKNSDLKKALGS--IPCEDKTKNASIRKAIWNHYSTDLQLDNIEIDVTKEDAKNIWEQLKNYMPLYALFQSDRKNSDGDSEIQDPLKEAVRQILNNEELKNKFNEISTVVEMKLREVSTRTLEKLREMNPEVADSLNPVIPPAENLKWADVFKNVSISGDEDIPINKRGSGIKRLVLLNFFRAEAERRQAEKNVPNIYAIEEPETSQHPAHQRKLIEAFITLSEPNTQVILTTHSPAIV 378
31 2.000e-97JGI.Meta 7072134739 C1905338__gene_149567 hypothetical protein [Human Stool microbiome from visit number 2 of subject 159490532]  ali  52  1.....MTLQNFRRYSNVTIEFENLTAFVGKNDAGKSSILEALDIFFNEGKGCVKLDKDDINKNEAEHGNKEISIAICFEDLPETVVIDATNETTLASEYLLNEEHQLEIVKKYPNAGG-PKVFIRAYHPTNPDCADLLLKKDSELRRILSSRSIECTDQTRNATMRKAIWGYYSDNLQLAKIDIDVTKNDAKTIWDKLQKYLPLYTLFQADRKNNDGDSEVQDPLKEAVKEILADETLTATLCSVAEEVEQKLREVSSRTLEKLREMSPEVANSLNPVIPSATSLKWADVFKGVSITGDNDIPINKRGSGVKRLVLLNFFXXXXXXXXXXXXXPIIYAIEEPETSQHAENQRKLIRAFLTLSEDNTQIIITTHSANVV 375
32 3.000e-97gi|728904170|gb|KHG33581.1| ATP/GTP-binding protein [Sulfurospirillum sp. MES]  clstr ali  56  1MKIVKVKLENFRSYKDIVIDFSDLTVFVGKNDIGKSTILEALDIFFNDGKGAVKIDKEDINKQAKEEENTEIKITVVFENLPASLTIDTTNPTTLQDEYLLNSSHQLEVIKKYSNAG-KEKVFIKAHHPTNTNCSDLLLKKIKDLQKIIEDNAITCEHKNKSAVARKSIWNYYIDDLQLEEIEIDVTKEDAKNIWEQLKNYLPLYSLFQSDRKNSDGDDEVQNPMKLAVQEILKDETLKNSLEQVAIEVERKLREVATKTLEKLKEMNPEIANSLNPVIPTSESLKWADVFKSVSITGDEDIPINKRGSGVKRLVLLNFFRAEAERRQRELHVPIIYAIEEPETSQHPSHQRKLIDAFIDLSRDNTQIILTTHSPAIV 380
33 3.000e-97gi|979430331|ref|WP_059324475.1| ATP/GTP-binding protein [Elizabethkingia genomosp. 4]  clstr ali  55  1MKLHSVKIKNFRSYKEVEIKIDDLTAFVGKNDIGKSSVLEALDVFFNDGKGNFKLDKDDINKSSMDGGDKEIVISAVFTNLPTSITIDTTNPTTFESEYLLNSDNRLEIVKKYPNAGA-AKVYIKANHPTNSKCSDLLLKKLADYKKIIKDENIECENLTINAIMRTAIWNHFTDDLQLQEILIDTSKEDAKNIWEKIQTYLPQYSLFQSDRKNSDNDSEVQDPLKKAVSQILGDQEVISMFENIAQKVSNHLNEVSNATLEKLQEMNPDIANSLNPIIPTASALKWVDVFKNVSICGDENIPINKRGSGVKRLILLNFFRAEAERRRSGNSQSIIYAIEEPETSQHTDHQKLLIKAFKELSQSNTQVLLTTHSSIVV 382
34 4.000e-97gi|496056241|ref|WP_008780748.1| hypothetical protein [Bacteroides sp. 3_1_19]  clstr ali  54  1MLIKSVTLKNFRGYRETTVLFSNLTTFVGRNDIGKSTILEALDIFFNEGKGCIPLDKEDINKRASSEGDDEIIIAVEFFKLPDSLVIDDSNRTTLAAEYLLTESNTLKIVKRYPKAG-REKVYIRAKHPTNAVCCDLLSKKITDLKTILNRENIECEDQTRKAVIRTAIWNHFADNLNLEEKEIDVTKEDGKTIWESLKKFLPVYSLFQADRSNNDHDKEIQDPLKEAVKSILKEENVAQMCQQIAEHVTTKLQEVSNHTLDKIREMNPELANSLSPNIPSFTDLKWSDLFKNVSIAGDNDIPINKRGSGVKRLILLNFFRAEAERMQSNESDGLIYAIEEPETSQHVAHQKILMKALIDLANNNVQVVLTTHSSYVV 380
35 1.000e-96gi|754469586|ref|WP_041886944.1| ATP/GTP-binding protein [Pedobacter sp. NL19]  clstr ali  55  1MKLRSVKLKNFRSYKEETIDLDDLTVFVGKNDIGKSTILEALDIFFNDGKGAIKLDKDDVNKTAIAEGDNDIYISAIFTDLPTNVVIDSTNETTFDNEYLLNSDGYLEVIKKYPNAGAS-KVFIKANHPTNPDCADLLLKKIVDYKKIITKENIECENLTINAIMRTAIWSHFAGDLQLEEILIDTSKEDAKNIWEKIQTYLPQYSLFQSDRKNSDNDSEVQDPLKKAVQQILADQEIVAMFEDIAQRVASRLTEVSDLTLDKLREMNPEIANTLNPIIPASNALKWSDVFKSVSICGDENIPINKRGSGVKRLILLNFFRAEAERRQSGNSQSIIYAIEEPETSQHSDHQKLLIKAFIELSQNNTQVLLTTHSSTVV 380
36 1.000e-95gi|737210178|ref|WP_035194965.1| ATP/GTP-binding protein [Acidithiobacillus ferrivorans]  clstr ali  48  1MKIKSVTVNCFRSYAHITVEIDDLLVLVGKNDIGKSTILEALDIFFNEGKGCVKIDKDDINKECLSSGNDCIEIGVEFVDLPKQIIIDTTNETTLENEFLVTASGTLKVVKRYSNAG-KEKVFIFARHPVNAQCADLLLKKNPELKKILADSGFDCQDKTKNAELRKAIWTG-QSDLQLEDCQIEIAKIDAKGIWEQLKAYMPLFTLFQSDRKNSDSDDEVQDPMRIAVREILGDAKIQADLANVANTVKARLDQVAARTLAKLEEMNPAIATSLDPQLPDVASLKWADVFKSVSITADNDIPINKRGSGVKRLVLISFFRAEAERRQNEANLPVVYAIEEPETSQHPEHQRALTDALIALSKKNTQVLLTTHSPEIV 379
37 5.000e-95gi|763207148|ref|WP_044080397.1| ATP/GTP-binding protein [Prevotella sp. P4-65]  clstr ali  51  1MKIKSISIKNFRSYNETTISFDNLTAFIGKNDVGKSTILEALDVFFHDGKGSIKLDKEDINKNAIDSGDTDIVITASFKELPTSVILDETNSTTLQDEYLLNSDGCLQVKKTFKTTSSNIKVSLLANHPTNSECDKLLQKKQADLLKIIEKLGIECEDKRKNALMRKAIWNHFHDDLQLSDTEIDVSSKDGKSIWEKLQNSLPFYSLFQADRKNCDGDDEVQDPLKAAVKQILNDGELQRKLHDVAISVQETLQHVSDLTLAKLREMNPEIANSLHPNIN-FDNLKWSDVFKNVSISGDNDIPINKRGSGVKRLILINFFRAEAERKRSETTSSIIYAIEEPETSQHKEHQRLLMEALHDLSQNNTQVIITTHSSDIV 385
38 7.000e-95JGI.Meta 7045946590 SRS045645_Baylor_scaffold_2269__gene_3299 hypothetical protein [Human Stool microbiome from visit number 2 of subject 60  ali  53  10MLIKSVTLKNFRGYRETTVLFSNLTTFVGRNDIGKSTILEALDIFFNEGKGCISLDKEDINKRASNEGDDEVIIAVEFFKLPDSLVIDESNRTTLAAEYLLTESNTLKIVKRY-PKAGREKVYIRAKHPTNAVCCDLLSKKISDLKAILNRENIECEDQTRKAVIRAAIWNHFADNLNLEEKEIDVTKEDGKTIWESLKKFLPVYSLFQADRSNNDHDKEIQDPLKEAVKSILKEENVALMCQQIAEHVTTKLQEVSNHTLDKIREMNPELANSLSPNIPSFTDLKWSDLFKNVSIAGDNDIPINKRGSGVKRLILLNFFRAEAERMQSNESDGLIYAIEEPETSQHVAHQKILMKALIDLANNNVQVVLTTHSSYVV 389
39 1.000e-94JGI.Meta 7067749668 C3227556__gene_298645 hypothetical protein [Human Stool microbiome from visit number 2 of subject 159571453]  ali  52  1MKIKSVAIENFRGYQKAVVCFENLTSIVGRNDIGKSTIMEALDIFFHDGKGLIKLDKDDINKTGKKSGNTDITISVCFTELPQSVVIDSSNETTLADEFLLNKEGYLEVSKTFKNAATTATVAIRANHPTNPLCADLLLKKQAALNSIIDELGVECEDKRKNACLRKAIWNKYSSSNELKLDEIEIDVNDIKAIWGKLQTYLPYYSLFQSDRKNCDGDNEIQDPLKEAVKQIINDSDLQEKLDYVATEVRKKLQEVSDLTLAKIKEMNPEVADSLHPKVPLTQDLKWADVFKGLSITGDEDIPINKRGSGVKRLILLNFFRAEAERRQKENSQHIIYAIEEPETSQHKQHQKILVDALKTLSNSGVQVIITTHSSDIV 388
40 1.000e-94JGI.Meta 7027312228 SRS016331_WUGC_scaffold_33881__gene_33206 hypothetical protein [Human Supragingival plaque microbiome from visit number  ali  57  1MKLSNLKIKNFRGYKEIAIDFVDLTAFVGKNDIGKSTILEALDIFFNEGKGVVKLDKDDINKQALAEDDTEIVISVCFEELPISIVIDSTNETTLQSEYLLNSKNQLEIIKKYPNAG-KEKVFIKANHPINDDCKDLISKTQKDLQKIINDRSIECRDKTKNAVMRTAIWNN-SMDLQLSEIEIDVTKGETKTIWEKIQNYLPLYSLFQSDRKNSDGDSEVQDPLKEAVKQILNDSGLQTKFSEIATEVENKLKEVSDRTLEKLREMNPDVASSLNPVIPTAESLKWADVFKTVSIAGDGNIPINKRGSGVKRLILLNFFRAEAERRKNEANVPIIYAIEEPETSQHTEHQKKLISAFLSLAETNTQVIITTHSAALV 379
41 2.000e-94gi|493307529|ref|WP_006265051.1| hypothetical protein [Myroides odoratimimus]  clstr ali  52  1MKLHSIKLKNFRSYKETEIIFNDLTAFVGKNDIGKSTVLEALDIFFNDGKGNYKLDKDDINKSALFEGDNTIYISAVFTNLPSSITIDATNPTSFQNEYLLNTEGNLEIIKKYQNAG-VAKVSIKANHPTNSRCSDLLIKKNTEYRRIITQNEIQCDNQTINANMRTAIWNHFSDNLELEEIEIDTSKEDAKNIWEKIQIYLPQFSLFQSDRKNSDTDSEVQDPLRKAVTQILADREINAMFENIAQRVSNHLNEVSSATLAKLREMNSDIANSLNPVIPTANALKWADVFKNVSICGDENIPINKRGSGVKRLILLNFFRAEAERRQSGNSQSIIYAIEEPETSQHTDHQRLLIKAFKELSQDNTQVLLTTHSSVIV 382
42 3.000e-94JGI.Meta 7059294778 SRS024075_LANL_scaffold_24351__gene_79009 hypothetical protein [Human Stool microbiome from visit number 2 of subject 15  ali  56  1MKIDSMKISNFRGYENTEIKFNDLTVFVGKNDIGKSTVLEALDIFFNEGKGVVKLDKSDVNVENRRNENQETCISVIFKDLPDEIVIDSNVRTTLKDEFLLNEDSKLEVIKKYNNGGY-PKVFIKARHPSNSNCKDLLLKKNADLKKIVQQKQIVCENQSVNSLLRKAIWEHYSEDLSLQETEIDASKEDAKKIWDKLSNYMPVYSLFQSDRKNSDGDSEVQDPLKEAVKQIINDEELQQTLASVAKVVETKLKEVSGRTLEKLREMDPAVANSLNPVIPTADKLKWVDVFKAVSISGDEDIPINKRGSGVKRLVLLNFFRAEAERRAEEDNTGIIYAIEEPETSQHTENQKKLIEAFKSLSQGNVQVLLTTHSAFIV 380
43 3.000e-94gi|788199868|ref|WP_045785176.1| ATP-dependent OLD family endonuclease [Ralstonia mannitolilytica]  clstr ali  40  1MRLASLTLSNFRGYRETTISFDRLTTLIGRNDVGKSTILEALEIFFNNNI--VKIDSSDCHVSV---PGGTVEISCSFAELPATLVLDAQAETSLAAEYLLDADGNLTIKKTFRCTKPKEEVFVVALHPSAVNYGDLLELNNTALKKRLTDLQLDNDGLNSNPSIRQKIWGT-CPNLELTLREVPVGKEDGKKIWDKLSERLPLFALFQSDRSSRDSDAEVQDPMKLAIATAIAEPEVQARLNEVVNAVQTKALELAARTHAALCNIDPTLAGELTPEFK---AEPKWANLFSVTLAGDQGIPINKRGSGVRRLILVSFFRAEAERRHADASRGIIYAVEEPETSQHPHNQRVLLESFQDLAELGCQVLLTTHSP... 373
44 5.000e-94JGI.Meta 7080020717 C3023810__gene_193437 hypothetical protein [Human Supragingival plaque microbiome from visit number 1 of subject 7639011  ali  53  1MKIKTVKIKNFRSYKDVEIEFGNLTAFVGKNDIGKSTILEALDIFFNDSKGIIKIDKDDINKQALEINDTETIISVCFEELPANIIIDATNQTTLQAEYLLNLNGNLEIIKKYSNAG-KEKVFIKANHPTNDICKDLLQKKNNELQKIIRDNSISCNNQTINAVMRTAIWNHFNQNLELSEIEIDVTKGDTKSIWDKLQLYMPLYSLFQSDRKNSDGDNEVQDPLKEAVRQILNEETLKEKFNEIATEVRNKLQDVASRTLEKIQDMNREIAGSLTPIIPTTDSLKWADVFKSVSIAGDENIPINKRGSGVKRLILLNFFRAEAERRKAENIPSIIYAIEEPETSQHTEHQRKLIKAFLDLAETNTQLIITTHSAVLV 380
45 1.000e-93gi|490971554|ref|WP_004833348.1| hypothetical protein [Parvimonas micra]  clstr ali  55  1MKITSMKINNFRGYKEINIKFDDLTVIVGKNDVGKSTILEALDIFFNDGKGTIKLDKNDVNNCEAKDGNNEISIGVCFEDLPESVIIDSAVETNLESEYLLNNEGQLEVIKKY-QNGGSAKVYIKAKHPHNGKCSDLLLKKNPELKKMIKEEDINCDNLSVNSLMRKALWNKYSDDLQLKDCEIDVSKEDAKKIWEKLTLYLPVYSLFQSDRKNSDTDSEVQDPLKEAVKQIIKDESLQKKLSEIADIVRERIKEVSSRTLDKIKEMDKDIANSLNPIIPQAKDLKWQDVFKNVSISGDENIPINKRGSGVRRLILLNFFRAEAESRAENNDNANIYAIEEPETSQHTNNQCKLIDSLKALSRPKTQIIITTHSPNIV 380
46 1.000e-93 [KEGG:K07459]|[eggNOG:NOG70858]  ali  52  1MKIVSVKIKNFRGYEEVNIKFDDLTVFVGKNDVGKSTILEALDIFFNDGKGAVKLEKSDINVEERKKGNLETVISVCFEELPTEIIIDASAKTTLKEEYLLNSDGYLEVVKKYK-DGGSPKIFVRAQHPTNGKCNNLLLAKNLDLKKIVSQEKITCENQTINVELRRAIWKFYGDDLQLNDVEIDISKEDAKKIWEKLANYMPVYSLFQSDRKNSDGDDEVQDPLREAVKLILSGNDLKERLSKIAEEINSTLKDVADRTLEKIQEVDPNIAQNLKPVIPTSDNLKWQDVFKGVSIVGDDDIPINKRGSGVKRLVLLSFFRAEAERKSSDENTGVIYAIEEPETSQHAANQKLLIEAFKKLSRDKTQVILTTHSSNIV 380
47 2.000e-93 GL0146085 [Complete] locus=scaffold41603_1:5758:7353:-  ali  52  1MKIKSVAIDNFRGYQKAVVCFENLTSIVGRNDIGKSTIMEALDIFFHDGKGLIKLDKDDINKTGKKSGNTDITISVCFTELPQCVVIDSSNETTLADEFLLNKEGYLEVSKTFKNATTTATVAIRANHPTNPLCADLLLKKQAALNSIVDELGVECEDKRKNACLRKAIWNKYSSSDELKLDEIEIDVNDIKAIWSKLQTYLPYYSLFQSDRKNCDGDNEIQDPLKEAVKQIINDSDLQEKLDYVATEVRKKLQEVSDLTLAKIKEMNSEVADSLHPKVPLTQDLKWADVFKGLSITGDEDIPINKRGSGVKRLILLNFFRAEAERRQKENSQHIIYAIEEPETSQHKQHQKILVDALKTLSNSGVQVIITTHSSDIV 388
48 4.000e-93gi|918674617|ref|WP_052545045.1| hypothetical protein [Candidatus Saccharibacteria bacterium GW2011_GWC2_44_17]  clstr ali  52  1MRVTGLKLKNFRSYRDVSMSIDDLTVFVGRNDAGKSTLLEALDIFFNDKDACVKIEPDDLNKEAEENEDYEISISVTFSDLPNEVDIDAGNKTTLESEYLVNASGELEVKKVYKN-GKTDSVFLVANHPTSELSRELMQQKQSVLKKVITDNSIECSNQSINAIMRAAIRNH-EDDLQLQLTEISAKTEDTKKIWDSLQRYTPVYALFQSDRSNSDQDSEVQNPMKLAVKEIMQDPDLQDKFEQIFNEVESRTKDIANQTLEKLKEMNPEIANQLSPKLPKLEELKWADVFKSIGIVGDKEIKLNKRGSGVKRLVLLNFFRAEAERRKESRNVGVIYAIEEPETSQHPEHQKVLINALISLSSDNTQVILTTHSPAL. 378
49 1.000e-92gi|880989245|ref|WP_048712238.1| ATP/GTP-binding protein, partial [Carnobacterium maltaromaticum]  clstr ali  54  1MKIMSMKLNNFRGYREIDIKFNDLTAIVGKNDIGKSTILEALDIFFNDSKGAVKLDKNDVNKFNLEEGNAETTIGVCFGDLPQRVVIDASVETDLESEFLLNARGELEVIKKY-QNGGSAKIYIKAQHPSNPECADLLLKKNQDLKRVIADKGIECHNLTVNSIMRRVIWDNYRDDLQLEEREIDVSKEDAKKIWEKLTTFLPVYSLFQADRKNSDNDSEVQDPLKQAVKQILNEESIQRTLSEVADTVRERIKDVSNRTLEKIKEMDVDIANSLTPIIPQTDALKWTDVFKNVSISGDENIPINKRGSGVRRLILLNFFRAEAERLAENNSNSNIYAIEEPETSQHTHNQIKLISSLIDLSKEGSQIILTTHSPNIV 380
50 3.000e-92gi|748753006|ref|WP_040011121.1| ATP-dependent OLD family endonuclease [Cupriavidus sp. HMR-1]  clstr ali  39  1MRLQSISIRNFRCYRDETVVLSDLTTFVGKNDIGKSTVLEALEIFFNNE--TVKIDSSDANVFTDDKT---VAITCEFSDLPETLTLDAGAETTLAAEYLLTANGALKIRKTFDCSKKSCEVAILANHPTAPGVADLLDLKERDLQRRVEDQKLDVARKG-NPGMRQALWAAADLSLAEVEIHVTKPKEDSKRIWDQLEPHLPLFALFQSDRSSRDSDGEVQNPMKAA--VAAAIAEVQDDIERIQLKVREKAEQIARTTHEALKTIDPSLARELTPQFAPPTASKWTGLF-SVSLDTDDGIALNKRGSGVRRLILVSFFKAEAERRRGGTTRNIIYAIEEPETAQHPNNQRILIESFKGLSEPGCQIILTTHSP... 372
51 4.000e-92gi|1002437308|ref|WP_061385802.1| ATP/GTP-binding protein [Listeria monocytogenes]  clstr ali  53  1MKLKTVKIKNFRGYRETSTDFGNLTTFVGKNDIGKSTLLEALDIFFNDAKACVKIDKEDVNIYSSADDDNEIIISASFTSLPNTVVIDTTNTTTLESEYLLNDNGYLEVVKKYKNTG-KPKTYIRAFHPTNANCSDLLLRTNACLKDIVESNNIECEDKTKNAILRKAIWEYYNASLELQLIEIDVTRGDTKSIWDKLQTYLPIYTLFQSDRKNSDGDNEVQDPLKEAVKEILSDEKIQDTFRCITEEVTQKLSEVSNRTLEKLREMSQDTANTLEPLIPEFSSLKWGDVFKNVSITGDQNIPINKRGSGVKRLILLNFFRAEAERRLEVNASNVIYAIEEPETSQHSDNQKKLIDAFIDLSNPNTQIVLTTHSANIV 380
52 5.000e-92gi|759380073|ref|WP_043106796.1| ATP-dependent OLD family endonuclease [endosymbiont of unidentified scaly snail isolate Monju]  clstr ali  44  1MKLEKVSIKNFRCYKDVTISIDDLTTVISRNDAGKSTILEALEIFFNND--AVKIETGDANVYSKDNL---VSITCSFSEFPASLPIDATAETSLAEEYLLDSNGLLTVEKTYDCSKKKEEVFLIANHPSTPGFNNLHELKEKELQAKVKELGLDVPLKG-NPGMRKAIWAACE-DLNLEEQAIPVAKEDGKRIWEQIKVHLPMYALFQSDRSSRDSDGEVQSPLKAA--IAAALAEVENEIAEIQRQVRHKVEGIAKRTFDALKKIAPELAKELSPEFSEAPKSKWTGLF-SVSMNTDDGIPLNKRGSGVRRMILVSFFRAEAERRMEEGSRGIIYAIEEPETAQHPANQKILLDAFKALAESGCQVLLTTHSPEF. 372
53 9.000e-92 GL0034270 [Complete] locus=scaffold3302_2:9146:10714:+  ali  51  1MKLTKLIITNFRGYKNTEVGFNDITTFVGKNDSGKSTILEALDIFFNDGKGCIKIDNQDINIENKNGNDTDIAIEACFTDLPAEIVIDASNKTSLKNEYLLNDDGTLHIEKIFPNASSKAKVYIIAKHPNNPNCNDLMQLKIADLKKKVKELNIEDKDKTVSAAFRAAIWSYYDHELSLANRKIDVSKGETKSIWEQIEKYLPIYSLFQSDRSNSDSDNEVQDPLKHAVKEFLMEKDVQEKLNSIAQDVIRKLEDVSRRTLEKLQEMDASVANTLEPSIPDPNKLKWAEVFKSVSITGDEDIPINKRGSGVRRLILLNFFRVEAERKSGNSTASIIYAIEEPETSQHFQNQLLLVKAFKDLSSPNVQVILTTHSGNIV 389
54 1.000e-91JGI.Meta 7021223749 C3111606__gene_181425 hypothetical protein [Human Tongue dorsum microbiome from visit number 2 of subject 159571453]  ali  53  1MQLKAVKVKNFRGYKNVTINIEDLTVFVGKNDIGKSTVLEALDIFFNDGKGVVKLDKEDISKEGCSEGDNDIYITAIFTDLPNEIILDESNPTNFSEEYLLNKDGDLEIIKKYPNAG-SAKVFIRAEHPTNPLCSELHTKKITDYRKIIQDNSIECEDHTKNAMMRKAIWQHFLKELQLKEIEIDASKEDAKNIWEKIQDYLPIYTLFQSDRKNSDGDSEVQDPLKIAVKEILEDNTIKQMLEDISVKVTNRLKEVSESTLEKLRDMNSSIASSLSPVIPAPKSLKWQDVYKNVSIAGDNGIPINKRGSGVKRLILLNFFRAEAERRKTENSKSIIYAIEEPETSQHYAHQKILIESFKKLSKSNTQVILTTHSSTVV 380
55 1.000e-91JGI.Meta 7053660488 C2981280__gene_139588 hypothetical protein [Human Supragingival plaque microbiome from visit number 1 of subject 1607043  ali  53  1.....MKLNNFRGYREIDIKFNDLTAIVGKNDIGKSTILEALDIFFNDSKGTIKLDKNDVNKLNLSAGNAETTIGVCFEDLPETVVIDSSVETSLGSEFLLNARGELEVIKKY-QNGGSAKIYIKAKHPSNPECSDLLLKKNQELKKVITDKGIKCDNLTVNSIMRNVIWNHYKEDLQLEEREIDVSKEDARKIWEKLTISLPVYSLFQADRKNSDNDSEVQDPLKQAVKQILNEESIQRTLSEVADTVRERIKDVSNRTLEKIKEMDVDIANSLTPIIPQTDALKWTDVFKNVSISGDENIPINKRGSGVRRLILLNFFRAEAERLAENNSNSNIYAIEEPETSQHTHNQIKLISSLIDLSKEGAQIILTTHSPNIV 375
56 1.000e-91 GL0022001 [Complete] locus=C1493989_1:3940:5538:+  ali  49  1MKIKSVSISNFRSYKEVKIDFQDLTAIVGKNDIGKSTILEALYVFFHNGKELIKLDKDDINISERSNGDQDIRISVVFDSLPQNVVIDESNKTTLKDEYLLNKEGDLEVVKVFKNASTTDKVSIKANHPTNPDCYDLLSKKQAELQKIVDQLGLSCEDKRKNASLRAAIWKHYEDNLAESEIAVNAKDGDIKALWEKLQYYMPYYSLFQSDRKNTDGDDEIQDPLKIAVKQIFSDEELLKTLDDVAQKVRDKLQEVSDLTLTKIKEMNPDIANSLHPKVPTAQELKWADVFKSLSITSDEDIPINKRGSGVKRLILLNFFRAEAERRQKESNQSIIYAIEEPETSQHKDHQLLLIDALKNLSKSSSQVIITTHSSDIV 388
57 1.000e-91 GL0046007 [Complete] locus=C2352555_1:327:1892:-  ali  49  1MRLKSFSLKNFRGYRNVRINMSDLTVFVGRNDIGKSTILEALDIFFNDKSAVSPIELADVNKDAIINGDTETIFTAVFDNLPDSIIIDDTVSTTLQDEMLLDSNGCLTVVKKYQAAG-KPKIYIKANHPTNPNCNDLLLQKIADLKKKAN--GLDCSDRTKKALLRKAIWNHYANDLQLEEGEIDTTGDGLKDIWQKLDLYMPIYSLFQSDRSNSDKDKEAQDPLKEAVKEIFSEEAILDKLTEVANEVRNKLQTVTSATLGKIGEMNPEIAQTLNPSIPSVESLKWADVFKNVSITSDNDIEINKRGSGVKRLILLNFFRAKAERMHDSDHSDIIYAIEEPETSQHIHHQRMLIDSFKQIATNPHQIIMTTHSSHVV 378
58 3.000e-91gi|653076169|ref|WP_027326917.1| ATP/GTP-binding protein [Helicobacter pametensis]  clstr ali  52  1MKISQVKIKNFRSYKDETIDFNNLTAFVGKNDIGKSTILEALDIFFEGGI--IKIDPNDVNKECELSGDREIQIAVAFEDCPQDLILDTSNPTSLKEEYLLNKEGKFEIVKRYPSQSSKSKVFIRANYPTNEKCGDLHSLKITDLRKIAKENGIECSNLAKSAEIRKAIWNHYSQDLQLQEIEIDVSKEDAKSIWEQIEKELPCYALFQSDRSNSDKDDEVQNPLKSAVSQIFKSDKISDQLTKIASEVIKKLDEITTLTLEKLKDMNPEIATTLKPKLPKVEELKWQDVFKNVSISGDEDIPINKRGSGVRRLILLNFFRAEAERIKKEQKKSIIYAIEEPETSQHQEHQRKLIEAFKELANQGIQIILTTHSPSIV 381
59 4.000e-91 GL0059498 [Lack 5`-end] locus=C2078259_1:165:1709:-  ali  52  4MKIKSVKIKNFRGYRDICVDFDNLTVLIGKNDIGKSTILEALDIFFNEGNGIVKWDKSDLNVQAIENGENETIISVCFTELPENIVIDSTVQTDLSSEYMLNAAKDLEIIKKFKAS--KPAVFIKALHPTNPECCDLLLKKNDDLKNIADILDIECENLSTNSKIRKAIWEHFNSNLNLKEVEINIAKEDAKKICENLSSYIPQYSLFQADRRNSDDDSEVQDPLKVAVKEILTDQEIKDKLNSVADTVKERLQEVADRTLKKLNEMDSGIASTLHPVIPI-DKLKWSDVFKNVSISGDEEIPINKRGSGVKRLVLLNFFRAEAERRKESRHAGIIYAIEEPETSQHNNHQRMLITALKELSQPHTQILLTTHSAVLV 381
60 1.000e-90gi|500154571|ref|WP_011830572.1| ATP-dependent OLD family endonuclease [Methylibium petroleiphilum]  clstr ali  41  1MRLKSVAIKNFRCYEEATVQLDELTTFVGKNDIGKSSVLEALEIFFNND--VVKIEAGDANVYSGDSR---LSITCEFSDLPASLTLDAGAVTTLADEHLLTADGTLKIQKIYDCKTKTPEVFLVAHHPTADGVAGLLDLKEKELQALIKAKGLAVQLKG-NPGMRKALWDAEADLKIAEVTLALTKKEDSKRIWEQLESHLPMFALFQSDRSSRDSDGEVQTPMKAA--VAAAIAEVQDEIDLIQKRVKEKAEEIAQSTHKALKAIDPNLAKELTPQFTPPTTAKWTGLF-SVNMDTDDGIPLNKRGSGVRRLVLVSFFKAAAERRMASNTRSIIYAIEEPETAQHPNNQKILIESFKALAESGYQVLLTTHSP... 373
61 2.000e-90gi|822609066|ref|WP_046991963.1| ATP/GTP-binding protein [Arcobacter butzleri]  clstr ali  56  1MKIIKIKLENFRGYKEVTVEFNDLTVFVGKNDIGKSTILEALDIFFNDGKGIVKLDKDDINKQAKEQGNNETKITIVFDDLPNEIIIDSTNPTTLNQEYLLNNDGKLEVIKKYFNAGA-GKVFIKANHPTYPNCQDLLLKKIKDLQKILDDDNITCENRAKSAVVRKAIWEHYNNSLKLQEIEIDVTKEDAKNIWEQLKNYMPLYSLFQSDRKNSDGDSEVQNPMKLAVQEILKDVELQKKLLEVATEVHTKLQEIASNTLEKLNEMNPEIANSLSPVIPTAESLKWNEVFKSVSITGDDDIPINKRGSGVKRLVLLNFFRAEAERRKEQNTPSIIYAIEEPETSQHPSHQRKLIEAFIALSNDRTQIILTTHSPSIV 384
62 3.000e-90 [KEGG:K07459]|[eggNOG:NOG70858]  ali  53  1MQIKRATLKNFRGYKEVDIEFQNLTVFIGKNDVGKSTVLEALDVFFNDGKGVVNLDVNDINKVAFQEGDSEITISVEFENLPSEIVIDATNKTSLSDEYLLNSSGNLTIIKKYPNSTSKAKVYIKAMHPNNKKCNDLLSKRNNDLRKIIEQENIECSDRTVNATMRAAIWKHFEENLEITETEIDVTKEDAKNIWVNLQKYMPIYSLFQSDRSNSDNDKEVQNPLERAVQEIFRRTDIQEKLDIVASEVKEKLEEVSNRTLEKLREMNPEIADSLNPVIPNTENLKWASVFKNVSITGDNDIPINKRGSGIRRLILINFFRAEAERRIRENAPSIIYAIEEPETSQHAEHQKKLIEAF.................... 361
63 9.000e-90 GL0068941 [Complete] locus=scaffold16875_3:418:1962:+  ali  45  1MQIKSVIIENFRGYQRQTIAFDQLTAFVGKNDVGKSTILEALDIFFNDGAGPISLDVRDVNVDAKNAANVDVIIGVEFSEVPDYVVLDDNNQTSLADEYLLNSEDSLTIIKHYPNAG-KPKVFIYANHPSHPDCCALLHKKQTELRKLTIDIDC---DHNKNAEMRKALRQQHVNELNLQMQEIDVSKEDAKNIWEKLRNYLPVYCLFQSDRSNGDKDKEVQDPLKEAIKIIFSKQEIKEKCKEIYSAVINELEDVSSRTLNKLNEMNSHLASTLHPTMPSSDALKWIDVFKNVSITGDNDIPINKRGSGVKRMILLNFFRAEAERSQAERKAPIIYAIEEPETAQHIVHQQIMVKSLKELSHDSTQVVITTHSSVIL 380
64 2.000e-89gi|518131289|ref|WP_019301497.1| hypothetical protein [Xanthomonas oryzae]  clstr ali  42  1MKLKSMTVANFRCYKSLTVTFDDLTALVGRNDAGKSTLLDALDVFFNDKA----LDKNDASKG---GVAKAVTITCVFWDLPNELILDETASTSLGGEYLLNADGELEITKVYNCSIEKPKLTLKAVHPSAEKVKDLIALKIDELKARAEEVGVDMSNKTVKRDLRSAIRTKV-GQLETVVSDLLDDKSNSIKVWDGLKATLPLYALFKSDRQSSDQDSEAQDPLKIAIKEAVAAKAVE--LQAVMTFVEQEVKKVADLTLQKLKEMDAAVADTLAPKF---EKPNWATLIK-ASITGDDEIPLNKRGSGVRRLILLNFFRAKAERMRERGAQSTIYAIEEPETSQHPHNQRLLMRALQQLAVGDDQVIVTTHTPNL. 376
65 2.000e-89gi|330427797|gb|AEC19131.1| ATP-dependent OLD family endonuclease [Pusillimonas sp. T7-7]  clstr ali  40  20MRLESVSIKNFRCYEETTVSMVDLTTFVGKNDIGKSSILEALEIFFNNE--AVKIEQGDANIYSGSPL---VSITCEFSDLPSKLSLDAGAETTLTAEFLLSVEGTLKIQKVFDCGKPSVEVYILANHPTAAGVADLLDLKEKDLQKLVKDQKLDTALKG-NPGMRQALWAATKDLELKEVLPVTKPKEDSKRIWDQLESYLPMYALFQSDRSSRDSDGEVQNPMKAA--VAAAIAEVQDDINRIQEKVREKAELIAKITHEALKTIDPNLAKELTPQFVPPTAAKWTGLF-SVGMDTDDGIPLNKRGSGVRRLVLVAFFKAEAERRKAGTSRSIIYAIEEPETAQHPNNQRILIESFKTLAEPGCQILLTTHSP... 391
66 4.000e-89JGI.Meta 7076140858 SRS011310_Baylor_scaffold_16336__gene_22792 hypothetical protein [Human Buccal mucosa microbiome from visit number 1 of  ali  48  1MRIKSLILSNFRGYKECRVDFESFTAFIGRNDIGKSTILEALDIFFNDGKGTIKIDKEDINKKCSANGNTDICLSLVLDSLPPKIILDEAYETTLENEYLLNGEGCLEIKKVFKN-GASPKVFINAFHPSNPECCNLLSKKQKDLKTQVETIGAECEDKRVNAKLRSAIWSKFSEDLQETLIDVSTKDGDIKPLWEKLQNYMPFFSLFQSDRKYTDADEEVQDPMSIAVKQIMSSNEIQSHLDDVATKVRAKLEDVINLTLAKIKEMNPSVADSLSPKIPKTNELKWNDVFKKVSITGDKDIPINKRGSGVKRLILLNFFRAEAERRQERDGQHIIYAVEEPETSQHKHHQRLLVTALKSLSQSKAQVIITTHSADIV 384
67 1.000e-88gi|520879067|ref|WP_020310724.1| MULTISPECIES: hypothetical protein [Megasphaera]  clstr ali  53  13MYLKRFKLKNFRGYKEVEINFDDLTAFVGKNDSGKSTILEALDIFFNENKGTVKLDKDDLNIDCKDAGDVDIMMTAYFSGLPDSIIIDESNPTSLQDEYLLNKNNELEIKKVFHNASSSCKTYIIANHPQNSECNDLLCLKNGDLKKKIKGLGIDSDDLTKNAEIRQAIWKYYRDKLQLAESKIDISKEDAKKYWNKISTYLPIYSLFQSDRNNSDSDDEIQDPLKNAVKEIISSNVLQEEFEEVAAQVLDKLNEVASRTLEKLKEMDEETAKTLKPSIPDVKQLKWADVFKNVSIAGDEGIPINKRGSGVRRLILLNFFRAEAERKLEEQNENNIYAIEEPETSQHFSNQVKLVEAFKTLASNNVQVIMTTHSGTIV 398
68 1.000e-88gi|740993111|ref|WP_038776340.1| ATP-dependent OLD family endonuclease [Burkholderia pseudomallei]  clstr ali  40  1MRLESVSIKNFRCYQDVTVSIGDLTTFVGKNDIGKSSILEALEIFFNND--TVKIEQSDANIYSGDPF---VSITCEFSDLPDKLTLDAGADTTLSDEHLLSIAGTLKIRKIFDCDKKTPEVFILAHHPTAAGVADLLDLKEKDLQKLIKDQKLDVALKG-NPGMRQALWAAANLELKEVALPVSKPKEDSKRIWDQLENYLPMYALFQSDRSSRDSDGEVQNPMRAA--VAAAIAEVQDDINRIQAKVQEKAELIVASTHEALKTIDPGLAKELTPQFTPPTASKWTGLFA-VGMDTDDGIPLNKRGSGVRRLVLVSFFKAEAERRKTGTSRSVIYAIEEPETAQHPNNQRILIESFKTLSEIGCQMVLTTHSP... 372
69 2.000e-88 GL0057156 [Complete] locus=scaffold3317_1:1530:3119:-  ali  53  1MKLKRMTLENFRGYKSVSVTFDNMTAFIGKNDAGKSTILEALDIFFNDGKGLIKLDKKDINIDNQGTDLNEIRISLSFSELPKKIIIDETNETELSKEYLLNKYGELEIIKLLKPTDGKPKTFIRANHPANPNCKDLLLKKNKELAKITTELGIEC-NKVKNAEMRAAIWKYYHDDLQLEEYEIDTKDSDIKSVWEKLQTYLPYYSLFQSDRKNTDSDDEVQDPLKEAVKQILSSEELREQLRHIAEKVKRKLQEVSDLTLEKIKEINPEIANTLHPNIPSPESLKWGDVFKGLSIYGDD-IPINKRGSGVKRLILLNFFRAQAEKKKEKKSPSIIYAIEEPETSQHVEHQNMLIDALNSIAENDIQVILTTHSANIV 383
70 2.000e-88gi|951156849|ref|WP_057636886.1| OLD family endonuclease [Stenotrophomonas ginsengisoli]  clstr ali  40  1MRLEAVSIKNFRCYEEVRVELGDLTTFIGRNDIGKSTVLEALEIFFNDDL--VSMEQGDAHVH---NVGKDVSITCEFSRLPPTLTLDAGAETTLADEYLLANDGRLKIRKTFDCKSKKPSVLVIANHPTAADCANLLELKENDLQKRVRALGLDVALKG-NPGMRRAIWAAADLQLQEVAIPVGKSKEDVKRIWEQIEPHLPMFALFQSDRSSRDSDDEVQSPMKAA--VAAAIAEVQDDIARIQAKVREKAEEIAQNTHAALATIDPNLASKLTPEFSPPTPAKWQGLF-SLGLNTDDGIPLNKRGSGVRRLVLVSFFKAEAERRRTSIKRSIIYAIEEPETAQHPNNQRILIDSFKMLSEDGCQVILTTHSP... 372
71 3.000e-88gi|95111583|emb|CAK16303.1| hypothetical protein PSEEN3569 [Pseudomonas entomophila L48]  clstr ali  40  1MRLKTIAIKNFRCYEKVTIPIEDLTTIIGKNDIGKSSILEALEIFFNNE--TITIEQGDANISS---EDKSVEICCEFENLPTPISLDSGAETSLSEEYLLSSEGTLKIQKIFNCNNKKEEIFIIAQHPSTKGFENLLELKEKDLQARIKELKLDTPLKG-NPGMRKALWAAADLQLSETAIPTGKAKEDTKRIWEQIEIHLPLFALFQSDRSSRDSDTEVQSPMKAAISAAIA--EVQDDIANIQKKVQEKAEEIAHRTHEALKTLDINLANELTPEFSAPSPAKWTGLF-SIGLNTDSGIPLNKRGSGVRRLVLVSFFKAEAERRKSGSRRSIIYAIEEPETAQHPNNQRLLIESFKSLSEPGCQVILTTHSP... 372
72 6.000e-88 [KEGG:K07459]|[eggNOG:NOG70858]  ali  49  1MKIKSVKIKNFRGYKETEIFFNNLTVFVGRNDIGKSTVLEALDLFFNEGKGTVKFEKEDINVTSD---DKEYWIEVVFSEIPDEIILDATYKTSLKEEYMLNKNSDLDIIKKFNGSKCNAT-YIKAFHPINKECENLLNKKITELKSIIKADNVECSNLTICSVMRKAIWKHYENKLDFSEIFIDISSEDTKKIWQQLSNCLPIYFLFQSDRSNTDGDKEVQDPMKAAVAQFLKDTKIQETLNEVAEEVLLKLNEVSERTLEKLKEMDEDIAENLKPVIPSVESLKWADVFKNVSITSDDNIPINKRGSGVKRLILLNFFRAEAERRQEKSNGNIIYAIEEPETSQHFANQRLLAKALISLANTNTQVIMTTHSGVIV 378
73 9.000e-88gi|696392527|ref|WP_032965771.1| ATP-dependent OLD family endonuclease [Stenotrophomonas maltophilia]  clstr ali  40  1MRLESVSIKNFRCYEEVEVKLSDLTTLVGKNDIGKSTLLEALEIFFNSDL--ISMESTDANIRSGS---TDVQITCTFSELPSKLTLDAGAETTLADEFLLNPQGHLKIRKIYGCAAKKPEIFIIANHPTAQSVDNLLELKERELQAKVKELKLDVALKG-NPGMRRALWAATDLELAEKAIPVSKPKEDVKRIWEQIEPHLPIFALFQSDRSSKDSDDEVQSPMKAAVSAALA--EVQDDIARIQARVRDKAEEIAKHTHRALMTLDPNLASELTPEFTPPTAAKWLGLF-SVGLTTDDGIPLNKRGSGVRRLVLVSFFKAEAERRKTSSRRSIIYAIEEPETAQHPNNQRVLIDSFKSLAEDGCQVILTTHSP... 372
74 3.000e-87JGI.Meta 7046229079 SRS013158_Baylor_scaffold_16059__gene_47592 hypothetical protein [Human Stool microbiome from visit number 1 of subject  ali  51  1MKIKSVKIKNFRGYRDICVDFDNLTVLIGKNDIGKSTILEALDIFFNEGSGAVKWDKNDLNVQSTEKGENETIISVCFTELPANIIIDSTVQTDLGSEYMINTDKNLEVIKKFK--TQKPAVFIKALHPMNPECSDLLLKKNADLKNVANKLGIECENLRTNSTIRKAIWEHFNSDLNLKEVEIDIAKEDAKKIWENLSSYIPQYSLFQADRRNSDDDSEVQDPLKMAVKEILTDQEIKDKLNSVANTVKERLQEVADRTLKKLKEMDSGIASTLNPVIS-TDKLKWSDVFKNVSISGDEEIPINKRGSGVKRLVLLNFFAEAERRAEESRHTGIIYAIEEPETSQHNNHQRMLIGALKELSQPQTQILLTTHSAVLV 378
75 7.000e-87 [KEGG:K07459]|[eggNOG:NOG70858]  ali  52  1MLIKSIILKNFRGYKNTSVEFSNLTAFIGKNDVGKSTVLEALDIFFNEGKGIISLDKSDINKEANNEGDTEIIIGVEFHNLPNEIIIDTENTTTLKQEYLLNEAGHLTIIKKYPNAG-KDKVFIRALHPNNINCNNLLQMKQSDLKTKIKELGVKC-DKTKNAIMRNAIWNYYIDNLELKTTEIDANKDETKNIWEKLKAYLPVYSLFQSDRSNSDHDKEVQDPLKEAVKQIFKEEEVAKRCQEIAEIVTQHLCKVSGKTLEKLREMNPALANNLNSQIPSPSDLKWPDIFKSVSITGDNDIPINKRGSGVKRLILINFFRAQAERRQNESHAPVIYAIEEPETAQHVAHQLLLIDALKKLSEPDTQVIITTHNSFIL 379
76 7.000e-87JGI.Meta 7023601256 SRS015574_WUGC_scaffold_20458__gene_21513 hypothetical protein [Human Supragingival plaque microbiome from visit number  ali  54  1MKLKTLKIQNFRGYKEISIDIDNLTVFVGKNDIGKSTVLEALDIFFNDSKGIVKIDKEDINKTALKEGDNNIIISAIFTDLPEKIIIDSTHETTFSKEYLLNKNGDLEIIKKYPNAG-NAKVFIKSNHPTNEKCKDLLLKKLADYKKIIIENKIQCENQSINSIMRKSIWDHFSNELQLQEIEIDASKEDAKNIWDKIREYIPIYSLFQSDRKNSDSDNEVQDPLKEAVKQILKDGDIKEKFEYISKKVSNSLLEVSKSTLEKIKEMNPEIANTLNPNIPSNETLKWIDVFKNVSIIGDDCIPINKRGSGVKRLILLNFFRAEAERRAKESERPVIYAVEEPETSQHTDHQKILIRAFKELAENNTQILLTTHSPIVV 379
77 2.000e-86gi|955294800|ref|WP_058095729.1| hypothetical protein [Alicyclobacillus tengchongensis]  clstr ali  43  1MRLKELVLRNFRAFRDVRITFDDLTAFIGKNDAGKSTILEALEIFFNGGGPLVKMESADANIH---NTDRHVVIGCVFSDLPEKLVLDAQTYTTLAGEYLLNDNGDLEIHKIIDCKNPKEEIFAYALHPTADIVKDLLELTNSDLKKRAEQAGVDMADRRSNPALRSAIRDCV-GNLNIELCYVPLSKQDAKAVWDTIEKQLPRYALFQADRSSKDEDSEIQDPMKIAI--AEAIKSVKGTLEDIKETVRRQVTEVANRTLQKLKEMDPTLANELSPHFRA--EPRWDGLFK-LSLTGDDQIPINKRGSGVRRLILLNFFRAEAERKQKTGEHGIIYGIEEPETAQHPNNQTMLVSALTSLSQENCQVVLTTHVP... 374
78 2.000e-86gi|919308322|ref|WP_052804703.1| ATP/GTP-binding protein [Campylobacter jejuni]  clstr ali  51  1MKIIQVKIKNFRSYANEVIDFEDLTAFVGKNDIGKSTILEALDIFFDGG--VIKIDKNDINKECVKNGDNEIQISVVFDNYPKKLVLDASNLTNLEEEYLLNQNNKLEIIKKYPNAG-KPKIFLKAYHPTNEECKNLHSLKITDLKKITKEKNIMCDNLTKSAELRKAIWQHYSDNLQLQEVEVELNKEEAKSIWEQLERKLPHYALFQSDRTNNDGDNEMQNPLKSAVAQIFKDEKISDKLQAIAEEVINKLQEVTNLTLEKLKDMNPEIAKTLNPKIPTIEQLKWADVFKSVSIAGDEDIPINKRGSGVKRMILLNFFRAEAERKKNNNEKSNIYAIEEPETSQHQYHQRLLIEALEKLSKEGIQIIITTHSPSIV 378
79 4.000e-86JGI.Meta 7078436071 SRS014271_WUGC_scaffold_45094__gene_61177 hypothetical protein [Human Tongue dorsum microbiome from visit number 1 of su  ali  50  1MRIHSVKLKNFRGYEETQINFNDLTVIVGKNDIGKSTILEALDIFFNDGKGCIKPDNEDLNFDARSRGEDTFSISVEFSDLPKEIVIDSDAHTTLESEYLLNIDTRLEIKKIYSENGKLKATYIVAEHPSNENCSDLLTSKITDLRKILQIFNIECDNKATSNIIRKSIWTYFSKNLKLKTCDIPVDKEDAKKIWSGIYKILPTFVLFQSDRQNKDGDAEVQDPLKEATKRILKNEELQKELEDISEKVRAELKKVANATVNKLKKIDPAIANILKPEIPEATELKWADVFKSVSITGD-EIPINKRGSGVRRLILLSFFMAEADRKNSDRDDGNIYGFEEPETSQHSDNQRMLITAFKKISEDNKQVILTTHSGDIL 381
80 5.000e-86gi|490240294|ref|WP_004138558.1| hypothetical protein [Gardnerella vaginalis]  clstr ali  50  1MQIKTVKLKNFRGYKNTTINFENLTVLVGKNDSGKSTVLEALDIFFNDGKNIIKIDKNDVNVRSREDGDLETVISVVFTDLPKEIEIDSSFKTSLRREYLLNNDDCLEIIKKY-HDGGSPKVYIKAKHPTNENCSELLLKKNTSLKSIIKENNIECSNMTVNSIMRTAIWNYYEKHLKLREVEIDASKEDAKQIWDKLSIEMPVYSLFQADRSNTDSDSEVQDPLKEAVKRILSDPEIKAILERVSKKVLENLREVSNRTLEKLKDLNLEVATSLSPVIPTADKLKWFDVFKSVSISGDDNIPINKRGSGVKRLILISFFTSEAERLAKESKTSIIYAIEEPETSQHTNNQKTLIESFIKIAKEGAQVILTTHSAYIV 388
81 6.000e-86gi|1016255603|ref|WP_062956080.1| OLD family endonuclease [Thalassospira sp. MCCC 1A01148]  clstr ali  43  1MKLLSLEVENFRGYKDAKITFDDLTTLIGKNDIGKSTILEALEIFFNND--TVKIEQTDANVFSNSKT---VKITCEFSEHTEAIVLDSESSTTLRTEFLLTDHNTLKIQKLYDCSKKTPEVFIIADHPSVTGAENLLELKEKDLRDKVKSLGLDVSLKG-NPTMRKAIWEHFDLQLKETPIPVSKPKEDSKRIWEKIEILLPMFAIFQSDRASKDSDGEVQNPLKGAV--ATAIAETQTQIAEIEQMVREKSEEIAKLTHDALKQIDPNLAESLEPKFSPPAQSKWANLF-SLGMETNGNIALNKRGSGVRRMILVSFFKAEAERKLQSNSKSNIYAIEEPETSQHPSNQKILINSFKDLSTENCQVILTTHSP... 372
82 9.000e-86gi|740499523|ref|WP_038330391.1| ATP-dependent OLD family endonuclease [Empedobacter falsenii]  clstr ali  40  1MKLTSITIKNFRCYDETKVTIDDLTTFIGKNDIGKSTILEALEIFFNND--TVKIESGDANIYSGNN---EVTITCEFKDLPIELTVDASSPTSLADEFLLSSEGTLKIQKVFACGKATPTFYIIANHPTVAGADNLLELKEKELQAIIKQKTLDSSLKG-NPTMRKAIWNSFEDLELKEIIPVSKPKEDSKRIWEQIESHLPIFALFQSDRNSQDKDKEVQNPMKAAI--ATAIAEVKEDLEKIQNKVREKAEEIAASTHEALKTIDPKLASKLAPEFTPPTAAKWTGLF-SINMDTDDGIPLNKRGSGVRRMILVSFFKAEAERRKTSNKRSIIYALEEPETAQHPNNQKILIDSFRALSEENCQVILTTHSP... 372
83 9.000e-86gi|491549972|ref|WP_005407583.1| hypothetical protein [Stenotrophomonas maltophilia]  clstr ali  40  1MRLEAISITNFRCYGDIRVELDDLTTFVGRNDIGKSAILEALEIFFN--ADVVAMEQGDAHVHS---VDKTVSITCEFSELPPTLTLDAGADTTLADEYLLTLDGRLKIRKTYDCTSKKPEVLVLAFHPTAANYDNLLELKEKELQKRVKDLGLAVALKG-NPGMRRALWAAAGDLKLQEVIAVGKSKEDVKRIWDQIEPHLPMFALFQSDRSSRDSDSEVQSPMKAA--VAAAIAEVQDDIARIQTKVREKAEEIAKNTHRALTTIDPNLASELTPEFSPPTAAKWQGLF-SLGLNTDDGIPLNKRGSGVRRLVLVSFFKAEAERRKTSTKRSIIYAIEEPETAQHPSNQRILIDSFKVLSEDGCQVVLTTHSP... 372
84 1.000e-85JGI.Meta 7046427196 C2866868__gene_165050 hypothetical protein [Human Tongue dorsum microbiome from visit number 2 of subject 763840445]  ali  53  1MRMTSMKINNFRGYEEINIVFDNLTAIVGRNDVGKSTILEALDIFFNEGKGTIKIDKNDINNYAFKEGNDETSITVCFADLPKNVIIDSSVNTNLTEEYLLNHQGQLEVIKKYKN-GGSAKVYLKANYPHNKKCSELLIKKNSELKKIISNENIPCENVTINSLMRKAIYNRYKNDLQLNECEIDVSKEDAKKIWDKLKLYLPIYSLFQSDRNNSDTDSEIQDPLKAAVKQILQDESLQIKLSEIANIVRERITEVSSRTLNKLQEMDKDIADSLNPIIPKTEELKWQDVFKNVSISGDEDIPINKRGSGVRRLILLNFFRAEAERRAENDNTTVIYAIEEPETSQHTNNQFKLISSLKSLSNSKTQILITTHSPNIV 380
85 2.000e-85 GL0071378 [Lack 5`-end] locus=scaffold77630_3:13:1560:-  ali  52  2MKIKSVKIKNFRGYRDERVDFDDLTVLIGKNDIGKSTILEALDIFFNETSGVVKWDKSDLNVQSAEKGENEAIISVCFTELPANIIIDSTVQTDLGSEYMINADKNLEVIKKFK--TQKPAVFIKALHPTNPECSDLLLKKNVDLKNVANKLGIECENLRTNSKIRKAIWEHFNSDLNLKEVEIDIAKEDAKKIWENLSSYIPQHSLFQADRRNSDDDSEVQDPLKIAVKEILTDQEIKDKLNSVADTVREKLQKVANRTREKLKEMDSGIASTLHPVID-TNKLKWSDVFKNVSISGDEDIPINKRGSGVKRLVLLNFFRAEAERRAEERNTGIIYAIEEPETSQHNNHQRTLIAALKELSQPHTQILLTTHSAVLV 379
86 3.000e-85JGI.Meta 7075251695 C68838__gene_2347 hypothetical protein [Human Posterior fornix microbiome from visit number 2 of subject 159247771]  ali  50  1MQIKTVKLKNFRGYKNTTINFENLTVLVGKNDSGKSTVLEALDIFFNDGKNIIKIDKNDVNVKSREDGDLETVISVVFTDLPKEIEIDSSFKTSLRREYLLNNDDCLEIIKKY-HDGGSPKVYIKAKHPTNENCSELLLKKNTSLKSIIKENNIECSNMTVNSIMRTAIWNYYEKHLKLREVEIDASKEDAKQIWDKLSIEMPVYSLFQADRSNTDSDSEVQDPLKEAVKRILSDSEIKAILERVSKKVLENLREVSNRTLEKLKDLNLEVATSLSPVIPTADKLKWFDVFKSVSISGDDNIPINKRGSGVKRLILISFFTSEAERLAKESKTSIIYAVEEPETSQHTDNQKTLIESFVKIAKEGAQVILTTHSAYIV 388
87 6.000e-85JGI.Meta 7067759619 C3236568__gene_308596 ATP-dependent endonuclease of the OLD family-like protein [Human Stool microbiome from visit numbe  ali  44  1MKLKTIYLKNFRCYKDVRIEFDDLTTFVGKNDIGKSTILEALEIFFNNDL--VKIEPSDANIHGDNN----VVITCDFCDLPSELILDSGEITNLADEYLTISNDTLRIKKVYDCSKSKSTVYIVANHPNVVEAKDLLSLKEKELQKIIKDKGID-GPLKGNPLMRKAIWASIEDLHLVTEIEVSKAKEDGKEIWTKIDAYLPNYALFQSDRSSHDSDGEVQNPMKVAIQAAIS--EVEEEINSIQKKVQDKAMAIAQQTQEALKYIDSNLANQLTPKFTPPAASKWNSLF-SIAMDTDEGIALNKRGSGVRRMILVGFFKAEAERKLNSKKKNIIYAIEEPETAQHPNNQRILINSFKELSKEKCQVILTTHSP... 371
88 7.000e-85gi|919202059|ref|WP_052757560.1| hypothetical protein [Sphingobium chungbukense]  clstr ali  40  13MKLASVSLHNFRSYRDVTVKIDDFTTVMGRNDVGKSTVLEALEIFFNQ--QVVKLDQADPCVHGADKV---VEISCTFDEFPNALTLDEQSQTSLEAEYLLNCEGLLEIVKRFDCKGAKPKVFARALHPSAAELADLLQLKNTALKERAASVDLTGVDKRSNVALRAAIRDRVGVGDL-EIRLVPLAEDEAKKVWVQLQRELPTFALFQADRASTDDDREVADPMKIAV--AAAMKEIEAELEQIKLKVQTSVMDVAQRTLAKLREMDPLLAQQLTPTFK---AEPKWDSFK-LSLTGDDQIPINKRGSGVRRLILLNFFRAEVERRRESSTRRVIYAIEEPESSQHPNNQIMLVRALLALAEDNTQVLMTTHVPAI. 384
89 8.000e-85gi|740439256|ref|WP_038271265.1| hypothetical protein [Xylella fastidiosa]  clstr ali  41  1MKLSAVILENFRGYQSTRIEIDDLTAFIGKNDAGKSTILEALDIFFNDGKPER----SDACVH---GTGTTIRISCAFDSLPSEIVLDTAARTSFAAEHLLNEKGELEIVKEWDASAKKESVFAAAQHPSNANAADLLILKNSELKARVKKLGIDESTVTINGSMRQAIRDA-CQPLTLERKLVPLDKEDAKKVWDQLKLQLPMYALFRSDRPSQDGDEEVQSPLKCAITQAL--KEMADDLRKIEDSVRSRAEDVAKRTLEKLNEMDSRLASELKPFFKTDPKWDVFK----FGLVGDNNIPINKRGSGVRRLILLNFFRAEAERRREKGALSVIYAIEEPETSQHPDNQRLLVQALKELADENTQVLVTSHTP... 368
90 5.000e-84gi|504852958|ref|WP_015040060.1| hypothetical protein [Bordetella parapertussis]  clstr ali  43  1MKLSAVILENFRGYQRTRIEIDDLTAFIGKNDAGKSTILEALDIFFNDGKPERG----DACVHST---DTMIRIGCAFASLPTEIVLDAAAHTSLAAEHLLNEKGELEIIKEWDSSAKKESVFAIAMHPTNADATDLLTLKNSDLKARVKKLGIDESSLAINGSMRQAIREACHPLTLERKS-LPLDKEDAKKVWEQLRPQLPMYALFRSDRPSQDGDEEVQSPLKFAITQAL--KELADDLKKIEDAVRLRAEDVAKRTLAQLNEMDGRLASELKPFFK---ADPKWDVFK-FGLVGDNDIPINKRGSGVRRLILLNFFRAEAERRREKGALSVIYAIEEPETSQHPDNQRLLVQALKELADENTQVLVTSHTP... 368
91 9.000e-84gi|896179050|ref|WP_049191699.1| ATP-dependent OLD family endonuclease [Serratia marcescens]  clstr ali  42  14...........RAYDEVSVELDDLTTFVGRNDIGKSTILEALEIFFNNS--VVSIEKGDACIHSGQ---ENVEITCEFTDLPPSLTLDSGAETTLAEEFLLSSTGSLQIRKIYNCSNKKPEIFVIANHPAAAGFQNLLELKEKELQARVKDLGLDVPLKG-NPGMRKAIWASADLRLTETLLAVGKAKEDTKRIWEQIESWLPMFALFQSDRSSRDSDDEVQSPMKAAITAALA--EVQDDIARIQLRVQQKAEEIARNTHEALKTIEPGLARELTPEFTPPTPAKWQGLF-SVGLNTDGGIPLNKRGSGVRRLVLVSFFKAEAERRKSSNRRSIIYAIEEPETSQHPNYQRILIESFKSLSEAGCQVILTTHSP... 373
92 1.000e-83gi|921991723|ref|WP_053281619.1| hypothetical protein [Comamonas testosteroni]  clstr ali  40  1MKLKSISLANFRGYKNITINLDDLTTLIGRNDAGKSTLLDALDVFFNDKAL-------DKNDASKGGNSKAVSITCVFGNLPDELVLDETVPTNLGSEYLLNADGNLEITKIYNCSIEKPKLYLNIFCPAAEKARDLISLKIEELKIRAEEVGVDMGNKTVKRDLRAAIRSKVGPLHPIQIGEEVNEKGNAVKVWDGLKSALPLYALFKSDRQSSDQDAEAQDPLKTAIKEAIAIKAPQ--LQEVMSFVEQEVKKVADLTLKKLREMDASIAATLDPKF---EKPNWSTLIK-ASITGDDEIPLNKRGSGVRRLILLNFFRAKAERMHEKSAQSTIYAIEEPETSQHPHNQRLLMSALQQLAIADDQVIITTHTP... 374
93 4.000e-83gi|916316551|ref|WP_051051597.1| hypothetical protein [Paenibacillus sonchi]  clstr ali  43  1MKLKRLIIKNFRSYKDIQIPIDDFTALIGKNDIGKSTILEAMEIFFNNKL--IKLESTDACVH---NTDKEVVIGCVFSDFPQEVILDSQSSTTLADEYLLNSQGELEIHKIYDCSLKKETIYTLCYHPQAQNAIDLIKVKNPELKKRAKELSIDTIDQRSNPDLRHAIRLQIS-DLQLKEQLISLNEENAKSIWGSLEKFLPQFALFQADRPSKDEDSEVQDPMKFSIEQAI--KTVEHDLEQIKETVHRQVMDVATRTLEKLRQMDPALATELAPQFKS--EPKWEGLFK-LSLTGDDQIPINKRGSGVRRLVLLNFFRAEVERKQASGAPGVIYAIEEPETAQHPNNQKMLIEALLELSQENCQVMITTHVP... 371
94 7.000e-83gi|519019243|ref|WP_020175118.1| hypothetical protein [Methyloferula stellata]  clstr ali  40  1MFIKTIILENFRAYKRTIVPVSNLTAFIGKNDAGKSTLLEALDIFFEGG--TVKIESADASKGGDS---KNVRIGVVFADLPAELILDSKAPTRLANEYLLNGDGDLEIHKAFNCALPKATVFAHAVHPTAPDVAQILQKAQKDLKAIIKDKRLENNNQTENPSMRYAIYQA-HADLQLQSRDVPLNEDNGKAIWSSLQNYIPIFALFQSDRPSNDQDPEVQNPMKVAIELALDQ--LVTELDAITDQVRQKAQETAERTLAKLQATFPNLASTLQPKFKKPP----WKNIFKLDLEADDGIPLNKRGSGVRRLILLSFFQAEAEKRRVDPGRRVVYAIEEPETSQHPDSQEQIIRAFRELAEAGDQVLLTTHVPAL. 375
95 1.000e-82gi|983703414|gb|KWV60186.1| hypothetical protein AS156_30060 [Bradyrhizobium sp. BR 10303]  clstr ali  40  1MRLTKLKLENFRCFKDVCIEFDDITAIVGRNDVGKSTIMDSLAIFFEEAKP----DKDDACLSGDR---KAVRITCEFDDLPEKIILDADYETSLEAEYLVNLDRRLEVRKTFDGSLATPKVEAVAVHPTGSGVNDLLQLKKADLVARATELGIDLSNKQANAPIRAAIWGGTQALKLDLVP-VSLEKEGGKQVWTALAPYLPAFALFKSDRASTDQDAEAQDPLKAAIRDAL--KAVEQDLAKIQAHVEAEVRRIAEATVEKIKEMDASVAQTLNPVVTT----KKWDSLFQTSITGDEGIPLNKRGSGVKRLVLLNFFRAKAEKAAERQAGSVIYAIEEPETGQHPRNQRMLMSALSDLSATGRQVIVTTHTP... 369
96 2.000e-82gi|639166815|ref|WP_024506591.1| hypothetical protein [Bradyrhizobium sp. ARR65]  clstr ali  41  1MKLTSLKLENFRCFKDVCLEFDDITAIVGRNDVGKSTIMDGLAIFFDEAKP----DKDDACISGDR---KAVRITCEFDDLPETIILDADYETNLDAEFLVNTERRLEIRKTYDGSLTNISVEAIAVHPTGNGVNDLLQLKKADLLARAGELDLSTVNKQANAPIRAAIWANTNA-LGLDVVPVSLEKEGGKQIWSALAPYLPSFALFKSDRASTDQDAEAQDPLKAAIRDAL--KAVEQDLVKVQAHVEAEVRRIAEATVLKIKEMDASLAEALSPVVTT----KKWDSLFQTSITGEDGIPLNKRGSGVKRLVLLNFFRAKAEKAAERQAGSVIYAIEEPETSQHPRNQRMLMSALSDLSATGRQVVVTTHTP... 369
97 2.000e-82gi|982030717|ref|WP_060205225.1| hypothetical protein [Burkholderia cepacia]  clstr ali  40  1MLIKAVVLENFRAYRATVIPISQLTGLIGRNDAGKSSILEALDIFFEGG--TVKIDSADASKGGDSR---NVRIGVVFGDLPDRLVLDSNAPTTLQNEYLLNDAGDLEVVKVFNCANPKATIFAKAVHPTAPEASDILQKSQRDLRTLIRERGLQNNNQAENPSMRLAIYQSI-GDLQTRLREVPLNDENGKEVWKSLQSYMPIFALFQSDRPSNDQDPEVQNPMKLAIEQAL--EALEQKLEEITSQVQQKAQETADRTVAKLKETYPDIASTLQPKFKRPP----WKNVFKLDLEADDGIPLNKRGSGVRRLVLLSFFQAEAEKRRADAVAGNVYAIEEPETSQHPDNQQQIIEALRALADAGDQVILTTHVP... 373
98 3.000e-82gi|950561577|ref|WP_057431200.1| hypothetical protein, partial [Pseudomonas syringae]  clstr ali  41  1MRLKSLKIKNFRSYQEKEIIFGDMTALIGRNDVGKTTILDALGIFFGHKLC--KFEPGDKCVYAGEN--EDVVITCTFDDLPNELVLDATSTTSLTEEYLLTAEGTLSLSRVFSKGKGAGVVVATCLHPSAKNTKGILLKKNEELKSLAQSLNIQAEDNRSNVSLRSAIYKAT-GDLKLKEQNVSLNKEDGKEILEKIQNHLPHFALFRADRPSTDEESEVQDPMKVAISQAL--EDIAPQLEAVKDQVRDRALAVANNTLSHLSDLDPELALSLTPEFKA--DPKWEGIFK-LSLAGEDNIPINKRGSGVRRLVLISFFKAEAERIKREQDRGVIYAIEEPETSQHPDKQRLLVEAFSEMAKKGCQIIITTHVPAL. 370
99 6.000e-82JGI.Meta 7009779341 SRS022137_LANL_scaffold_3612__gene_9133 hypothetical protein [Human Stool microbiome from visit number 1 of subject 6387  ali  50  2.....................SDFVAIVGKNDIGKSTILEALDIFFNDGKGIIPIDKHDVNKKNLANGEDEIIIGVEFDDSYE---------TTLVDEYLLTADGTLCILKKY-PNGGKPKIYIVANHPTSQDCNDLLNKKIKDLKAIVEKLNIDC-DKTKNAVMRKAIWDHYHDSLNLSQREIEVSIDGLKDIWPKISGYMPIYCLFQSDRSNNDKDKEAQDPLKEAVKLILGDLTIQTKLQEIADVVTQQLRQVTDSTLDKLREMNGEIASALSPQIPNAKDLKWADVFKNVAITSDNDIPINKHGSGVKRLILLNFFRAEAERRSSHSNVNVIYAIEEPETSQHLNHQLMLVEALKSLSKTYAQVLITTHSAHIV 349
100 6.000e-82gi|488049420|ref|WP_002120817.1| MULTISPECIES: ATPase AAA [Acinetobacter calcoaceticus/baumannii complex]  clstr ali  42  1MKLVSIEIKNFRCYENILISFDNLTTFIGKNDIGKSTILEALEIFFNNS--TVKITQDDLNINST---DTDVIITCEFSDLPPKIILDSGVETNLKDEFLVNKNDNLKIKKVFDCSKKNVEVFINAYHPTAIGFDNLLELKENDLKKIIRDGNIASTLKG-NPLMRSAIWSSCSDLCLEKDIPVSKPKEDIKKIWEQLEKYLPIFALFQSDRSSKDSDGEVQDPMKAAI--ATAISEVRDDIEKIQEKVKQRTEEIARKTHKALESIDKNLASQLTPEFTMPTNSKWVGLFNVGLNTDD--IPLNKRGSGVRRLVLVSFFKAEAERLSEKNKQSIIYAIEEPETAQHPNNQKILQSAFVALANDNCQVLLTTHSP... 371
101 7.000e-82gi|973087107|gb|KUK47584.1| hypothetical protein XD74_1811 [Actinobacteria bacterium 66_15]  clstr ali  41  1MRLKAVALRNFRGYKEVRIPISDLTSLIGRNDVGKSSILDALAIFFD--SPLVKFDASDLCVYA---EDQEVRIGCVFDELPDTLMLDVTSITNFKEEYLLNEDSDLEISKVFDCSLKKPRIVARAMHPTADGYADLLQVTNSGLKGRLKEKNIDVDDQRSNPSIRKALWDSCD-DLRLSLTETELNKEDAKKIWDQIQKYLPIFALFRADRPSTDEDSEVQDPMKIAVQQAIS--ELADQLRQIQDQVRDAAMDVAKRTLGKLQDLAPDLAKELTPTF---RADPKWDSLFKLALTTDDQIPVNKRGSGVRRLILLGFFXXXXXXXXXXXXXSNIYAIEEPETSQHPSNQRMVIDALKDLASTNCQVVITTHVP... 372
102 1.000e-81gi|922781793|ref|WP_053379495.1| hypothetical protein [Nitrospira moscoviensis]  clstr ali  42  1MKLARLRIRNFRCYKDIAFDFDQLTAFIGRNDVGKSTVMDALDIFLNDGAP-------DKNDASKSGDAKDLTIICEFSDLPTAAVIDEDFPTTFEAEYLLNAEGRLEIHKTYSGHTATPKIGAFAIHPTADIASDLLQLKNPELKQRAKELKIDGIDLKINAQLRQRIREAI-GDLKLQPSFVPLHEENAKKAWEGIRAHMPVFALFKSDRASTDQDPEAQDPLKAAVKEAIKEKE--HELNAIVTHVETEVRRIAQKTLEKLREMDSSLAQKLTAQFT---APKWESLFK-ATIAGDDDIPINKRGSGVKRLILLNFFRAKAEMQRERDGAPIIYAIEEPETSQHPHNQRMLVSALMDLATQN-QVIITTHTP... 367
103 1.000e-81gi|902806081|ref|WP_049675153.1| hypothetical protein [Desulfocarbo indianensis]  clstr ali  41  1MRIVKIKLRNFRCYKDTEFEIQDLTIFAGRNDSGKSSILDALNIFF----KEAEMDPDDASIGGD---AKDVRITCEFDDLPEKLILDADYATNLSQEYLVNSSGRLEIIKQYNASIQKPKIYAKAMHPTKDGLSDLLYLKNADLKKRTADKGIDDTDKRVNSKIRKLLWDS-DPESELGEVLIELEKDEAKKIWAQLKTSLPCYALFKSDRASTDQDDEAQDPMKAAIKEAIKAQEAE--LDAIAKRVEQNVVAIAELTTKKLKEMHPSLANQLNPKFKTS----SWASVFKVSLTGDDEVPINKRGSGVRRLILLNFFRAKAEQMAKEKGSSVIYAIEEPETSQHPHNQKMLMRAFMDLSESDCQVLLTTHTPTL. 371
104 5.000e-81gi|940337594|ref|WP_054963335.1| lantibiotic ABC transporter [Vibrio bivalvicida]  clstr ali  44  1MKLEVVKLKNFRGYGEVTIPINDLTAFIGRNDAGKSTVLEALEIFFNNSI--VKCEKDDLNINAENNL---IEITCIFGELPEQLVIDSAFPTSLAEEHLLNSDQKLEIKKVYSATNPKEKTYIICMHPTVTSASDLLTLKRTDLRARANQIGVDAYNASINASIRQAIRENIE-DLDLSHTELLVDKEDSKKVFDSIKSYLPLYALFQSDRPSKDDDKEVTDPMKIAVQQALA--ELSDEIEHIKNEVREKAIETANRTLAKLHEMSPDLADELIPEFKT---EPKFDSQFKLAIKSENDISINKRGSGVRRLILLNFFRAEAERRRSINEGSNIIFFEEPETSQHPDHQRMLIEAFMELSNTNSQVMLTTHTPSL. 373
105 6.000e-81gi|918247414|ref|WP_052378408.1| hypothetical protein [Polycyclovorans algicola]  clstr ali  41  1MRLVEVKLANFRGYQETTMPIDPLTVLIGRNDAGKSSVLDALDIFFNE----ATIEKEDCCVGTT---ATEIRIACVFEDLPAQLVIDDQHPTTLQAEHLVRSDGRLEIIKVYNCAAAKGKVMAKALHPSTQGTDDLLGLKITELRSRARQVDLSQTNQTIKTQLRSAIWGQAD-DLERVEREVGLSKETGKEVWEQLQTHMPVYALFKSDRASTDQDAEAQDPLKSAIKEAIRRRE--TELNDVIGDIRRELERVAGRTVEKIREMNHELANQLHPAVKN----KNWDSLFTVTLTGENDIPINKRGSGTRRLVLLNFFRAKAEDDSLTKGGGVIYAIEEPETSQHPNYQIMLLEAFEDLVDQGCQVLLTTHTPTL. 370
106 7.000e-81 GL0100984 [Complete] locus=scaffold13103_1:3080:4897:+  ali  44  1MKLKTIYLKNFRCYKDVCIEFDDLTTFVGKNDIGKSTILEGLEIFFNNDL--VKIEPSDANIHGDNN----VVITCDFGDLPSELILDSGEITNLTDEYLTISNDTLRIKKVYDCSKSKSTVYIVANHPNVVEAENLLSLKEKELQKIIKDKGIDCPLKG-NPLMRKAIWASIDDLHLETEIEVSKAKEDGKEIWTKIDAYLPNYALFQSDRSSHDSDGEVQNPMKVAIQAAIS--EVEEEINAIQKKVQDKAMANAPQTQEALKYIDNNLANQLTPKFTPPAASKWNSLF-SIAMDTDEGIALNKRGSGVRRMILVGFFKAEAERKLNSKKKNIIYAIEEPETAQHPNNQRILINSFKELSKEKCQVILTTHSP... 371
107 9.000e-81gi|736771431|ref|WP_034774849.1| hypothetical protein [Idiomarina salinarum]  clstr ali  38  1MRLKSLTIENFRAYQHTTVEFTDMNGLIGRNDVGKTSILDALGIFFGHKLCKYDF--GDKSVYAGKE--DDVVITCEFDALPGELIIDTASTTSLQQEYLVTERGTLSISKVFNKGKGNGTFVANCLHPSAKNAKGILLKKHDDLKQLAGSLGVVATDNRSSASLRTAIYESIDDLKLKA-QQVALSKEDGKKILEQIQNHLPHFALFRADRPSTDEEAEVQDPMKMAITQAI--ESLTPQLEEIKEQVKYRALAVAESTLSHLSELDPELATSLTPDFKA--DPKWEGIFK-LSLSGDDNIPINKRGSGVRRLVLISFFKAEAERIKQQQDRGVIYAIEEPETSQHPDKQKLLVEAFCEMAKDGCQIVVTTHVPAL. 370
108 1.000e-80gi|503094902|ref|WP_013329720.1| hypothetical protein [Methanolacinia petrolearia]  clstr ali  42  1MKLISVTLKNFRCYLDETIQIQDLTTIIGKNDIGKSSVLEALEIFFNNDS--VKIDSEDCHLSASEKI---VEITCEFDDVPDEIIIDSNAYTTLPKEYLLTADKTLRIKKIFKCTKPKEEIFICSCHPTTKNYEDLLELKITELKKRLDDLSIEGINLSSKPSIRHAIWKS-CPNLNTAYTEIPVTKEDSKTIWDKINESLPIYALFQSDRNSRDSDPEVQDPMKIAITTALSDPSIQTKLNEVQDAVKIKAVELAERTQEALKKIDAELADELKPEFK---ADPKWAGVFSLVLKDDKGISVNKRGSGVRRLILVSFFRAEAERQKENNNQSIIYAIEEPETSQHPDNQRILLDSFKDLAENGCQVILTTHSPSF. 375
109 2.000e-80gi|700402608|gb|KGO32869.1| hypothetical protein JT06_17855 [Desulfobulbus sp. Tol-SR]  clstr ali  41  1MFLREVILKNFRGYKNEHIPIDQLTAFIGKNDAGKSSIFDALAVFFDHSLG--KIDASDICVHAGANG--ELRIGCVFSDFPDSITIDASSVTTLAEEHLLNVDGLLEIHKVYEFSDKRPKVFAIANHPTANGFDGLLSKKNVELKKAGEAANIDAGDKRSNAALRKAIWGSADDLKLGH-SEIQLDKEDAKAIWEQLSKYLPEYALFRADRPSTDEDSEVQDPLKVAIKQAI--EEVQAELDAVKEKVKARTLDVANRTITKLADFDSALSSQLNPNFKS--DPKWDGLFK-LSLTGDDEIPINKRGSGVRRLVLFSFFRAEAERLREEHKKGNIYAVEEPETAQHPDNQRKVIEALQAIAEDGCQVMLTTHVPAL. 374
110 6.000e-80gi|805352294|gb|AKB32609.1| putative ATP-dependent endonuclease, OLD family [Methanosarcina siciliae HI350]  clstr ali  41  1MLLKEIILKNFRGYRNEHIPIDQLTAFVGKNDAGKSTIFDALAIFFEH--PLGKIDASDVCVHA--DCSCEVIIGCVFTDFPEEITIDTTSSTSLSGEYLLNHDGELEIHKIYECSNGKIKIFAVANHPTADGCSGLLSKKNADLKKLGDSVGIDTSDKRSNVALRKAIWEKYE-DLQLQVVKVQLDKEDAKVIWDKLFKYLPEYALFRADRPSTDEDAEVQDPLKVAIKQAIQ--EVQSELDTVKDKVQLHALDVAKRTLIKLSDFDSKLASELTPVFKS--DPKWDGLFK-LSLTGDDGIPINKRGSGVRRLVLFSFFRAEAERLKEEKKGNIIYAVEEPETAQHPDNQRKIIETFQSIAEDGCQVLLTTHVPVL. 374
111 8.000e-80gi|670478671|ref|WP_031427108.1| ATP-dependent OLD family endonuclease [Leeuwenhoekiella sp. MAR_2009_132]  clstr ali  42  1MNLKSITIKNFRAYQNTKIEFDQLTTIIGRNDIGKSTILEALEIFFNN--QTIKIDSSDPNIHSTSKI---VEITCEFTDYPAEISIDTSSPTNLKDEYLLSTDETLVIKKKFDCGKKTPSIFIIANHPTEKEVSNLLELKEKDLQAIIKSKSLDSKLKG-NPTMRKAIWESISELKLQTIIPVSKPKEDAKRIWEQIDSYLPIFALFQSDRSSSDTDNEIQDPMKAAI--ATAISEVQKEINDIQQKVREKAEEIANNTHKALKEIDENLASKLDPKFNPPTPARWNGLF-SIQLDTDDGIPLNKRGSGVRRMILVSFFKAEAERRKSSSKQNIIYAIEEPETAQHPNNQKILIESFKSLANEDCQIILTTHSP... 372
112 1.000e-79 GL0058252 [Complete] locus=scaffold9190_15:8958:10784:-  ali  40  1MRLRELKLKNFRGYKNTEIIIDEMTGIVGRNDFGKSTLLEALAIFFETE--GMKADKNDMNCFSLREGDGRFEIACEFDDLPDFIMIDDRVQTTLASEHLLNEDGNFEIVKTFKASGKPEQTCIRCIHPDEEPLRNLLGMKISELKAVGKEVEKNVADKRTASLWRQAIREAA-APYTCSEIMLDVDKEFGKSLWGKILDLLPTYAIFKADRESSDGDSEAKNPLQQAVKDAQA--ALQDKITALENEIQDSVLDVAQRTLDKLREMAPELASELTPRFK--EKPKWTFNFT---LDGENGIPINKRGSGIRRLILLNFFRAEAEKNVAGTPRNVIYAIEEPETSQHPNYQMMLMKALLALAQPHRQIIVTTHVPAL. 375
113 5.000e-79gi|501408188|ref|WP_012439754.1| ATP-dependent endonuclease of the OLD family [Erwinia tasmaniensis]  clstr ali  41  1MRLKKIKLTNFRGYRNIEIPVDEMTGIVGRNDFGKSTILEALAIFF--EIDGIKADKNDMNCFSMANGDTHFEISCEFDDLPPVILIDERVSTTLASEHLLNSHECFEIVKTFKATGKPDKTYIRCQHPVNEPLNNLLGMKISELKAIGKDVEQKVEDKRTASLWRQAIRDAA-MPYECAEILLDVDKGLGKSIWGRILEQLPTFALFKADRESSDGDSEAKNPLQQAVKDAQA--ALQGKISALEQEIQDSVLDVAGRTLDKLREMAPELANELTPRFK--EKPKWTFNFT---LDGENGIPINKRGSGVRRLILLNFFRAEAEKAVSGTPRNVIYAIEEPETSQHPNYQIMLMKALLLLSNKNRQIIVTTHVPAL. 375
114 6.000e-79gi|1011306711|ref|WP_062223263.1| hypothetical protein [Aureimonas sp. D3]  clstr ali  42  13MKLLSASICNFRSYREVTIGFGNFTAVIGRNDVGKSTLLEALEVFFNH--QLIKLDQDDPCVHGADKI---IEIGCVFDNHPTELTIDVGSSTTLEAEFLLNRDGRLEIVKQFDCSGKKEAVFARASHPTHDKLRDLLKLKNTDLKARATELEIEKGNFRSNTALRNAIRGAVDDGAREE-TLIPLAADDGKKVWELLEKHLPAFALFQSDRPSRDDDREVSDPMKAAM--ALAVKQVEAELEAIKTKVQASVMEVAERTLAKLREMDPALAGQLTPTFKAEPKWDGFKL----SLTGDHQIPINKRGSGVRRLILLNFFRAEAERRREAEGGRNIYALEEPESSQHPDNQIMLIKALLALGEDSTQVLITTHVP... 383
115 6.000e-79gi|495565481|ref|WP_008290060.1| hypothetical protein [Methylophaga thiooxydans]  clstr ali  41  1MKLKKLKVQNFRAYQETEISFSNMTGLIGRNDVGKTSILDALGIFFGHKLCKY--EAGDKCVYAGEN--EDVIITCEFEELPQEIVLDATSVTSLDREYLLTDGGTLSLSKVFKKGKGSGAYMANCVHPSARNAKGILLKKNDELKSIAQSLGIAAEDNRSNVSLREAIYDAV-GDLKLKEQSVALSKEDGKAILEQIQNHLPHFALFRADRPSTDEEAEVQDPMKVAISQAI--EDISPQLEDIKDQVKQRALTVANSTLSHLADLDPELAMSLTPDFKA--DPKWEGIFK-LSLAGDDDIPINKRGSGVRRLVLISFFKAEAERIKREQDRGVIYAIEEPENSQHPDKQKLLVEAFSEMAKDGCQIVITTHVPAL. 370
116 6.000e-79gi|921165377|ref|WP_053111220.1| OLD family endonuclease [Pseudomonadaceae bacterium C6819]  clstr ali  41  1MRLRSIKLTNFRGYREIEIPIESTTGIVGRNDFGKSTILEALAIFFETDGA--KADKSDMNCFRLAEGESQFEIACEFDELPERLVLDEMVETTLSDELLLNADGYFEIIKTFKSSGKPDKTFIRCMHPSEEGVSNLLGLKIADLKKFGKELDVEDADKRVASQWRQAIRAAAPFNLVETLLDVDKSLATGKSIWGKVQEQLPTFALFKADRESSDNDAEAKNPLQQAVKDAQS--ELQAQITALENQIEQKVLDVAERTLDKLREMAPELANELTPRFK--DKPRWTFNFT---LDGENGIPINKRGSGVRRLILLNFFRAEAEKIVHGSERKVIYAIEEPETSQHPSYQVMLMKALLDLANENRQIIVTTHVPAL. 377
117 6.000e-79JGI.Meta 7052480644 C1298461__gene_152497 hypothetical protein [Human Stool microbiome from visit number 1 of subject 764447348]  ali  41  1MKLSKIIIENFRSYSHVELSIEQITAIIGKNDIGKSSILDALDTFFNQS----KFDLTDKNIHSSDN---PVIIGCVFSDLPEEIVLDDSVSTTLEAEYLLNEDNQLEIWKEYSPSG-KESIFIVAVHPVNEPYDNLLQKKNTELKRLIQSAGLDTVNQTINSEMRHALWESIGDQIRLEKRHIAADKEEAKNIWLKLLPALPKYRIFRADRPSTDDDSIAQDPMQVAMKAAI--EENQAELIRIAENIKQRVSVVANQTIEKLRDFDETLASTLTPKFK---KEPAWDKAFSFSLTGDEDIPVNKRGSGVRRLILFSFFRASCEENLDGNTDV-IYAVEEPETSQHPNFQQTIINTFLQMTENHCQILFTTHVP... 364
118 8.000e-79gi|1004017003|ref|WP_061484912.1| OLD family endonuclease [Alteromonas macleodii]  clstr ali  40  1MRLKSVKLTNFRGYQDTTIPIDEMTGIVGRNDFGKSTILEALAIFF--EADGAKADKNDINCFQLEAGANKFEITCVFDELPDALILDENVKTTLADELLLNAEGCFEIIKVFKASGKPDKTYIRCQHPEEEQLNNMLGLKMAELKKLGKDRGIEEKDKRVASLWRKAIRDASPLNLIETLLDVDKGLSVGKSVWTKIQDQLPTFALFKADRESSDGDAEAKNPLQQAVK--EAQTSLQSEISYLEEQIEQSVLDVANRTLAKLREMAPELANELKPRFK--DKPKWTFNFT---LDGKDGIPINKRGSGVRRLILLNFFRAEAEKAVSGANRKVIYAIEEPETSQHPNYQIMLMRALLELANDNRQILVTTHVPAL. 377
119 1.000e-78gi|953993608|ref|WP_058078135.1| OLD family endonuclease [Pseudomonas sp. TTU2014-066ASC]  clstr ali  38  1MRLKSVKLSHFRGYRTTTIPIDEMTGIVGRNDYGKSTILEALAIFF--ESGDVKADKSDMNCFSLAEGAEQFEIACEFDGLPEALVLDENAETSLAQEYLLNAEGALEIVKTFKASGKPERTAIRCQHPADEALAGLLSLKMADLKKLGVQLGERVADQRVAFQWRQAIRAAAPIVCQETLLDVSKLSTDSKSIWEKIEAQLPTFALFKADRESSDGDAEAKNPLQQAVK--EAQAALQSEISALEQQIEASVLDVAARTLDKLREMAPELANELTPRFK--EKPKWSFNFT---LDGENGIPINKRGSGVRRLILLNFFRAEAEKAVVGSQRNVIYAIEEPETSQHPNYQMMLMKALLELSNQNRQIIVTTHVPAL. 377
120 1.000e-78JGI.Meta 7001915993 SRS022725_LANL_scaffold_15597__gene_39533 hypothetical protein [Human Supragingival plaque microbiome from visit number  ali  42  1MKLKTVYLKNFRCYKDVSIEFDELTTFVGKNDIGKSTVLEGLEIFFNNDL--VKIEQSDANIHGDKN----VVISCDFCDLPSELVLDSGEKTNLADEYLTITNDILRIKKVYDCCKSKSTVYIVANHPNAVDAENLLSLKEKDLQKIIKDKGL-NGPLKGNPQMRKAIWASIDLNLKETEIEVSKAKEDGKEIWTKLDAYLPNYALFQSDRSSQDSDGEVQNPMKMAIQEAIS--EVQEEINVIQKKVHDKAMAIAQQTQEALKYIDSNLANQLTPKFTPPASAKWNGLF-SIAMDTDEGIALNKRGSGVRRMILVGFFKAEAERSSGSKKKNIIYAIEEPETAQHPNNQRILINSFKELSKEKCQVILTTHSP... 373
121 1.000e-78JGI.Meta 7052483485 C1302756__gene_155338 hypothetical protein [Human Stool microbiome from visit number 1 of subject 764447348]  ali  48  1MNIKSVIIENFRGYKDQVINLNNFTAFVGRNDVGKSTILEALDIFFNDSKGVVVMDSTDVNREAKEANDKDIVIGVEFINLPSEVCIDDNNTTTLSDEYLLNYEGNLTVIKKYTNGSKTPKVYIYAYHPNHKECCDLLSKKQKELQELSGDLDC---DKTKNAEMRKAIRNLYSDFLDLRMKEIEVSKEDAKNIWDKLKQYMPIYTLFQADRSNDDKDKEVQDPLKEAVKIIMSSTKIRSKCQEIYDAVIEELQNVSDRTVKKISDMNPSLASSLHPALPTADDLKWTDVFKSVSITGENDIPINKRGSGVKRLILINFFRAEAENKQEKAKAPIIYAIEEPET.................................. 344
122 1.000e-78 GL0087638 [Complete] locus=scaffold51464_1:3755:5572:+  ali  43  1MKLKTIYLKNFRCYKDVSIEFDDLTTFVGKNDIGKSTVLEGLEIFFNNDL--VKIEQSDANIHGDKN----VVITCDFCDLPSELVLDSGEKTNLADEYLTIANDILRIKKVYDCSKSKSTVYIVANHPNAVDVENLLSLKEKDLQKIIKDKELDVPLKG-NPLMRKAIWASIDLNLKETEIEVSKAKEDGKEIWTKLDAYLPNYALFQSDRSSQDSDGEVQNPMKMAIQEAIS--EVQEEINVIQKKVQDKAMAIAQQTQEALKYIDSNLANQLTPKFTPPASAKWNGLF-SIAMDTDEGIALNKRGSGVRRMILVGFFKAEAERSSGSKKKNIIYAIEEPETAQHPNNQRILINSFKELSKEKCQVILTTHSP... 373
123 2.000e-78JGI.Meta 7037487911 SRS047210_WUGC_scaffold_62191__gene_76170 hypothetical protein [Human Tongue dorsum microbiome from visit number 2 of su  ali  43  1MRLKKLSISNFRGYQDVDIPISNLTTFIGRNDIGKSTILEALEIFFNNKL--VQIDIDDLNKQAYENGADEIVISCIFDDLPTEIVVDANKNTTFDNEFLLNSDGDLEIVKKYKVSGSKLKIYILCNHPTKEHYNDLLVLKNNDLKKRAQQLQINLYNASINVELRNAIWRNIESELELSECFIQVDKEGGKEIYGQIQKFLPIYALFQSDRPSKDDDPEVVDPMKLAI--ISALKGVEVELDKIKQQVQESACETANRTLDKLKEMAPEIANNLIPEFKSA---PKFDSLFKMTIKSDENIPINKRGSGVRRLILLNFFRAEVERRMMENCESIIYAFEEPETSQHPKHQMILLKAFQDLSSNNCQVIFTTHTPAL. 378
124 2.000e-78gi|660524829|gb|KEO54692.1| hypothetical protein DT23_18220 [Thioclava indica]  clstr ali  38  11MRLIGLTVENFRCYAAISVRFNDLTALVGRNDVGKSTLMDALSIFFDTTNP----DKDDASKNGDPKL---MRISCEFDQLPASIVVDAEFPTTLASEFLLSRAGTLVVRKTYNGALASPKIEAIAMHPTTDGYNDLLALRKADLSKRAAALGIELNDKRANAPVRSAIWASCD-DLQLAEVPVSLEVEGGKQVWAALQRFLPTFALFKSDRASTDQDAEAQDPLKAAIR--EAIREVEPKLQEVKDYVEAEVKKIAAATVDKLREMDASIAETLAPIVTT----KKWDTLFSTSITGDEGIPLNKRGSGVKRLVLLNFFRAQAEKNAERNSTSIIYAIEEPETSQHPRNQRLLLKALRELAADGRQVIITTHTP... 379
125 3.000e-78gi|839726247|gb|KMH99578.1| hypothetical protein SM82_01570 [Klebsiella pneumoniae]  clstr ali  41  1MRLRKLKLKNFRGYRNTEIIIDGMTGIVGRNDFGKSTLLEALAIFFETE--GMKADKNDMNCFSLREGEGRFEIACEFDDLPDFIMIDDRVQTTLASEHLLNKDGNFEIIKSFKATGKPEQTCIRCIHPDEEPLRNLLGMKISELKAVGTEVEKNVTDKRTASLWRQAIREAA-APYTCSEILLDVDKEFGKSLWGKILDLLPTYAIFKADRESSDGDSEAKNPLQQAVKDAQA--ALQDKITALENEIQDSVLEVAQRTLDKLREMAPELASELTPRFK--EKPKWTFNFT---LDGENGIPINKRGSGIRRLILLNFFRAEAEKNIAGTPRNVIYAIEEPETSQHPNYQMMLMKALLALAQPHRQIIVTTHVPAL. 375
126 3.000e-78gi|493303287|ref|WP_006260860.1| lantibiotic ABC transporter [Myroides odoratimimus]  clstr ali  45  1MNLESLKLKNFRGYQEIIIPFSNLTAFIGKNDAGKSTVLEALEIFFNNKI--IVCEREDLSINADNN---NIEISCVFNDFPEEIVIDAAASTTLAAEYLLNAENKLEIKKIFSATKPKEKIFIVCNHPSAENANDLMDLKRAELRQRADDLGIVTYNRNINSSIREAIWQHVGDLNLIP-TELLIDKEDSKKIYNTLESYLPIYALFQSDRQSNDDDKEVTDPMKIAIQQALQELEVE--LDYIKNQVRNKAIETADRTLAKLKEMAPDLAEEL---IPEFRTDPKFDSQFKLTIKSEDNIPINKRGSGVRRLILLNFFRAEAEKRRLGNGDRIIYAFEEPETSQHPNHQKMLIRAFIELSNPNTQIILTTHTPTL. 373
127 4.000e-78JGI.Meta 7022935290 C3739567__gene_194600 hypothetical protein [Human Tongue dorsum microbiome from visit number 1 of subject 763840445]  ali  52  1MRVKKVTIKNFRGYQETTIEFDNLVAFVGKNDIGKSTILEAMDYFFNSGNGIVKIDSNDINKTNKDNGDDTIIISMIFDQIPNEIIIDSTNSTTLKDEYLLNSDGYLEIIKKCPNAG-KEKVFIKAMHPTNPHCSDLLSKKLSELKKDLGD--IPCEDKTKSSVIRKAIWANYSNDLQLNDIEIDVSKEDAKSIWDQLKNYMPIYALFQSDRKNSDNDSEIQDPLKEAVRQILHDEQLLIKLNEIASEVEAKLTEVSARTLEKLREMNPEIANSLNPVIPSTESLKWIDVFKNVSITGDNDIPINKRGSGIKRLVLLNFFRAEAERRKLERKVPNIYAIEEPETSI................................ 345
128 1.000e-77gi|495316638|ref|WP_008041385.1| ATP-dependent endonuclease of the OLD family [Pseudomonas sp. GM67]  clstr ali  39  1MRLKSVKLTHFRGYRHTTIPIDEMTGIVGRNDYGKSTILEALAIFFETDGA--KPDKSDMNCFSLAEGADQFEIACEFDGLPDRMVLDENAETTLTDEFLLNADGVLEIVKSFKASTGKDRTAIRCQHPADAQLATLLSLKMVDLKKLGEQRGESVADKRVAALWRKAIRTAAQIDCQETLLDVSKALSDNKSIWDKIEAQLPIFALFKADRESSDGDAEAKNPLQQAVK--EAQAELQEQISELEKKIETSVLDVANRTLEKLREMAPELANELTPRFK--EKPKWSFSFT---LDGENGIPINKRGSGVRRLILLNFFRAEAEKSVVGSQRDVIYAIEEPETSQHPNYQMMLMKALLELSQHNRQIILTTHVPAL. 376
129 1.000e-77gi|654452722|ref|WP_027923162.1| ATP-dependent endonuclease [Pseudomonas sp. URMO17WK12:I12]  clstr ali  19  1MHISKLTLINYRNFKNTSLRFKGVNTIIGENGSGKSNILRAIRLLLDDTMAAYRLEESDFSRSLGQWQGHWIIISVEFEEISTDESVQALFLTVRKATYNLIFRPKKEIRSKFELAQIRSTITINDYETIFTGRSEADFSDPKVYKELVGDFELDFSSETEFPEIGSKVPGFLSVTKEVSLTFIQALRDVVAEFHNNRTNPLLTLLKSKSGQINPASMEPITEMVRELNTSIEDLEDVQSVRNHIRETIKDAAGETYSPASLSIKSDLPEEADKLFQSLR----------LFVGESEEGYEGAIHELSLGGANLIYLTLKLLEFKYQREKMAMANFLLIEEPEAHIHTHIQKTLFD---RIAYSDAQIIYTTHSTHI. 386
130 2.000e-77gi|491828403|ref|WP_005620598.1| ATP-dependent endonuclease [Pseudomonas avellanae]  clstr ali  18  70MHISKMTLVNYRNFSNTTLKFQGVNTIIGENGSGKSNILRAIRLLLDDTMAAYRLEESDFCRSLGEWRGHWIIISVEFEEISADEAVQALFLHLAKATYNLIFRPKKEIRLKLELTEIRNAITIDDYETVFTGRSSANFSDPSVYRSIVGDFDVCSFSETEFPEIGAKVPGFLSVTKEVSLTFIQALRDVVAEFHNNRTNPLFALLKSKSGEIDPVSMLPITQMVRDLNASIEGLEDVQSVRNHIRETIKDAAGETYSPASLSIKSDLPDEAEKLFQSLR----------LFVGEADDGYDGGIHELSLGGANLIYLTLKLLEFKYQREKLAIANFLLIEEPEAHIHTHIQKTLFD---RISYSDAQIIYTTHSTHI. 455
131 2.000e-77gi|654588104|ref|WP_028055150.1| ATP-dependent OLD family endonuclease [Sinorhizobium meliloti]  clstr ali  40  1MRLKSIKLSHFRGYREVVIPVEGMTGIVGRNDYGKSTILEALALFFDGTKS----DKTDMNCFSLSDGLEQFEIACEFDDLPSQLVLDENVETTLGDEYLINASGHLEIAKLYRASTGKEKTSIRCQHPADQVLGALLSLKMADLKKLGEERGEAVADKRVSSLWRKAIRASAGAILQETLLDVDKLSTDSKSIWGKIQDQLPTFALFKSDRESSDGDVEAKNPLQQAVKDAQA--ALQDRITKLEQEIEKSVLDVAGRTLDKLREMAPDLANELVPRFK--EKPKWTFSFT---LDGENGIPINKRGSGVRRLILLNFFRAEAERAVTGTQRNVIYAIEEPETSQHPNYQIMLMKALLALSQDNRQIIVTTHVPAL. 376
132 3.000e-77gi|916723531|ref|WP_051330622.1| hypothetical protein [Niveispirillum irakense]  clstr ali  39  1MKLEEVAISGFRRYREVRIPISQLTALIGRNDIGKSTALEALDAFFNGT-----IDIGDATVGGSG----TATVTCVFSGLPEEIILDRGAITSFKAEHLLRADDKLEIRKSWDLSGTKPKVAAFANAPTAEKAEGLLGKKQTDLKKLVKELGLEGNDQTENPSMRAAIYEHCKGNGGLKLEEREVALDDAKSIWAALERHLPSYALFKSDRVNSDQDKEVQDPMKLAIRRAMS--DIEDELEGIAKRIETVAEETATRTLEQLRASYPELASTLTPRF---RKPNWDGVFK-LDLASDDDVPLNKRGSGVRRLVLMSFFQAEAGRKRTEREKPIIYAVEEPETSQHPDNQRRIIEALIALADAGDQVILTTHVPAL. 376
133 9.000e-77gi|491776581|ref|WP_005593131.1| hypothetical protein [Vibrio scophthalmi]  clstr ali  37  1MKLISLTLENYRGYQETTIEVSDLTALIGKNDIGKTTLLDALGVFFNHKLC--KFDATDKCVYSGEQ--DDVLIGCEFSNLPEQLILDERANTTLQNEFLLNERGNLELFRIFKKGKGNGEYAAWCVHPSAKDAKGILYKKNDQLKAIAERRSVNVEDQRVNALLRQGIYGSIEDLKLTPQM-IPLKAEDGKSVWERISSYLPHFALFRADRPSTDEEAEVQDPMKAAVSNALS--ELDTELENIKQVVREKTLAVAADTISHLNDIDSKLASELIPEFK---VEPNWGSIFKLSLIGNDGVHINKRGSGVRRLILISFFKAEAERKRDNSKKGVIYAIEEPETSQHPSYQQMLVDAFKELSEDDCQVILTTHVPAL. 370
134 1.000e-76gi|992332896|ref|WP_061051375.1| hypothetical protein [Vibrio mimicus]  clstr ali  38  1MRLEKLILENYRGYQRTEIVINELTALIGRNDVGKTTVLDALGVFFGHKLCKYDIS--DKCVYAAEN--DDVKIGCVFSGVPESLVLDASSHTTFSNEYLLNSDGHLELHKIYKKGKGAGVIHAYCRHPSARGVKGILLKKNDELKAIAQSLSINVEDRRSNVSLRQAIYKE-KDDLRLTNQLVSLSKEDGKAIWEQIQTYLPHFALFRADRPSTDEESEVQDPMKAAI--LNALDELESDLNDIKQRVKEKALAVATNTISHLNDIDPNLAQQLAPEFK---AEPKWDSIFKLSLVGDDGIHINKRGSGVRRLILISFFKAEAERIKQENSRGVIYAIEEPETSQHPSNQKLLLEAFSELASENCQVLLTTHVPAL. 370
135 1.000e-76gi|553782295|ref|WP_023113868.1| ATP-dependent endonuclease [Pseudomonas aeruginosa]  clstr ali  20  1MHISKLTLVNYRNFKNTTLQFKGVNTIIGENGSGKSNILRAIRLLLDDTMAAYRLDESDFSRSLGQWQGHWIIISMEFEEISTDESVQALFLHTLEDTYNLIFRPKKEIRLKDQLAEIRDTITIDDYETIFTGRSWVDFSDPDVYKAFVGDFDLCCFNETEFPDIGSKVPGFLSVTKEVSLTFIQALRDVVAEFHNNRTNPLLTLLKSKSGEINPATMQPITELVRELNTSIEDLDDVQSVRNHIRETIKDAAGETYSPASLSIKSDLPEDADKLFQSLR----------LFVGESEEGYEGAIHELSLGGANLIYLTLKLLEFKYQREKLAMANFLLIEEPEAHIHTHIQKTLFD---RIAYSDAQIIYTTHSTHI. 386
136 1.000e-76gi|987355940|gb|KXB68557.1| hypothetical protein HMPREF1863_00026 [Peptoniphilus coxii]  clstr ali  42  1MNLNSVKIRNFRGYKDVSIKIDDLTTIVGKNDSGKSTILEALEIFFNNKI--VVCEKEDLSIN-HSQGDDLIEITCVFSPILESISIDASSETTLKKEFLLNTDGLLEIKKVFKASTAKPKTFIVCNHPSDENFNDLLTLKIKDLKQRAKDLNIDESKYEARSSLRQAIWKENEKLNLVT-TDVPVDKEDSKKIYSKLETYLPYYALFQSDRSSSDTDKEITDPMKVAVQKALQ--EVEKELNVIKEEVRKKALDTANRTLNKLKDMNSELATSLTPEFKT---EPNFDSLFKLTINSDDNIPMNKRGSGVRRLVLLNFFRAEAERQLSEDNSSIIYAFEEPETSQHPLHQKLLVEAFLEISKKNAQVIVTTHTPAI. 376
137 2.000e-76gi|917347959|ref|WP_051954671.1| hypothetical protein [Methylobacter whittenburyi]  clstr ali  39  1MRLKKLKLENFRGYKETVVDFDELTAFLGRNDAGKSTILEALEIFFNNE--TIKIDIGDLSKSAISNM---ISLTCIFDELPGQVVVDANYPTTLQDEFLTNTDGDLEIRKEYKATVGKPSVFVIANHPINENISDLHRLKISQLKTLGKQLGVEGDDQRVASLWRKAIWAHESNELKIQKIAVSDLGTDSKEVFARVEALFPTFALFRSDRASNDVDPEARNPLQAAVKQ--AQKDLQDEINEIQAKIERSVIDVADRTLDKIREMDPNLANELTPRFKEPPKW-----TFNFTLDSDDGVPMNKRGSGARRLILLNFFRAEAEKRKTDNHSPVIYAIEEPETSQHPNYQVMLVEALLRLSREDCQILLTTHVPAL. 374
138 2.000e-76gi|406902040|gb|EKD44557.1| hypothetical protein ACD_71C00103G0004 [uncultured bacterium (gcode 4)]  clstr ali  49  1MKIETLILKNFRGYKNETISFWNLTAIIWRNDAWKSSILEALDIFFNNWSWVIKIEKDDLSKSS---LGEDMVIWVEFSWLPDSIIIDSTYNTTLTEEYLLNDFGNLEIHKKYSWIGVKCSTYLFARHPANSNFIELLEKKITELKKYIEDNAIHCENRSTSAILRKSIRDSL-GSIEFRSILIPIDKEDSKKIWEQIEKYLPLFVLFQSDRQNKDQDSEVQDPMKLAIKEILKDPVIQWQLMEIAIKVEEKVKTIADMTKEKLNEMNPELANILKPILPQSQDIKWESAFGKVWVECDDWIPLNKRWSWVRRLVLLNFFRAQAERRKTEKSSNIIYAIEEPETSQHPDHQKKLINAFIELSETGSQIILTTHSPAI. 377
139 3.000e-76gi|820898736|ref|WP_046804835.1| ATP-dependent endonuclease [Achromobacter sp. LC458]  clstr ali  18  1MHISKLTLVNFRNFKSTKLAFQGVNTVIGENGAGKSNVLRAIRLLLDDNMAAYRLDESDFSRALDYWKGHWIIISMEFENLSPDEAVQALFLHISKATYNLIFRPKKEIRLKFDFAGLKDSITIADYETIFTGRSSADFSDPEVYQRIVGDFDLEFPDETEFPELGAKVPGFLSVTKEVSLTFIQALRDVVAEFHNNRTNPLLTLLKSKSGEIDAAALVPIVGKVRDLNGSIEGLEDVQAVRMHIRQTIKDTAGETYSPTSLSIRSDLPEDAEQLFQSLR----------LFVGEAEDGYEGTINELSLGGANLIYLTLKLLEFKYQREKMAIANFLLIEEPEAHIHTHIQKTLFD---RIAYDDAQVIYTTHSTH.. 385
140 4.000e-76gi|757526734|ref|WP_042789164.1| ATP-dependent OLD family endonuclease [Acetobacter aceti]  clstr ali  39  1MRLRSVKLTNFRGYKTVTVLIAGMTGIVGRNDYGKSTILEALAIFFETD--GVKADKHDMNCFSSQEGKTNFEISCVFDELPDTLVIDSHVQTSLVQECLLNSEGFLEIVKSFKAANGKVERTICCQHPTDSVLGSLLSLKMADLKKLGEAQGVNVADQRVASLWRQAIREAVSIDYQECLLDVEKGFSTEKSIWRKIQDILPTFALFKADRESSDGDAEAKNPLQQAVKEAQD--ALQSQISDLEQQIEASVLDVAARTLDKLREMAPELASELTPRFK--EKPKWTFNF---SLDGENGIPINKRGSGVRRLILLNFFRAEAEKAASGSQRNVIYAIEEPETSQHPNFQVMLMKALLSLANQNRQIIVTTHVPAL. 376
141 5.000e-76gi|551214349|ref|WP_022842291.1| hypothetical protein [Acidobacteriaceae bacterium TAA166]  clstr ali  40  1MRLVELRLRNYRCYKDISVRFDDLTALVGKNDAGKSTIMEALDIFFNETGP-------DENDACKHGQANDLCITAVFSELPASIILDQDVPTTLAAEHLLNANGELEIHKVFNGALAKPKITLVAQHPTAARLDDLYSLNNSDLKKRAVDVGADTTNKKINSQLREAIRITAK-NLQIQKKDIMLLDGNGASFWKGIQAHLPAFVLFRADRSSTDQDPEAQDPLNAAIKEAIRLQE--TELNKVQVFVEQEVKKIADLTVSKLQEMDPRLASTLNPQLTI---KPWQSLFK-VSITGDANIPINKRGSGVRRLILLGFFRAKAELQRQSNKQSIIYGIEEPETSQHPRNQRLLMSVLQELSAT-EQVVITTHTP... 367
142 5.000e-76 GL0108019 [Complete] locus=scaffold6530_52:1179:3014:+  ali  40  1MILREIVLQNFRGYKNHRIQLDQLTAFIGKNDAGKSTIFDALAVFFDH--PLGKIDASDICVHAGDRG--ELRIGCVFSDFPDSITIDASSVTRLEDEYLLNVNGLLEIHKVYEFSDKKPKVFAIANHPTANGLDGLLSKKNVELKKAGEAANIDTVDKRSNVALRKAIWENA-RDLELKPSEIQLDKEDAKAIWERLSKYLPEYALFRADRPSTDEDSEVQDPLKVAIKQAI--EEVQDELDVVKEKVKARTLDVANRTITKLADFDSALSSQLNPNFKS--DPKWDGLFK-LSLTGDDEIPINKRGSGVRRLVLFSFFRAEAERLREEHKKGNIYAVEEPETAQHPDNQRKVIEALHSIAEDGCQVMLTTHVPAL. 374
143 7.000e-76gi|737100150|ref|WP_035088129.1| hypothetical protein [Caulobacter henricii]  clstr ali  38  1MKLVGLKISNFRSYKAVHLRIDDFTAIVGRNDVGKSTLLEALDVFFNHKN--IKLDQSDPCVH---NEGKVIEITCVFEDLPPILTIDARSETTLEREWLLNHAGQLEIRKRFDCRPKKEEVFAWAVTSSNAQLADLLKLKNQGLKERARAVDLSAVDERSNAALRQAIRATVEVDMVEQL--VPLNEEDGKKAWDQIELEMPTFALFQADRPSKDDDPEVADPMKVA--VAEAVKAVQAELDGIKEKVRQSAIDVANRTLEKLREMDPDLANELTPSFKAEPKWDGFKLT----LASDNEIPINKRGSGVRRLILLSFFAEAERRRAASQTKRVIYAVEEPESSQHPDSQQLLIRTLLELGDDNTQVLITTHVP... 370
144 7.000e-76gi|889435757|ref|WP_048817261.1| ATP-dependent endonuclease [Ralstonia solanacearum]  clstr ali  18  1MHISKLTLVNYRNFANATLRFKGVNTIIGENGAGKTNVLRAIRLLLDDNMASYKLNESDFHRGLGSWRGHWIVISVEFEDVSPDEAIQALFIHVARATYNLIFRPNKQIRDIAGMRAILDQVTIDDYETLFTGRSVADFADPVVYRRIVGDFDNAVFSNEEFPELGARIPGTLSVTKEVSFTFIQALRDVVSEFHSNRTNPLLTLLKSKSGQIDPAQFQPIVERAQQLNREIENLNDVRTVRSDIEETIYGAAGQTYSPSLLAIKSDLPDEADLLFQSLK----------LFVGEFDGDHEGSIQELSLGGANLIFLTLKLLEFKYQHDRQAIANFLLIEEPEAHLHTHVQKTLFD---RIGYTGAQIIYSTHSTHI. 387
145 9.000e-76gi|974591624|ref|WP_059181854.1| hypothetical protein [Pseudomonas sp. URMO17WK12:I11]  clstr ali  42  1MKLAQIRLRNFRCYKDVSLDFGDMTALIGRNDAGKSTIMEALDIFFNDGLP-------DKHDASKTGNAADLCIIAVFEDLPESLVLDQTQPTSLADEYLLNADGKLEIHKVFNGGLEKPKLTIIAVHPTAARVNDLVTLNNSELKARARELNIPLDDQRVNSQLRAAIRSYV-GDLALDVREISLTEGNGVSVWKGMQAQMPAFALFKSDRASTDQDPEAQDPLNAAIKEAVRQKEPE--LNAIAIHIEAEVIKIAELTLKKLQEMDPSLASSLTPSFPPP---KWANLFK-ASITGDDDIPINKRGSGVRRLILLNFFRAKSEQLIREQHKPNIYAIEEPETSQHPRNQRLLISALQEITGTD-QVILTTHTP... 367
146 9.000e-76gi|984334028|gb|KWV83230.1| recombination protein F [Pseudomonas fluorescens]  clstr ali  38  12MRLKTVKLTHFRGYRSTTIPIDAMTGIVGRNDYGKSTVLEALAIFFD--SADIKPDKSDMNCFSLTEGHDKFEITCEFDDLPENLVLDENVQTSLSQEFLLNVEGGFEVVKTFKASTGKHDGTIRCQHPADKALASLLSLKIADLKKLGEQFGVTDADQRVASQWRQAIRSAADVSCQETLLDVGKGLSTEKSIWEKIEMLLPTFALFKADRESSDGDAEAKNPLQLAVK--EAQAALQAQISELERQIESSVLDVAERTLDKLREMAPELANELTPRFK--DKPKWTFNFT---LEGENGIPINKRGSGVRRLILLNFFRAEAEKNAVGSPRNVIYAIEEPETSQHPNYQMMLMKALLELSQTNRQIIVTTHVPAL. 388
147 2.000e-75gi|918572825|ref|WP_052518196.1| hypothetical protein [Geobacillus thermoglucosidasius]  clstr ali  45  1MKLVKVILENFRSYQETEVEIDNLTAFIGKNDIGKSTILEALEIFFNNNL--VKIDPSDACVYSDSKI---VKIGCVFTDFPEEIVLDSSSKTDLISEFLVNKDGYLEIIKEYNCKNPKEKVMLKAYHPTKPELKDLIHLKNSELKNKVKQLGIEDIDLRSNVSIRKAIREHYE-DLELKEVLIPLETGDAKTIWTQLEKALPIYALFQSDRSSSDQDAEIQDPMKIAI--IEALKTVQDDLENIKNTVTKKVLEIANDTLDKLKEIDEELANQLSPRFKN---EPKWDKVFNITINGDDDIPINKRGSGVRRLILLNFFRAEAERKKENQSSSIIYAIEEPETSQHPNNQILLIKALKELAEDNTQVLITTHVPAI. 373
148 3.000e-75gi|839832562|gb|KMJ04950.1| hypothetical protein SN05_04211 [Serratia marcescens]  clstr ali  42  1MRLRQVRLSNFRGYKDEAIDIDDLTGVIGKNDAGKSTILEALEIFFNN--QQIKIDSTDRNVFSQDGTA---SISCIFDDLPNEVVLDSTSKTTLQQELLLNEDGFLEVKKSFDLTKKSEKITILANHPTNNGLSDLHSLKQSDLKKRLQEKGIDIKDQRSNVEIRKTLYA--NEKLVLARTEVAVNKEDAKAIWEALSKYLPVYALFRSDRGSNDQDSEVQDPMKLAI--INALKEVEGRLDEIKEHVRLRALDVAKRTLEKLEEMDSSLAKDLNPDF--TKEPDWKSLFK-LSLASDSGISVNKRGSGIRRLILLNFFRAEAEKHYASENTSNIYAIEEPETAQHPGNQQMLIKALYKLSRDRCQVILTTHVPAL. 374
149 5.000e-75gi|940144320|gb|KPX60065.1| Uncharacterized protein ALO39_02988 [Pseudomonas syringae pv. lapsa]  clstr ali  40  1MKLAQIRIRNFRCYKDISLDIGDMTVLVGRNDAGKSTVMEALDIFLNEGLP-------DKHDASKSGDSTDVSIIAVFQDLPETLILDQSQTTSLSGEFLLNSDGKLEIHKIFNGSLEKPKLTVVAHHPTAPGAEDLIELSNSELKARARELNISLDDQRINARLRSAIRTSI-GDLSLKLRDVSLTEGNAATVWKGLQAQMPAFALFKSDRASTDQDPEAQDPLNAAIKEAVRQKE--NELNAIAVHIETEVRKIAELTLRKLQEMDPSLANSLTPSFPTP---KWANLFK-ASITGDGDIPINKRGSGVRRLILLNFFRAKSERLIREQHRPNIYAIEEPETSQHPRNQRMLISALQEIVGAD-QVILTTHTP... 367
150 1.000e-74gi|737613621|ref|WP_035584261.1| ATP-dependent endonuclease [Halomonas sp. TG39a]  clstr ali  19  1MHISKLKLVNYRNFKNTTLYFKGVNTIIGENGSGKSNILRAIRLLLDDHMAAHRLDESDFCRSLSRWQGHWIIISVEFEEISSDEAVQALFLQTTKATYNLIFRPKKEIRLKDELADIRDAITIDDYETIFTGRSSADFTDQSVYESIVGDFDMCCFSETEFPEIGSKVPGFLSVTKEVSLTFVQALRDVVAEFHNNRTNPLFTLLKSKSGEIDPGAMQPISEMVRNLNTSIESLEDVQSVRQHIRETIKDAAGETYSPASLSIKSDLPDEAEKLFQSLR----------LFVGESDDGYEGTIHELSLGGANLIYLTLKLLEFKYQREKLAIANFLLIEEPEAHIHNHIQKTLFD---RISYNDAQIIYTTHSTQI. 386
151 1.000e-74gi|913720221|ref|WP_050470439.1| ATP-dependent endonuclease [Herbaspirillum chlorophenolicum]  clstr ali  18  1MHISKLTLVNYRNFKNATLLFNKVNTIIGENGAGKTNVFRAIRLLLDDTMAARGLDDTDFHRGIGRWQGHWIIISAELQEISLDEEIQALFAHVQTATYNLIFRPNKNIRQRLAMNGILSQLSVEDYESGFTGRSTVNFADTEVYRRIVGDFDNALFPQEDSAEIGSRIPTYLSVTKEVSLTFIQALRDVVSEFHSNRTNPLLSLLKRMSGEINQNLLGPIVGQVQALNQSIEGLEDVKKLRSHISETIYGAAGQTYSPTSLSIKSELPQEADKLFQSLK----------LFVGEANDGHEGAINELSLGGANLIFLTLKLLEFKYRNSRPAIANFLLIEEPEAHLHTHVQKTLFE---KIGNSGAQIIYSTHSTHI. 386
152 1.000e-74JGI.Meta 7003059220 SRS042131_WUGC_scaffold_21249__gene_34952 hypothetical protein [Human Tongue dorsum microbiome from visit number 2 of su  ali  40  1MKLNSVKIRNFRGYKDEVIKMDKLTTIVGKNDAGKSTILEALEIFFNNKI--VVCEREDLSVN-HDSGDELIEITCIFLPNMSSISIDASSQTKLDEEYLLNSDGLLEIKKVFKATTSKPKTFIVCNHPTDEGYNDLLTLKITDLKKRAKDLDIPEYDARSSVSLRQAIWNR-KDSLTFAISDIPVDKEDSKKIYNKLATYLPYFALFQSDRSSSDADKEITDPMKIAISTALQ--EVEGELDKIKEEVKKKALDTANRTLEKLKEMNSELATSLIPEFK---AEPNFDSLFKLTINSDDNIPMNKRGSGVRRLVLLNFFRAEAERQEEEEKTSIIYAFEEPETSQHPSHQKLLVEAFLDISNKNAQVIVTTHTP... 374
153 1.000e-74gi|1004335778|ref|WP_061514703.1| hypothetical protein [Legionella pneumophila]  clstr ali  39  1MLLKKIILQNFRGYKNHTIEVDQLTAFIGKNDAGKSSIFDALAIFFDH--PLAKIDSSDYCVHAGKNG--ELRIGCVFDNFPEQIVIDSTTTTTLKNEYLLNCNGELEIHKVSDGNLKKAKIYAIANHPTAKGYEDLLSKKINELKTLAKTSGIDNGDKRSSAALRKALWESLS-ELQLKPSLIQLDKEDAKAIWEQLSKHLPEYALFRADRPSTDEDSEVQDPLKVAIKQAI--EDVQTELDAVKEKVKMHTIYVAQRTIKKLADFDETLSSQLKPVFK---SDPKWDSLFKISLTGEDEIPINKRGSGVRRLILFSFFRAEAERLREKHKKNNIYAIEEPETAQHPYNQRKVIEALQTIAEDGCQVMLTTHVPAL. 374
154 1.000e-74 [KEGG:K07459]|[eggNOG:NOG70858]  ali  40  1MRLHEVILKNFRGYGETRIAISDLTALIGKNDVGKSTILEALDIFFNQSKIDAT-GKNIFHV------DEETVIGCVFNDLPAEIALE-NATTSFSKEYLLNQEGNLEVLKKYSSNG-KPTIWICANHPSNDGFNDLLLKKNNELKMMIRAAHLEDSNLSINSAMRAALWTSLGNAITFGTKEISADQADEKKLWPKIEPLLPTYRLFKADRPSSEDDKEAQDPMQHAMKAAL--EEQSEQLTAIANEVQRKVSEVATNTIQKLKEFDPDLAATLTPRFK---KEPTWEKAFSFSLTGDNSIPLNNRGSGIRRLVLFSFFRATTESSLFEGE-SIIYAIEEPETSQHPDAQRMIVRTLREMTEKNCQVIITTHVP... 363
155 2.000e-74gi|503757597|ref|WP_013991673.1| lantibiotic ABC transporter [Zobellia galactanivorans]  clstr ali  44  1MILETVKIKNFRGYKETIVPISNLTAFIGKNDAGKSTILEALEIFFNNSL--VNCEKGDLNTTADNN---KIEITCVFTDFPADLIIDTANPTTLQNEYLLNLQNKLEIKKVFTAAKPKEKVYIICNHPSVDNGNDLLTLKKAELKQRAKALGIPTENYNVNSSIREAIRNSFENLELEETE-LLVDKEDTKKVYDTIKTYLPLYALFQSDRQSKDDDKEVSDPMKIAVQQALS--ELNTELEHIKEQVRIKAIDTANRTLNKLKEMSPDLANELIPEFKT---EPKFDSQFKLTIKSEEDIPINKRGSGVRRLILLNFFRAEAERLRAQHQGNIIFAFEEPETSQHPDHQEMLIQAFMELSNTNSQIILTTHTPAL. 373
156 2.000e-74gi|498253604|ref|WP_010567760.1| ATP-dependent endonuclease [Pseudomonas extremaustralis]  clstr ali  16  1MHISKLSVVNYRNFANTTLVLSKVNTIIGENGSGKTNLFRAIRLLLDDNMAAFKLDESDFHRGLEQWRGHWIIISLEFDEIGPDEAIQALFLHVGRATYNLIFRPKKEVRLKLASLDDGDAITIADYETLFTGRSEANFGNEVVYKSLVGDFDNCVFSEVDDPRIGSRLPVFLSVSQEVSFTFIQALRDVVAEFHNNRTNPLLTLLKSKSGEIAPATMAPIVAQVLALNNSIEALEDVQTVRTDIRDTIKDAAGETYSPSSLSIKSDLSDEADKLFQSLK----------LFVGESAEGYEGGIHELSLGGANLIFLTLKLLEFKYQKAHQSIANFLVIEEPEAHIHTHIQKTLFD---RIAYDDTQIIYSTHSTHI. 386
157 2.000e-74gi|1016500156|ref|WP_063086873.1| hypothetical protein [Thalassospira sp. MCCC 1A02898]  clstr ali  38  1MRLIGLTLENFRCYSEINVKFDNLTALVGQNDVGKSSLLDALAIFFEEAQP----DKDDASKNGD---PKKMRIACEFDQLPDALVVDANHSTSLAAEHLVTANRTLVINKVYNGSIGSPKIFAEAEHPTARGYDDLLKLKRAELVKRAEDLGVDLADKRVNAELRAAIWGS-CINLQKIPSSVPLEEEGGKQLWTALQAYLPAFALFKSDRASSDQDNEAQDPLNMAIR--EAIKEVEPRLLEIQEHVESEVKKIAAATVEKLKEMDPNIAETLDPIVTT----KKWEKLFSTSITGDNGIPLNKRGSGVRRLVLLNFFRAKAEKGATDKSKSIIYAIEEPETSQHPRNQRLLMSALSDLSSDGRQVILTTHTP... 369
158 2.000e-74gi|917719395|ref|WP_052233729.1| hypothetical protein [Massilia sp. WF1]  clstr ali  42  1MKLAAVILENFRGYTRIEID-EDLTAFIGKNDAGKSTILEALEIFFNDGKP----EQGDACVHGN---AADIRIGCAFTELPAALVLDSAANTSLAAEHLLNEAGELEIIKVWDSSAKKEAVFAAALHPTHADAADILSLKNSDLKARIKKLGISDTNLSVNGSMRQAIRDTCS-PLAPERKLVPLDKEEAKKVWEQIKPQLPMYALFRSDRASQDGDEEVQNPLGFAI--AQALKEMEADLKKIENAVRARAEDVASRTLSKLNEMDSRLASELKPFFK---ADPKLNNAFKFGLIGDNGIPINKRGSGVRRLILLNFFAEAERRRREKGALSVIYAIEEPETSQHPENQRLLVRALKELAEENTQVLVTSHTP... 370
159 3.000e-74JGI.Meta 7008500318 SRS017307_Baylor_scaffold_13857__gene_25189 hypothetical protein BACCOPRO_01801 [Human Stool microbiome from visit numbe  ali  53  1MLIKSVTLKNFRGYRETTVLFSNLTTFVGRNDIGKSTILEALDIFFNEGKGCISLDKEDINKRASSEGDDEIIIAVEFFKLPDSLVIDDSNRTTLAAEYLLTESNTLKIVKRYPKAG-REKVYIRAKHPTNAVCCDLLSKKITDLKTILNRENIECEDQTRKAVIRTAIWNHFADNLNLEEKEIDVTKEDGKTIWESLKKFLPVYSLFQADRSNNDHDKEIQDPLKEAVKSILKEENVAQMCQQIAEHVTTKLQEVSNHTLDKIREMNPXXXXX--------------------------------------------FFRAEAERMQSNESDGLIYAIEEPETSQHVAHQKILMKALIDLANNNVQVVLTTHSSYVV 336
160 3.000e-74gi|518017920|ref|WP_019188128.1| ATP-dependent OLD family endonuclease [Prevotella conceptionensis]  clstr ali  41  1MKLKRLYLENFRSYKDISIDFENITTFIGKNDVGKSTILEALEIFFNSDI--VKIDSSDANVFSDSKI---VTIACDFTELPNELVLDSGENTSLKEEYLLIDEDTMRIKKTYDCSKSKEDICIVANHPTADGFENLLSLKERELQKMVKERQLDCSRKG-NPIMRKALWESADDLNISEVISLTKSKEDVKDIWSKIESHLPTYALFQSDRSSSDSDGEVQNPMKVAI--LEAIGEVQKVIQEIQEKVREKATAIANQTHEALQSIDPSLANELTPTFATPSVSKWNSLF-SIAMDTDAGISLNKRGSGVRRMILVGFFKAEAERKKKSNKKDIIYAIEEPETAQHPNNQKILINSFLELSDTHCQIILTTHSP... 372
161 4.000e-74gi|913624198|ref|WP_050444201.1| hypothetical protein [Enterococcus faecalis]  clstr ali  43  14.RIKTVYIENFRGYKNVDINFGALTAFVGKNDAGKSTILEALDIFFNEGKNVIKIEKDDACVHGDSDVF---SIGVCFEKFPERIVVDSTVETTLEAEFLLNNKNMLEIKKEFK-GGKKVSTYIVANYPTSSELHDIHLKSISDLKKMLETHGLEVKDNRKSSLIRKKLLSSIENE-GLATKEIAIDEPGTKQIWSSLEQYMPLYELFQSDRKNVDQDDEVQSPVKLLIKEILKQDSMEDRLNEIFDEIQTKTKILTDKTVTKIAEMNPEIASELKSEFANPN----WSSIFKFSLDTDQGISLNKRGSGVRRLILLNFFRAEAERRSSERKVPTIYAFEEPETSQHPEHQKMLIEAFQELAQSENQVILTTHSP... 381
162 5.000e-74JGI.Meta 7063935642 SRS049318_LANL_scaffold_178052__gene_256729 hypothetical protein [Human Supragingival plaque microbiome from visit numbe  ali  44  1MRLKQIKIKNFRGYKDETIDFDNLTAFIGKNDAGKSTILEALEIFFNNKL--VVCERDDLSVGADSD---SIFITCIFDELPDEIVVDASSKTSLEDENLLNSNGDLEIKKTFKCSSAKPKTKIICNHPTDDNYNDLLLLKQADLKKRAVDLGIDEDDKRSNVSIRQAILSS-KRDLIIKEIELEVTKEDAKKVYGVIETFLPIYALFQSDRSSSDSDKEIADPMSVAVSQALQ--ELQTEINKIKSEVQQKAIETAGRTLAKLQEMDEDLAASLVPEFK---SEPKFDSLFKLSIKSDNDISINKRGSGVRRLILLNFFRAEAERKLSEANKSIIYAFEEPETSQHPSHQKLLIEAFLELSKENTQIILTTHTPAL. 374
163 5.000e-74gi|1017909189|emb|SAC42569.1| Predicted ATPase [Enterobacter cloacae]  clstr ali  36  1MKLEKLILKNFRGYHEHSIDINSLTALVGRNDVGKTTILDALGVFFEHKLCKY--DATDKCVDSVEN--EDVSIGCIFSGADIPIVLDATSITNLKEEYLLNSNGKLEIYRVFAKGKGSGSVQAKCMAPSAKGAKSLLAKKNDELKVIAESIGVDGADKRSNVSLRQEIYRKI-GDLKLKEIFVKLNAEEGKVICEKIYDKLPHFALFRADRPSTDEESEVQDPMKSAVQTALQKIDIQ--LESIKESVKEHAVEVAENTIKHLHDISPNLAAGLIPKFK---VEPKWENIFKLTLEDDRGIAINKRGSGVRRLVLISFFKAEAERLQKEPDKGVIYAIEEPETSQHPSNQRLLIDAFQELANDKCQVLITTHVPALV 371
164 6.000e-74gi|493712504|ref|WP_006662114.1| SMC domain-containing protein [Providencia alcalifaciens]  clstr ali  18  1MHISKLTLVNYRNFKNTSLQFKGVNTIIGENGSGKSNILRAIRLLLDDTMAAYRLDESDFSRSLGQWQGHWIIISMEFEEITTDESVQALFLHIHKATYNLIFRPKKEIRLKLQLSEIRDAITIDDYETIFTGRSWADFSNPAVYKSIVGDFDIDFSPETEFPEIGAKVPGFLSVTKEVSLTFIQALRDVVSEFHNNRTNPLLTLLKSKSGEINPATMEPITEMVRELNTSIEGLEDVQSVRNHIRETIKDAAGETYSPASLSIKSDLPEESDKLFQSLR----------LFVGESEEGYEGAIHELSLGGANLIYLTLKLLEFKYQREKLTMANFLLIEEPEAHIHTHIQKTLFD---RITYSDAQIIYTTHSTHI. 386
165 6.000e-74gi|943608204|ref|WP_055438156.1| hypothetical protein [Idiomarina woesei]  clstr ali  40  1MKLEQVKIKNFRCYEEITIPLTDLTALIAKNDVGKSSILEALDAFFN----AEKLESGDRSAGLRN--SENIEITCIFKEIPDQLIIDTDNLISPANEYLLNTDGKLEVKKVFSGAAPKEEIFIRAFHPTAENFNDLFSLTVAQLRTRARSLDLDGVNETVKSALRHAIWLSVPDVVLDK---QVVELEVKSKIWKPIQNILPLFQLFKSDRPSSDQDAEAQDPIKFAIKEALKQKA--GDLETIGEHVKRQVEEVTRLTIEKIREMDPDLASQLNPNFSSFNWSKV----FSVSLTNEDKIPLNKRGSGVRRLFLINFFRAKAEQLADEREVDVIFAIEEPETSQHPNNQLLLLDAIKELAEDSSQVIFTTHNPIL. 368
166 7.000e-74JGI.Meta 7074967946 SRS053854_LANL_scaffold_39905__gene_54989 hypothetical protein [Human Tongue dorsum microbiome from visit number 1 of su  ali  43  5MRLEKLILKNFRSYSSVEIPISNLTTLIGKNDIGKSTILEALEIYFNNDI--IKIDLDDLSKGSTDD---EIIISCVFSDLPNEIILDSCNETSFDKEYLLNDEKKLEIRKVYKMTSTKPKIFINCMHPSLEKYSDLLLLKNSDLKKRAKELGIDLYSASVNAEIRNAIWNKSKEELRLQETNIPVDKEGVKDIYSQIQKYLPIFALFQSDRPSRDDDKEVTNPLNIAIKQAL--KEVQDQIDTIKNQVKGYACETATRTLNKLKEMDKEIAESLVPEFK---SEPKFDSLFKLTIKSDDDIPINKRGSGVRRLILLNFFRAEAERLNENNKDSIIYAFEEPETSQHPDYQLLLLDAFKSLINPNCQVLFTTHTPAL. 379
167 7.000e-74JGI.Meta 7001110697 C2628907__gene_52981 hypothetical protein [Human Buccal mucosa microbiome from visit number 1 of subject 159814214]  ali  44  1MKLVKLKLRNFRGYKNAIINIDSITALIGKNDAGKSTILEALEIFFNNK--VVVCEKEDLSINADDN---SIYISCIFNSLPDNVTIDASSVTDLGSENLLNDDGELEILKSFKCTSAKPKTKIICNHPGDEGYSDLLQLKQADLKKRAKELNVPSEDYDSNVSIRRAILKYYRGEY--KLSEIEVDKEDAKKIYSSLEQFLPVYALFQSDRNSSDSDKEVTDPMSVAVSQALS--DLQSEIEKIKSEVKKKAIETAERTLLKLKEMDEELANSLIPEFK---SEPKFDSLFKLSINSDNNISINKRGSGVRRLILLNFFRSEAERKLNENNKSIIYAFEEPETSQHPSHQKMLIDSFLKLSNDNTQVLLTTHTPAL. 373
168 8.000e-74gi|974224162|gb|KUO64943.1| lantibiotic ABC transporter [Lutibacter sp. BRH_c52]  clstr ali  44  1MKLDTLKLKNFRGYQETIIPISNLTAFIGKNDAGKSSILEALEIFFNNSL--VSCEKDDLNITADNN---DIEITCVFSDFPDELIIDAANPTTLQAEHLLNVENKLEIKKVFTAAKPKEKIYIICNHPTIENGNDLLTLKKAELKQRANNIPIANYNGNVNSSIRQAIWNSFD-NLILQETQLLVDKEDTKKVYETLNSYLPMYALFQSDRQSRDDDKEVTDPMKIAVQQALS--ELSAELDYIKEQVRNKAIDTANRTLAKLKEMSPELANELIPEFKT---EPKFDSQFKLTIKSEENIPINKRGSGIRRLILLNFFRAEAERLRAQNLGSIIFAFEEPETSQHPDHQEMLIQAFKELANTNSQIILTTHTPAL. 374
169 1.000e-73gi|737856195|ref|WP_035823388.1| ATP-dependent endonuclease [Janthinobacterium sp. RA13]  clstr ali  18  1MHISKLTLVNYRNFQRSIFRFSKINTIIGENGSGKSNVLRAIRLLLDDSMASYRLNEEDFNRGLTSWQGHWIIISIEFEDISSDEAIQALFVTVTKATYNLIFRPNKQVRDVTAMSEILSKITINDYETIFTGKSNVDFSDPEVYKRIVGDLDHAHFNSNEFPEIGSRIPGTLSVAREVSFTFIQALRDVVSEFHNNRTNPLLTLLKSKSGQIDHVQFQPIVERARQLNKEIEGLQDVQKVRSDIVETIHGAAGQTYSPALMAIRSELPDEADLLFQSLK----------LFVGEFDSKHEGSIQELSLGGANLIFLTLKLLEFKYQHERQALANFLLIEEPEAHLHTHVQKTLFD---RISYSEAQIIYSTHSTHI. 387
170 3.000e-73gi|501004359|ref|WP_012057307.1| ATP-dependent OLD family endonuclease [Thermosipho melanesiensis]  clstr ali  41  1MKIAKVILENFRAFGRNEIPIEDFTVFIGRNDQGKSTILEAIDIFINDGKGVTKIEENDLNIKAKNEGNEIFKIGVCFKDLPENIVIDATNTTTLQNEYLLSKEGFLEIYKVFKNKLQNKETYIRCMHPANDSFLELLKKKITELQNFVREKGPDCLDLRKSAELRKCIRDYYDGDLVLKEIDLKINEEGMKDIWLQLEKCLPIFSLFHSDRPNTEQDSEIQDPLKTKVDEIFKREDIQNKLEEIAKEIDEELKKIANATVEKFREL-SQQDTEIKPNIPEVGKLRWKDVYKGIGYNTDNDIPLNKRGSGLRRLVLVSSFLAEIKQNESEDNLNVIYAIEEPETGLHPEMQKTLINNLIKLSKNGHQILITTHSPALI 385
171 3.000e-73 [KEGG:K07459]|[eggNOG:NOG70858]  ali  42  2.................EFSIEQITAIIGRNDIGKSSILDALDTFFNQS----KLDLADRNIHAADN---PVIIGCTFSNLPNEIVLDDAVSTTLEAEYLLNEDQQLEVRKEYSISG-KESVFIVAMHPANEPYDNLLLKKNADLKRLIQSAGLQDANQTINSEMRHALWESLGDQIRLKKRDIPADKEDAKNIWQKIIPALPRYCIFRADRPSTDDDAIAQDPMQIAMRAAI--EENQRELMQIAENIKQRVSVVANQTIEKLKQFDETLASTLAPKFK---KDPAWDKAFSFSLTGDEDIPINKRGSGVRRLILFSFFRASCEEDLDGNSDV-IYAVEEPETSQHPNFQQTIINTFLQMTENHCQIIFTTHVPGLV 350
172 3.000e-73gi|489185543|ref|WP_003094964.1| lantibiotic ABC transporter [Streptococcus vestibularis]  clstr ali  44  1MRLKQIKINNFRGYKDETIDFDNLTAFIGKNDVGKSTILEALEIFFNNKM--VVCEKDDLSVGVDSD---SIFITCIFDELPDEIVVDTSSKTSLKDENLLNSNGDLEIKKTFKCSSAKPKTKIICNHPIDDNYNDLLLLKQVDLKKRAVDLGIDENDKRSNVSIRQAILSS-KRDLTIKEIELEVTKEDAKKVYGVIETFLPIYALFQSDRSSSDSDKEIADPMSVAVSQALQ--ELQTEINKIKSEVQKKAIETAGRTLAKLQEMDEDLAASLVPEFK---SEPKFDSLFKLSIKSDDDISINKRGSGVRRLILLNFFRAEAERKLSERNKSIIYAFEEPETSQHPSHQKLLIEAFLELSKENTQIILTTHTPAL. 374
173 7.000e-73JGI.Meta 7018451030 SRS017120_Baylor_scaffold_53646__gene_68132 hypothetical protein [Human Tongue dorsum microbiome from visit number 1 of  ali  45  1MKLKTVKIKNFRGFKDVIIPFENLTAFIGKNDAGKSTILEALEIFFNNKL--VSCEHNDLNVKAKEEGEFKIEITCVFNEFPNIFVLDSTYGEELRKQYLLNADGDLEIKKIFDLKTIKEKIFIVCNHPSADGLNDLLYVKNAELQKRAKNLEEDSLPFVASAPLREYLWSQCSDLQIVS-TELPTEKEGSKDIFEKIKEQLPIFALFQSDRDNSDENKEVTDPMKLAIQ--EALKEMQSEINLIKNKVKEKALNTANATLLKLKEMSPEIADAL---LPEFRVEPKLDSVFKLTINSDDNIPINKRGSGVRRLILLNFFRAEAEKRKENNDSSIIYAFEEPETSQHPSHQEMIIESFIQLSQNNTQVVLTTHTPNL. 377
174 1.000e-72gi|917011674|ref|WP_051618386.1| hypothetical protein [Hyphomonas johnsonii]  clstr ali  39  1MKIKALILENFRGYQKTIIPFSQFTALIGRNDAGKSTILEALDIFFDNSKPDQG-------DACINGDARGVRIGIIFDHLPTEITLDRGARSTFQAEHLLNSDGDLEIHKVFNLGVQRPKIFAIAVHPTRPDLADLLQKSNTQLKAVIRERGLEANNLNENPSMRQAIYRAV-GDLGLSRQEVPLNDENGKAIWTAIQSVLPLFVLFRSDRASSDQDPEVQNPMKVAVQKALS--EIEEDLAAITAEVRTRVEETAARTLAQMQLTYPELAKTLTPQFRTPT----WQNIFKVDLESDDGVPLNKRGSGVRRLVLMSFFQXXXXXXXXDGQRPVVYAIEEPETSQHPENQELIVEALKEIADAGDQVVITTHVPAL. 375
175 1.000e-72gi|910173045|ref|WP_050010686.1| hypothetical protein [Herbaspirillum sp. B65]  clstr ali  16  2MHISKLTIVNYRNFKNATLKFNKVNTIIGENGAGKTNVFRAIRLLLDDSMVRKSMDVADFHRGLERWQGHWIFISAELSEISLDEEIQSLFVHVQTATYNLIFRPIKEVRLRLAMNAILNSLTTADYEVVLTGRSTADFANPVDYARIVGDFDNAVFPKEDSPEIGSRLPTYLSVTKEVSLTFIQALRDVVSEFHNNRTNPLLTLLKRMSGEINEELLRPIIGQVQALNQSIEGLENVTLLRRDIRETIYSAAGQTYSPSSLSIKSELPQETDRLFQSLK----------LFVGESNDGHEGPIHELSLGGANLIFLTLKLLEFKYRNARHTIANFLLIEEPEAHLHTHVQKTLFDNIGD---SGAQIIYSTHSTHI. 387
176 1.000e-72gi|514889151|ref|WP_016618629.1| hypothetical protein [Enterococcus faecalis]  clstr ali  44  14.RIKTVYIENFRGYKNVDINFGALTAFIGKNDAGKSTVLEALDIFFNEGKNIIKIEKEDVCIYGDSDVFT---IGVCFDNYPSKIIVDSTVETSLEEEFLLNNENMLEIKKQFKN-GKKTGTFIVANYPVSSELQDIHLKSIADLKEILESHNLEVEDYRKSSLIRKKIFNSVENE-GLAIKEIPIDVQGAKQIWSSLEQYMPLYELFQSDRKNLDQDDEVQSPVKLLIKEILKQDEMEERLNEIFNEIQIKTKILTDRTVSKISEMNPEIASEL---ISEFSKPNWSSVFK-FSLDTDQGISLNKRGSGIRRLILLNFFRAEAERRSSERKVPTIYAFEEPETSQHPEHQKMLIEAFKELAQEVNQVILTTHSP... 381
177 3.000e-72gi|772279830|ref|WP_045243458.1| ATP-dependent endonuclease [Burkholderia pseudomallei]  clstr ali  16  1MHISKFTLVNYRNFPSTTLTFKGVNTVIGENGSGKTNLFRAIRLLLDDNMSAYKLDESDFNRGLSDWRGHWIILSLEFDEIGPDEAIQALFLHIGRATYNLIFRPKKELRLKLALTAIREAITAADYETLFTGRSEADFCNPAVYKELVGDFDNCIFSPEIDDRVGARVPVYLSVAKEVSFTFIQALRDVVAEFHNNRTNPLLTLLRAKSGDISPAVMAPIVEKVLDLNTAIEDLEDVQTVRSNIRDTIKDAAGETYSPSSLSIRSELSD----------EPEKLFQSLRLFVGESEEDHEGAIHELSLGGANMIYLTLKLLEFKYQQAHQAIANFLIIEEPEAHIHTHIQKTLFD---RIAYEETQIIYSTHSTHI. 386
178 3.000e-72gi|646882691|ref|WP_025607840.1| hypothetical protein [Vibrio parahaemolyticus]  clstr ali  45  1MKITKLTLKNFRGYRDVSVDFDNFNVIIGKNDIGKSTILEALEIFFNND--TVKIDINDHNVHAAGQ--DFMSIQVSFKPEDKEYTID-TVPTDLKKEHLLDSDNNLSIKKVWDCSKDKLKTYLVANYPTAFD-SPLINQKIADLKKLLDGYKDQLDVNEVKKHKSSSIRQAIENLNDFSVIEIPIDKEDGKKIWESLKLDLPLFFIFQSDRANKDSDKEVQDPLKAITKTAISQLEAE--LEDVKEQIRIKAEQLGHNTLAKLKEMSPEIADVLSPEMT----HKPWESLFSFSFNCDDGIPINKRGSGVRRLILLNYFRAEAERKNSEE-RNVIYAIEEPETSQHPTWQVELFNALVDLSENNTQVLITTHSPSL. 374
179 3.000e-72JGI.Meta 7010715140 C511250__gene_43161 hypothetical protein [Human Posterior fornix microbiome from visit number 1 of subject 158458797] :_  ali  42  1................VSISFDDLTTFIGKNDIGKSTILDALEIFFNND--TVKIDNKDCNIHSDS---KNVVITCDFTELPTKLILDSGEETSLSAEHLTIADDTLRIKKIFECGKKSEDVYVVANHPIDKGLEDLLSLKEKELQKRIKDKNI-NSPLKGNPQMRAALWNTVHLNLQVTELPVSKSKEDMKSIWNKIDSYLPTFALFQSDRSSNDTDGEVQNPMKVAVQ--EAIKDVQQDIETIQNKVREKAMEIANRTQMALQEINKELANQLSPSFTTPVASKWAGLF-SVGMDTDEGIALNKRGSGVRRLILVGFFKAEAERKAKSNKKDIIYAIEEPETAQHPDNQRKLVKAFNELAQDNCQIILTTHSPEL. 357
180 4.000e-72gi|644227288|ref|WP_025291328.1| ATP-dependent endonuclease [Sphingomonas sanxanigenens]  clstr ali  17  1MHISRVQLVNYRNFANATFRFNGINTIIGENGSGKTNLFRAIRLMLDDDMLRHKLDDGDFHRGLGNWRGHWIIISLEFSEVSQDEAIQALFLHTYNLIFRPNKLGELEMGDQAGLEALRRTITIDDYEPVFTGKSTADFADPAVYQSLVGNFDVEFPDELSPPEIGGRMPAVLSVSKEVCFTFVQALRDVVSEFQGQRTNPLLTLLRGKSGELDADTLDPITQRVKDLNEAIEGLPDVGEMRSHIRQTIRDAAGEAYSPARLSIRSGVPTEADKLFQSLK----------LFVGETDDEYEGAIHELSLGGANLIFLTLKLLEFKYQQAKRACANFLLIEEPEAHIHTHIQKTLFD---KLTYPDTQVIYSTHSTQI. 386
181 6.000e-72gi|917002708|ref|WP_051609420.1| hypothetical protein [Fodinicurvata fenggangensis]  clstr ali  38  1MKLEKVILEGFRGYHETEISVSALTALIGENDVGKSSVLEALDAFFND-----VVDAQDVN---TRTAGGKFTVGCIFWDLPDQINLDAQSQTTLQDEYLLNDSGKLEIYKVWRTTAIKAEIYARANAPAHEVGKDLLFKKRDELKEIVEAHDLQ-ANKRKNPDMRQAIYRHLEAELKLQPREVELDRPDARKIWKKLNRHLPVYSIFKADQVRGDKETAVRSPLDATLKAAI--KELEEQLSAITEQVQKQVKETTDRTLERLKRDYPEIAQSLVPDYKPPS---WSKAFDLDVLRGDDDVPLNKRGTGVRRLVVLAFFQAEAEKKRQERAPPIIYAIEEPETSQHPNFQRSIIEAFNSLAEAGDQVLLTTHVP... 381
182 6.000e-72gi|947596894|ref|WP_056260157.1| ATP-dependent endonuclease [Devosia sp. Root436]  clstr ali  16  1MHISRLQLVNYRNFGSANVYFKKINTLIGENGSGKTNLFRAMRLLLDDDMLRYRLDESDFHRGLDNWRGHWIVISLEFDEVAQNEALQALFLHTYNFIFRPNTAIRLRLAELGEGDRDRNAITLDDYEVVFTGKSTADFTDPDQYRALVGDFDAVRFPDEMESEIGGRVPKVLSVAKEISFTFVQALRDVVTDFQNNRTNPLLSLLRSKSGEIDQAALAPITALVEGLNTAIEELPDVGTIRGDIRQTIRDAAGETYSPAGLWIRSGVPAEAERLFQSLR----------LFVGESDDGYEGAIHELSLGGANLIYLTLKLLHFRYQKEKQVCANFLVIEEPEAHIHTHIQRTLFDRLN---YPDTQVIYSTHSSHI. 386
183 8.000e-72gi|949551521|ref|WP_056986886.1| hypothetical protein [Lactobacillus paracollinoides]  clstr ali  41  1MKLVRVKIHNFRGYNDAEVNIDDMTTIIGKNDVGKSTIVDALEIFFNNS--VVKIDKNDLNIHAEND--QSVSISCEFSCLPQNIIIDSTQRTNLNDEYLVNSNGNLEIKKVYDFSKKTIEIFAITKYPDNPELADLLTKLVSALKKLPNPIQNSVESLVANAPIRMAIRSAYKIQS-FSTKEIDLKKVDGKSLWNKIEASLPIYALFQSDRPSNDSDSEVQDPMNVAIR--ESLSKATKDLENIQNKVKEEVTEVAKVTISKLREMDPEVAKGLEPV---YQGDPKWDKLFQFKIEDEQGIPLNKRGSGVRRLVLLNFFRAKVDMNNEAMTNGLIYAVEEPETAQHPDNQRKIMKSLLELGKRNCQILITTH..... 372
184 2.000e-71gi|1016512197|ref|WP_063093127.1| ATP-dependent endonuclease [Thalassospira xiamenensis]  clstr ali  18  1MHISKLQLINFRNFERAEVVFKKVNTIIGENGSGKTNLFRALRLLVDDSLLRYKLDEKDFHRGLGDWRGHWIIISLEFDEVSQDEAIQSLFLIVGKATYNLIFRPNAAIRRSLSLAELRAKISVVDYETIFTGKSTADFLAPATYKALVGDFDAVIFPTEIHPQIGGIIPGMLSISREVSFTFVQALRDVVADFQNNRTNPLLTLLKSQSGEIDPASFKPISSLVKNLNSAIEELPDVGTIRADIRETIIDAAGETYSPRSLSIRSDLSDEADRLFQSLK----------LFVGETDEGYEGAIHELSLGGANLIYLTLKLLEFKYQKQKEAFANFLVIEEPEAHIHTHIQKTLFDRLN---YDDTQVIYSTHSTHI. 386
185 3.000e-71JGI.Meta 7068340178 C3463346__gene_275648 hypothetical protein [Human Stool microbiome from visit number 1 of subject 764224817]  ali  52  1MKIHSIKIRNFRSYKNIEIELNNLTALVGKNDIGKSTILEALDIFFNDGNGVVKIDKTDVNVLNSRNGDNEIVISVCFSNLPESIVIDSTVQTKLVDEYMLNSDGLLEVVKKYKN-GGKASVFIRANHPINPECKDLLLKKNAELKRIIADKGIECDNQSINAVMRKAIWENYSANLSLANTEIDVSKEDAKKIWDKLSGYMPVYSLFQADRKNSDGDSEVQDPLKEAVRQIMCDEELQRTLNSVAEVVEEKLKEVSGRTLEKLREMDPEVASSLNPVIPTADKLKWADVFKSVS................................................................................... 295
186 4.000e-71gi|686297665|ref|WP_031864227.1| lantibiotic ABC transporter [Staphylococcus aureus]  clstr ali  43  1MILKSVKLKNFRCYKDEVIPFKEITGLIGKNDAGKSTILEALEIFFNNSI--ISCEKNDLNIYA---ESENIEISCTFTDLPANITLDTSSETSLQNEYLLNLQEELEIKKVFKASKPKEKVFIVANHPSQTDLNDLLLLKITDLRKRAKNLNIPAENYNANNSLRSAIWNNCD-DLNLKLQEIPADKLEAKNIYESLVKYMPMFSLFQSDRASTDDDKEVTDPMKIAVEKAL--KEVETEIENIKNIIQNTAMETANRTLEKLQEMDKDLAQSLSTEFKS---EPKWNTIFKLNINSDNGIPINKRGSGIRRLILLNFFRSEAERKAQDTSQNIIYAFEEPETSLHPNHQIMLIESFLSLSSNKSQIILTTHTPNL. 372
187 6.000e-71 [KEGG:K07459]|[eggNOG:NOG70858]  ali  43  1MKLVSLQLENFRGYSEFTIDLNDLTCLVGKNDAGKSTILEALDFFFNESNGIIKLDKDDCSIGSGK---EEILIGATFTNVPDKVILDTSVETSLKDEFLLNKDGMLQVNKIIKSGKVISTKLIANYPKGKP---KVHSLKISELKKLLKEMDISVEDERISSLCRKAILSSYCKEELEEIE-IETKNEGGKAIWEELKKYLPAYSLFQSDRKNQDKDGEIQDPMKEAVKEALSNKEIIDTLNNISTEVINAVKDVTQRTLEKLAEMNPEIAKELEPEIP---KKIEWDKVFNFGLRSDNGIPLNKRGSGVRRMILLNFFRAQAEKRRSSDSSSNIYAFEEPETAQHPDYQKKLIDSFIELSKKNTQIIFTTHSPEI. 372
188 7.000e-71gi|654738863|ref|WP_028195112.1| hypothetical protein [Paraburkholderia fungorum]  clstr ali  39  23MKLAEIRIRNFRCYRNFLISFDKLTCIIAKNDIGKSSILEALEAFFN----LEKLDAEDRSTGVRN--ADPIEVTCVFENIPTTLVVDTDALISPHNEYLLNRDGCLEIRKCFFGASPKEEIYVRAVHPTAPNFDDLLTLTIAALRQRAQALNLTGINQTIKSAIRHAIWSSVP---LEDLRLEEVLIEVKATIWKPLQNALPLYQLFRADRPSSDQDSEAQDPIKFAIREALAGREAE--LETLGAYVKAQVEQVTRATISKLREMDPALASELNPVFSPFNWAKV----FSVSLTGEGQVPLNKRGSGVRRLFLINFFRAKAEQLASGRGAPVILAVEEPETSQHPNNQLLLLDALWELSQDPNQVVLTTHNP... 388
189 1.000e-70gi|848256014|gb|AKN26923.1| hypothetical protein AB691_2023 [Pseudomonas stutzeri]  clstr ali  17  20MHIAKLTLVNYRNFASADLMFKGVNTIIGENGSGKTNLFRAIRLLLDDSMSRSRLEEADFHRGLDNWRGHWIIISLEFDEVGPDEAIQALFLHTYNLIFRPKKDVRLKLAKLANGDIARESIEITDYETVITGRSTADFGSPATYSEIVGDFENIISYETDDPRIGARVSPLLSVASEVSFTYIKALRDVVAEFHNNRTNPLLTLLKSKSGSISAPDMDPIVARVRELNESIVALNDVQVVRSDIRSTIKAAAGETYSPSSLSIRSDLPEEADKLFQSLK----------LFVGESDENYEGAIHELSLGGANLIFLTLKLLEFQYQRARQSIANFLLIEEPEAHIHTHIQKTLFD---RISYADTQIIYSTHSTQI. 406
190 1.000e-70gi|940303367|gb|KPZ08377.1| Uncharacterized protein ALO40_05804 [Pseudomonas syringae pv. viburni]  clstr ali  17  43MHISQLSLINYRNFANTKLLFKGINTIIGENGSGKTNLFRAIRLLLDDNMSAYRLEQTDFHRGLGRWQGHWIIISLEFEEISADEAVQALFRHTGKATYNLIFRPKKEIRLRLSQLNDGDHVTLDDYETIFTGRSEADFNDTAFYKEVVGDFENARFSEEEFPAIGAKIPSVLSISKEISFTFVQALRDVVSEFHNNRTNPLLSLLKGKSGDIDPVAFQAITDGVKALNDSIEALPDVQVVRTDIRDTIKDAAGEAYSPSSLSIKSDLPDEADKLFQSLK----------LFVGESGEGHEGPIHELSLGGANLIFLTLKLLEFKYQKAKQSIANFLLIEEPEADIHTHIQKTLFDKLK---YDDTQIIYSTHSTHI. 428
191 2.000e-70 [KEGG:K07459]|[eggNOG:NOG70858]  ali  43  1MKIKRIYIENFRGFSGSNIDIDNLTTFVGKNDTGKSSVLEALEIFFHPKSKLVKFDESDKNIRS---ECDTVRIGVSFSDFPVDIDIDSGNITNLEKEYLLDDKGYLTFVRSFYPQQSSE---LWANYPEHEECKDLLKSKQSALKKKVTELGLDC-DKNKNADMRLAIFEHYDVSNNLSLQF----KSIDKELSDKLTTQFPNFFLFQSDRSNHDTDKEVQDPLAFAVQSILSDNDLKNLQKEMAEKVIERLKQVSEKSLEKLKEMNPELAKQLFPKLPDPEELKWPDVFKNVSIVDENNISLNKRGSGVRRLVLLNFFRAEAERQAAASNINQIYAIEEPETAQHRSHQQKMMRALSDLS-SNFQILLTTHS.... 365
192 3.000e-70gi|657042655|ref|WP_029285725.1| ATP-dependent endonuclease [Pedobacter sp. R20-19]  clstr ali  19  1MYISKIIIEGFRNFPKNTIEFNDVNVIIGHNNAGKTSLLKAIGLMIDQNVP-KKLEIDDFSKHILQANAPEIVISLDIDQSKSEDLTSDDLVTVADWLIKLEEPYQAKLTYRFSLPFEKHGDYHTALTGCTTKQDAWLVIKHEFLR--FYQNKIYGGDPTLRVLADSSALQKFDFQFLTAIRDVERDMFTGKNTMLRDVLDFFMDYEIKSADDAVKNKATKLAEIKALKTNFTAKAGLIKDLQTRMEAGKEHILSYATQTGATFNNALPDFDGTISDVEMYSAIKLIIG-----YAGLDITIPASHNGLGYNNLIFMSLLLAKMQVNSSNAKVFPVLAIEEPEAHLHPAMQYKFLKFLKENKNKRRQIFVTTHSTQI. 383
193 3.000e-70gi|1011829319|ref|WP_062648282.1| ATP-dependent endonuclease [Chryseobacterium kwangjuense]  clstr ali  19  1MYISKISIEGFRNFPQNEILFNDVNVIIGHNNSGKTSLIKAISLVINSETP-RRLELDDFSKSNLQRLPPSVSISLTFKKSTDEPPNSEDLVTVSNWLTVLSADYEAKLTYKFFLPIEKHDEYIDSLQECDTKDKAWQVIKQDYLR--FYTYKIYGGDPSLLQTADSESLQKFDFQFLNAIRDVERDMFTGRNTMLKEILDFFLDYDIKADEAVKTSEVKLAEIKAAKQAFSVQATALITELQIRMRAGKDQILNYARQTGATFNNATPDFDGGISEVELFSALKLIIG-----YTGLDIKIPATHNGLGYNNLIYMSLLLAKMQVNSSNAKVFPVLAIEEPEAHLHPSMQYKFLKFLKELERKVRQIFVTTHSTQI. 383
194 4.000e-70gi|740647270|ref|WP_038432716.1| lantibiotic ABC transporter [Streptococcus pyogenes]  clstr ali  43  1MRLKKLKLKNFRGYRDEVVDFDALTAFIGKNDAGKSTILEALEIFFNNKL--VVCEREDLSVGVDED---SIYITCIFDELPNEIIVDTSSKTSLQEENLLNSDGDLEIKKIFKCSSAKPKIKIVCNHPVDDNFKDLLLLKQGELKKRAVDLGIDENNKRSNVSIRKAILDS-NANLTIEKVELEVDKEDAKKVYGVIETFLPIYALFQSDRSSSDSDKEIADPMSVAVSQALQ--ELKSEIDKIKREVQQKAIETAGRTLAKLQEMDEELAASLIPEFK---SEPKFDSLFKLSIKSDDDISINKRGSGVRRLILLNFFRAEAERKLSETERNIIYAFEEPETSQHPSHQKLLIEAFLELSKENTQIILTTHTPAL. 374
195 4.000e-70JGI.Meta 7039803953 SRS045713_WUGC_scaffold_32954__gene_52829 hypothetical protein [Human Stool microbiome from visit number 1 of subject 40  ali  41  1MRLEKVILENYRGFKATTINIEDITAILGKNDAGKSSILDALNVFFNGG-----IEKDDACVTGDSS---NVKISCVFSDLPETIIIDTTNNTQLTQEYLLNADGFLEIEKLYDCTLAKPKIFAVAMHPATENYNDLLSLKIADLKKRASNLNVDNVNQTISANIRSAIWASAEQHLEE--TRISLTKEDGKRIYDALSKKFPYYALFKSDRPSTDQDAEAQDPMKVAIKEVTER--LEESFAQIKNEVEHELTQIAELTVKKAQELSPEIARILTPKVNT----KKLDSLFSVSLSGDNDIPINKRGSGIRRLLLLSFFRAEAERKLSNSDRGIIYAIEEPETSQHPHNQKLLLEAFADLAENSNQILLTTHTPAL. 372
196 7.000e-70gi|737592811|ref|WP_035563609.1| ATP-dependent endonuclease [Burkholderia sp. 9120]  clstr ali  16  1MHIAKLTLINYRNFSRTTLTFKGVNTIIGENGSGKTNLFRAIRLLLDDNMVRYRLDDIDFHRGLGQWRGHWIVISLEFSDIGPAEAIQALFLHAAGVTYNLIFRPKKEIRLKFSALDDRNSITIDDYETLFTGRSEANFADPLVYNAIVGDFEQAIFSEEDDPRIGARVPQILSLTKEVSFTYIQALRDVVSEFHNNRTNPLLNLLKSKSGEIASATMAPIVEKVQDLNASIEALEDVQTVRSDIRKTIKDAAGETYSPASLSIKSDLSDEADKLFQSLR----------LFVGESDENYEGTIQELSLGGANLIYLTLKLLEFKYQKIRESIANFLLIEEPEAHIHTHIQKTLFD---RIAYTDTQIIYSTHSTHI. 392
197 7.000e-70gi|644962161|ref|WP_025382916.1| MULTISPECIES: ATP-dependent endonuclease [Yersinia]  clstr ali  17  1MYISKLSLLNYRNFANTKLLFNKTNTIIGENGAGKTNLFRAIRLLLDDNMSAYRLDKTDFHRGLGQWQGHWIIISLEFEEISADEAVQALFLHVGKATYNLIFRPKKEIRLRLSLDAILGLVTIDDYETIFTGRSEADFNDETFYRQVVGDFTNVRFNKETEFRIGAKIPSVLSVSKEISFTFVQALRDVVAEFHNNRTNPLLTLLKSKSGDIDPVLFTAITDKVKELNDSIEALPDVQNVRTDISSTIKDAAGEAYSPSSLSIKSDLPEEADELFQSLK----------LFVGESGEDHEGPIQDLSLGGANLIFLTLKLLEFKYRKARQSIANFLLIEEPEAHIHTHIQKTLFDRLN---YDDTQIIFSTHSTHI. 384
198 9.000e-70gi|780791680|gb|KJR98259.1| DNA helicase [Desulfobulbaceae bacterium BRH_c16a]  clstr ali  18  1MKIKHVKVENFRLLRDVELGLEDTTLIVGRNNSGKTSIAEIFRRLLSDK--ALNFRLEDFSLGCHEKFWTAFEAVHAGISAPDVLGLLPYIRITLDIAYDVDAPD-LGPLSDCIIDLNPDCSFARVVLNYGPRSTAADVL-------FADLPAPEADIAAVRAALFRVLGNRIPAAYCSSLEAVDPNDGTNRKMELKILTALVQGGFINAQRGLDDDTKRERDVLGKVVEVLFQDHEKRTIAEQLKVAVEDIQSDLHADFNTKLTSLLPTFDLFGYPGLPDPVEKLLSDHTKVRYGKNGVTLPETYNGLGVRNLVYMLFQLLRFFREYQTAAGVHLIFIEEPEAHLHPQMQEVFIRQLDQITNVPVQFVVTTHSPHM. 400
199 9.000e-70gi|751646950|ref|WP_041113927.1| lantibiotic ABC transporter [Bacillus badius]  clstr ali  44  7................ISIDFNELTAFIGKNDAGKSTILEALEIFFNNSL--VVCDREDLNVNA---EDSNIEITCVFSDLPEKIVLDTSSETNLKSEYLLNLNEELEIKKVFKATSAKPKIYIVCNHPTVEPYSELLSKKRTELKQIAKQLNIEKYNATSNTSLRRAIWEN-SENLVCQLQELLVDKEDSKKIYESLEKFLPIYSLFQSDRASKDNDKEVTDPMSLAIEQAL--KELVPEIETIKENVRNKAVETANRTLEKLKEMDKDLADSLNPDFK---SEPKFDSLFKLSIKSDDGISINKRGSGVRRLILLNFFRAEVERKNDSTSQNVIYAFEEPETSQHPKHQEMLINSFLQLANTNSQVILTTHTPAL. 362
200 1.000e-69gi|1011228157|ref|WP_062147305.1| hypothetical protein [Beggiatoa leptomitiformis]  clstr ali  41  1MKLVQVRLRNFRSYKEVTIDIEKITALLGCNDAGKSTVLDALDIFFNDVPL-------DKHDACKTGDAQDVAIICVFDELPESIVLDEEASTTLQVEYLLNLNKQLEIHKTFDLEKPKSKFELKAFHPTHENAKDLITLTNDKLKKRAREAGVSADDERCNSSLRRAIRDQIETQLQLDEQLISLADGNAKKIWGNIQSKLPLFALFKSDRPSNDQDAEAQDPLTIAIKEALKTKT--NELDAISEFVKDEVSKVTQRTLDKLCELDDNLATTLKPQFSDFKLDKWASVFK-TSIIGDNDIPINKRGSGVRRLILLSFFRAKAELSEGENSV--IYAIEEPETSQHPNYQRLLFEALSELSSMN-QILITTHTPVL. 369
201 2.000e-69gi|835558122|ref|WP_047556982.1| ATP-dependent endonuclease [Rhizobium leguminosarum]  clstr ali  18  1MHISRLQLVNYRNFEKANVVFKKINTVIGENGSGKTNLFRAIRLLLDDNMSALRLDEKDFHRGLGDWRGHWIIISLEFEDVSPDEAIQSLFLHNIDDEYSLIFRPRAVVRNRFLQLDEGDQVTIDDYEAVLTGKSTADFTDPQVYKALVGDFENVRFSKELDPEIGGRTPGIFSITKEVSFTFVQALRDVVSDFQNNRTNPLLTLLKSKSGEINSAEFGSIASKVKDLNTAIEDLKDVKEIRGDIRKTINETAGDAYSPSSLSIRSDLPDEADRLFQSLK---------LFVGEADEKDYEGAIHELSLGGANLIYLTLKLLEFKYQRVKQSFANFLLIEEPEAHIHTHIQKTLFDKLN---YEDTQVIYSTHSSHI. 387
202 3.000e-69gi|947657395|ref|WP_056320110.1| MULTISPECIES: ATP-dependent endonuclease [Rhizobium]  clstr ali  16  1MHISRVQLVNYRNFERASFHFNKINTVIGENGSGKTNLFRAMRLMLDDDRWAYRMEESDFHRGIGNWRGHWIIINIEFGEVSQDEAVQALFLHVIEDEYNLIFRPNAAIRTRLAQLDQDDAVTLDDYETVFTGKSTADFSDPAVYQELVGNFETVQFPAELHATLGGRVPGIMSVSKEVCFTFIQALRDVVSEFQGQRTNPLLTLLRSKSGDLDPAVLAPITDRVNQLNSEIEAIPDVGEIRADIRQTIRDAAGETYSPASLAVRSAVPGEADRLFQSLK----------LFVGETDDEYEGAINELSLGGANLIFLSLKLLEFKYQKAKQACANFLVIEEPEAHIHTHIQKTLFDRLN---YPDTQVIYSTHSTQI. 386
203 4.000e-69gi|764958487|ref|WP_044528519.1| hypothetical protein [Herbaspirillum sp. B65]  clstr ali  38  1MKLEGVLISNFRCYRAFYVPIDILTCIIAKNDAGKSTVLEALDAFFN----LEKLDAEDRSIGARN--ADAIEITCFFSSIQATLILDSDALISPATEYLLNAQGQLEVTKKFTGATPKCEVFVKALHPTAPRFNDLFDLSIAELRRRAQELNVDLQNQTIKSALRHAIWSSVP---QADLELQEVAIEIKSTIWKPLQNALPLYQLFRSDRPSSDQDAEAQDPIKFAIREAIVGREAE--LNAIGAYVRDQVAAVTHATIEKLREMDPGLAAELNPVFSPFN----WAKGFAVSLTGEGQIPLNKRGSGVRRLFLVNFFRAKAEQLANGRGAPIILAIEEPETSQHPNNQLVLLEALIELSQSSTQVLMTTHNPLI. 368
204 4.000e-69gi|786216542|ref|WP_045752279.1| chromosome segregation protein SMC [Sphingobacterium sp. PM2-P1-29]  clstr ali  19  1MYINSIGIEGFRNFKESQIEFEGVNVIIGHNNAGKTNLLRALSLVLDNKTS-RKLEIDDFNKNILRAQPPKVTIKLSISESENEDLTADDLVTVSPWLTKLESPYNAMLTYVFFLPESEHTEYLEALAGETDMKTAWLKIKHDFLRKYV--HKIYGGNPALQNQAESENLQKFDYQFLHAIRDVERDMLTGKTSLLREVIDFFMDFQIKNDV-SKDKAAKHSEIIAHKQTFSADALNLITQLQNRMKEGRDHIMKYADETGAAFDGAKPGFDGQI------SEIEMYSALKLIITHTTGIEIPATHNGLGYNNLIYMSLLLAKMQYLGSNAKVFPVLVIEEPEAHLHPSLQYKLLRFLSTETQNARQIFITSHSTNI. 379
205 5.000e-69gi|551224195|ref|WP_022851716.1| hypothetical protein [Geovibrio sp. L21-Ace-BES]  clstr ali  40  1MKLDIVKIKNFRCYKNISIHFSDLTTLVAKNDIGKSSVLEALDTFFN----ADKLESGD--RSAGLSSSDDIEITCIFTDIPRHLIIDTDHRISPANEYLLNTEGKLEIKKVFSSASPKEKVFIRASHPTVENFNDLFSLNITQLKARAKELNLEGVNETVKSALRHAIWSSVSDEQLVK---QLVELEVKSKIWKPLQNTLPLFQLFKSDRPSSDQDAEAQDPIKFAIKEAITQKA--NELVAIENYVKRQVEEVTNLTIEKIREMDPELANQLNPNFS----KFNWGKVFSVSLTNENQIPLNKRGSGVRRLFLINFFRAKAEQLASEDVQDVIFAIEEPETSQHPNNQMLLLDALKELAEETHQVIFSTHNPVL. 368
206 7.000e-69gi|495591638|ref|WP_008316217.1| ATP-dependent endonuclease [Leptolyngbya sp. PCC 6406]  clstr ali  19  1MYISKIHIKGFRNFKDQEVTFNDANVIIGHNNAGKTNLIRALALVIDC-QGTKRLDVDDFYKNINLSEVKSITVSLSICQSEDEDLNSDDLVTVSNWLTKLDPPYEALLTYGFFLPEKEIENYKRSLEDVTDLKKAWQIIKHDFIRLYV--YKIFGGIPNLLNIADSESLQKFDFQFLDAIRDVERDMFSGRNTLLKEVLNFFMDYEVKNDHAKTIEEKNTEIKQKKRNFS-DQAERLLEQLQLRMVEGKKQILSYAEETGASFNRANPDFEGNL------SDVEIFSALRLIVEYGTGIRIPATHNGLGYNNLIFMSLLLAKMQVNSSNAKVFPILAIEEPEAHLHPAMQYKFLKFLRDNKDKVRQVFVTTHSTQI. 381
207 7.000e-69gi|430783956|gb|AGA69239.1| putative ATP-dependent endonuclease of the OLD family [Desulfitobacterium dichloroeliminans LMG P-21439]  clstr ali  20  29MYISKIRMINFRNFKNTEIEFNDVNVIIGHNNAGKSNLIKALSLVL-DSQVSRQLDIDDFNKYISLDELKKISIAITINQSIDEDLNSDDLVTVGNWLTQLNEPYESLLTYEFFLPEKEKSNYLNIITTAIDLNMAWKIIKHDFIRLFA--YKVWGGDPITQTVADSESLQKFDFQFLDAIRDVERDMLTGKNTLLRNVLDFFMDYEIKSDVTKSEEDKR-KEIEKKKQDFSDHADALLLDLQERMKQGKDQILSYAKDTGASFNKAIPNFEGSI------SDVEMFSALKLIVEYETGIKIPATHNGLGYNNLIFMSLLLSKMQVNSSNAKVFPVLAIEEPEAHLHPAMQYQFLRFLKKNKEKVRQIFVTTHSTHI. 408
208 8.000e-69JGI.Meta 7063936265 SRS049318_LANL_scaffold_178366__gene_257352 hypothetical protein [Human Supragingival plaque microbiome from visit numbe  ali  44  1MKLKQLKLKNFRGYKEICVEFENLTAFVGKNDVGKSTILEALEIFFNNK--TVQCEREDLSVN-HKDEDENIEISCVFSDIDIPIILDSNFETNLKDEYLLNKDGFLEIKKVFKCSIAKPKSYIVCCYPSEENCKDLLLLKSTELKRRAESLDIPKENYSINASIRRAIFNNFSDLNLVE-TDLAVDKEDSKKIFNKLEEYFPMYALFQSDRASSDSDKEIVDPMQIAISQAIKGLEVE--INKIKEEVKNKTLEIANKTLEKLKEMNSTLADSLIPEFK---AEPKFDSLFKLFINSDDGIAINKRGSGVRRLILLNFFRAEAERQLKENKNNIIYAFEEPETSQHPNHQIMLIESFLKLSKENCQIILTTHTPAL. 376
209 8.000e-69JGI.Meta 7023684193 SRS015574_WUGC_scaffold_79494__gene_104450 ATP-dependent endonuclease of the OLD family-like protein [Human Supragingiva  ali  21  1MKIQSVRIKNFRTLKDVSIPFDSVTTFIGPNGAGKSTVLRALDWFFNGKPGS--LNEKDCSFGA---IDEDIEVQITFSDLTEKDREALG-------KYAPEGAATFTAWKRQSPDGSDIKGFPDFNAIKAAGNATAKKDLYALLRRDRPDLELPAATSGAAVEQAMTAWEANHTDQLVDAPEALQTNFFGFNSNGKMSGLFDFVLVTADLRASEESIDGKSSIIGRILERSIDRAAADEEIAKIVEEYEEKFKEQLDGVTAQLNEVVASYSPGRSVTVSPADVELKKTTFEVAVLDGTNETAVERQGHGFQRTILISALQLLAQSGAASAEGVICLAIEEPELFQHPIQAQAFAKVLRSLAEKRIQVTYATHSPYFL 384
210 9.000e-69 GL0061985 [Complete] locus=scaffold3041_1:18447:20555:+  ali  20  5MYISNIHIENYRGFSDLSVDFDGINILIGPNNSGKSNLLRALALIF-DGKFRKQLSVDDFYNGITKQHSPKIVVTVTLSQSDDEDLMGDELVTVSSWLVKLEKPYSAKLQYEFFLPEEYESIYIESIQNVSSTSEVWTRIDNSFIRLYV--YKIWSGNPENQMQADSEGLSKFDFQFLDAIRDVERDMFSGKNTLLKSVIDFFLDYDIKSDKALSSEEQT-QKINERRRDFKEKSDILVEVLKKRLENGRNQILSYADHVGASFDNSKPTFEGAI------SENEVSSILQLLVQQETGMRIPIGNNGLGYNNLIFMSLLLAKMQIDASNAKVFPILAIEEPEAHLHPTMQFQFVKFLKDNLRDKRQVFITSHSTHI. 384
211 1.000e-68gi|739201580|ref|WP_037065030.1| ATP-dependent endonuclease [Rhizobium leguminosarum]  clstr ali  17  1MYISRLQLVNYRNFARADVAFKKVNTIIGENGSGKTNLLRAMRLLLEEGMVRHRLDAQDFHRGLKDWRGHWLIISLEFSEVSDHEAVQSLFLHNVGNIDDGSALGKLTPGDKAGLDAVRAKIEIEDYEPVFTGKSSADFADPETYKAIVGDFDDVIFPEELHDALGGIIQGGFSITREISFTFVQALRDVVSDFQNNRTNPLLTLLKRKSGEIDPVTFKPISGKVKDLNDAIEALPDVRTVRSDIRETISDAAGETYSPRGLSIRSDLSDEADRLFQSLK----------LFVAENDELHEGGIHELSLGGANLIYLTLKLLEFRYRSRKESFANFLLIEEPEAHIHTHIQKTLFDRLN---YTDTQVIYTTHSTHI. 387
212 2.000e-68gi|919190583|ref|WP_052746084.1| hypothetical protein [Sulfurovum lithotrophicum]  clstr ali  40  1MKLIRFCVKGFRGYQETCIDLNDLTTIIGKNDSGKSTVLEAMDTFFNN----IKMDAGDYNINLGD--TKEIRLTAVFSNLPDEVVIDETNPINLAEEYLLNSDGYLEIEKVYKGAAPSHKTYIIANHPSNENFSDLLKLKITPLKTRARELDLDGVNQTMKSEIRKRIWESIELEFELQ--SILVKDEDTKKIGEKLEAIYPTYSLFKSDRPSTDQDAEAQDPMQVAIKEAMKAQEA--RLNVIARRVQREVEAVANRTVEKLQEMDLELANELNPVFKTD-----WGKVFKLSLTSDEQIPINKRGSGVRRLILLNFFRVKAEQQNSTN---IIYAIEEPETSQHPDNQKMLIEAFWELSQDNTQVLFTTHTP... 362
213 2.000e-68gi|495967463|ref|WP_008692042.1| lantibiotic ABC transporter [Fusobacterium nucleatum]  clstr ali  44  1MKLKELKLKNFRGYKEICVEFENLTAFVGKNDVGKSTILEALEIFFNNKI--VQCEREDLSVN-HKDEDENIEISCIFSDIDIPIILDSNFETNLKDEYLLNKDGFLEIKKVFKCSIAKPKSYIVCCYPSEENCKDLLLLKSTELKRRAESLDIENYNASINASIRRAIFNNFSDLNLVE-TDLAVDKEDSKKIFNKLEEYFPMYALFQSDRASSDSDKEIVDPMQIAISQAIKGLEVE--INKIKEEVKNKTLEIANKTLEKLKEMNSTLADSLIPEFK---AEPKFDSLFKLSINSDDGIAINKRGSGVRRLILLNFFRAEAERQLKENKNNIIYAFEEPETSQHPNHQIMLIESFFKLSKENCQIILTTHTPAL. 376
214 2.000e-68gi|771519299|ref|WP_045172140.1| lantibiotic ABC transporter [Enterococcus faecium]  clstr ali  42  1MKLVQLIVKNFRGYKETKLNVDELTALIGKNDAGKSTLLEAMEIFFNNKK--IACEKEDLSIECDEKKDN-IEISCLFSHYPTKLTIDSGSETTLKKEYLLNKDGLLHIKKIFNCKKPKEEIYIVCNHPTKSGYDNLLLLKQTDLRKKVQALNIEKYDARNNASMRKAIWQS-CTNLELEETELIANKEDSKKIYEALETYLPTFALFQSDRKSSDSDNEITDPMKIAISKALM--GLEKEINIIKKEVQEKAIESAKITLEKLKEMDPTLSDSLIPEFK---SEPKFDSLFKLTIRSDMGISINKRGSGVRRLILLNFFRAEAERKLTENDRNIIYAFEEPETSQHPTHQRMLLESFIELSKKNCQILITTHTPAL. 376
215 2.000e-68gi|515232413|ref|WP_016818716.1| ATP-dependent endonuclease [Paenibacillus polymyxa]  clstr ali  19  1MYISRIEIENYRNFKNKPISLNDINVIIGHNNAGKTNLIKALALVL-DSNGKKRLDIHDFNKSISLEELKKIRIGVTIKQSDNEDLNSDDLVTVANWLTKLEEPYEALLTYEFYLPEKETEKYVATLSNATDIDKAWRIIQQDFLR--LYIYKIWGGNTVNQTTADSDSLQKFDFQFLDAIRDVERDMLSGRNTLLKDVLDFFMDYDIKSDPKRKEEEKIEELKFKKQNFSDTADL-LLSNLSQRMQLGKEQILSYARDTGASFNKAKPNFEGSI------SDVELFSALKLIVEYETGIKIPATHNGLGYNNLIFMSLLLSKMQVNSSNAKVFPILAIEEPEAHLHPAMQYQFLKFLIKNKKEKRQIFVTTHSTHI. 380
216 2.000e-68gi|491033223|ref|WP_004894909.1| hypothetical protein [Acinetobacter schindleri]  clstr ali  41  1MKLIALKLENFRGYQENLIYIDDLTGIIGKNDAGKSTILEALDIFFENSS----LDKSDKCVNCTEE--DNISITCIFDDIPTSLTLDATSVTTLQEEYLLNSEGYLEIKKTFRVNQKVSTDLLLAKYPDNNGLDNLIILKNADLKALFKTKGLDISDQRSNTSLRQYLFQSEPLTFRLK--EVPLNKEDAKNVWDALKNFLPIYALFKSDRNSSDQDSEVQDPMKLAIKHALS--EIQPQLQKIQEHIKTKVEDVAGRTLEKLAEMDSNLAQDLIPDFS---KEPKWESIFSMALSSEQGIPINKRGSGVRRLILLNFFRAEAEKKFRENGRSIIYAIEEPETSQHPDYQEMLIKALLDLSLPKTQILVTTHTPAL. 372
217 2.000e-68gi|917632467|ref|WP_052201509.1| hypothetical protein [Ensifer sp. ZNC0028]  clstr ali  37  3....................FGNLTALVGRNDVGKSTLMDALAIFFETASP----DKDDACKAGD---PKQMRITCEFDQLPEQLVVDAEFPTTLSGEYLLSANGTLVIRKTYNGSLGTPKITAIADHPTAAGYSDLLTLKKAELAKRAADQNLDGVDKRANALVRAAIWQS-CGDLKLATAAVSLDAEGSKQVWAELQQYLPTFALFKSDRASTDQDAEAQDPLKAAIR--EAIKAVEPKLQEVRDYVESEVKKIAAATVDKLREMDASVAETLNPVIAT----KKWDTLFSTSITGDEGIPLNKRGSGVKRLVLLNFFRAKAEKSAAEKSSSVIYAIEEPETSQHPRNQRLLLNALRELSDDGKQVIVTTHTP... 350
218 2.000e-68gi|902768212|ref|WP_049639578.1| hypothetical protein [Methylophilus sp. TWE2]  clstr ali  38  5.KLAKIKIRNFRCYEEFVMTFDELTCIIARNDAGKSTVLEALDAFFN----LDKIDSEDRSIGVPN--GTPVEITCVFSELQPQIVVDTDAIISPQREYLLNADSQLEIRKSYSGTSPKEQVYVTALHPSAENFNDLFNLSIAQLRQRARTLGLDGINQTIKSAIRNAIWDSVDS---VALGLSEVQLEIKETIWKSLQNSLPLYQLFRADRPSTDQDAEAQDPLKFAIKEALANQ--QQALDAIGAQVKAQVETVTRATIDKIREMDPALAAELNPVFSA----LNWSKVFSVSLTAENQVPLNKRGSGVRRLFLINFFRAKAEQLASGRGAPVILAIEEPETSQHPSNQXXXXXXXXXXXXSSTQIIMTTHNP... 369
219 3.000e-68gi|499192107|ref|WP_010889647.1| hypothetical protein [Pediococcus pentosaceus]  clstr ali  42  1MHLVSVTIHNFRGYKNTKINIDDLTTLIGKNDVGKSTIVDALEIFFNNT--VVKLDTNDLNIYATD--SKLVSISCEFSDIPESIIIDSNQQTNLKDEYLVNANGNLEIKKVYDCSKKTPKIFAVVHYPDNPEIADLLSKLLTALKKLPPAIQETVTSRVANAPIRQAIRSAYNITNFLT-KDIDLQKVDGKTLWDKIETCLPIYALFQSDRPSNDSDAEVQDPMNTAIQESLSNAAXXXXXXXXXXX--XEVTAVAEMTISKLKEMDPEIAKGLEPQY--QESPKWNKLFKFV-IADEKGIPLNKRGSGVRRLVLLNFFRAKVSMTSDKLKTNLIYAVEEPETAQHPDNQRKIMQALLELGQGNCQIIITTH..... 372
220 3.000e-68 GL0027940 [Complete] locus=scaffold66740_2:512:2338:-  ali  40  1MKLREVILKNFRGYYDETISINDLTALIGKNDVGKSTILEALEIFFNQ----AKIESGDKNVF---HTAEDTIIGCVFDDLPSEIALE-NVSTSFTAEYLLNEDGDLEIRKIYR-TGGKQTIWINAKHPSNAGFDDLLSKKNQELKAMIRENGLENSNLTINTEMRTALWESLGESITYQKKLISADQADEKKLWPKIEPLLPQYHLFKADRSNADEDKVAQDPMQDAVRMAL--EEQKKQLADIAGEVQRKVSDVASRTISKLKEFDSELAKTLTPEFK---KEPMWEKAFAFSLTGDNEIPLNKRGSGIRRLVLFSFFRASVESPLFEG-KSIIYAIEEPETSQHPDAQRMILKTFQEMTEKNCQIILTTHVP... 364
221 9.000e-68gi|504351120|ref|WP_014538222.1| ATP-dependent endonuclease [Ketogulonicigenium vulgare]  clstr ali  16  1MKLHNVKIENFRLLQDVEIGFEDTTLIVGRNNSGKTSIAELFRRLLSEKTLTFRL--EDFSLGCHEKFWNAFEAFSAGAEVSDVLDTLPVIRIIIDVSYDVDDLGALGDCIIDLNPDCTYGRLVLTFGPRPDATTFLFADLPAPEEDA----------ENARSALFRALGARVSATYISILEAIDNDPTNRKPLETKVLTAIIQGGFINAQRGLGDDTKRERDVLGKVVEILFQDPEKRTTAEQLKSAVEDIQSDLHSDFNVKLTSLLPTFELFGYPGLADPERLLSDHTKVRYVGKNGITLPETYNGLGVRNLVFMLLQLLRFFREYQTAAGVHLIFIEEPEAHLHPQMQEVFIRQLDQILNDNHQFVVTTHSPHM. 400
222 1.000e-67gi|501218474|ref|WP_012261492.1| hypothetical protein [Bacillus weihenstephanensis]  clstr ali  40  1MKLTTIKLENFRSYHEVVIDISNFTTLIGRNDAGKSTILEALEIFFNAEIVKP-----DPNDVCKFSGGTSFSITCCFSDLPSSIIIDDSVPTSFNREYLLNNNGELEIKKVYNCSRIIPKVFLNTVVPDIQEMHELVTFNNLSLKAIARKQDINEYTKTSNVSLRDAIRMHLRDKYPDYLLEISGTNKNLKEIHTKIGRLLPHYALFQADRPSRDEDSEVQNPLKLAIKSAIDQ--VAPELERIREKVQDEVLDVANHTLRKLEEMDPKLAQQL---IPQPKKEPEWHKIFNFTLDGDNEIPINKRGSGVRRLILLNFFRAQAER--DSQEKDIILAVEEPETAQHPNNQRKLVETLMSLSEQNYQVLITTHVPAI. 376
223 2.000e-67gi|647241735|ref|WP_025692798.1| ATP-dependent endonuclease [Paenibacillus zanthoxyli]  clstr ali  19  1MYIYKVEIEKYRNFRNREITFNDVNVIIGHNNAGKTNLVSALALVLN-SNGKKRLDIHDFNKSTSLEELKKIRIGITIKQSENEDLSSDDLATVANWLTKLEEPYEALLTYEFHLPEKDNEKYVRTLSDVMDKEKAWKIIQQDFLRLYV--HKIWGGNVTSQNMAENESLQKFDFQFLDAIRDVERDMLSGRNTLLRDVLDFYMDYDIKSDRTITEEQKVEKIRLKKQAFSDGADSLLLNLIK-RMELGKGHILSYAKDTGAGFNKANPSFDGSI------TDVEMFSALKLIVEYETGIKIPATHNGLGYNNLIFMSLLLSKMQYLGSNAKVFPVLAIEEPEAHLHPAMQHQFLKFLLKNKEEKRQIFVTTHSTHI. 380
224 2.000e-67gi|917533972|ref|WP_052140389.1| ATP-dependent endonuclease [Janthinobacterium lividum]  clstr ali  18  1MHISKLQLVNYRNFSRAEFHFKGINTIIGENGSGKSNVFRAIRLLLDETLSRSYLDVKDFNRALGDWRGHWIIVSLQFAEISQDEAIQALFLHTGELELDPIERATLNLLYRFALMALRESITILDYEPTLTGRSIADFSDPQVYRSLVGDFENVEFPAELEPYLGTRLPNILSIHREVCFTFIQALRDVVSEFHNNRTNPLFALLKAKSGEIDSAEFAPIVAQVDGLNTAIESLAGVTGIRGDIHDTINDTAGDAYAPASLSIKSDLPNEAEKLFQSLK----------LFVGESDYGHEDAIHELSLGGANLIFLTLKLLQFKYQSKGQSFANFLLIEEPEAHIHTHIQKTLFERLD---YPNTQVIYSTHSTQI. 386
225 2.000e-67gi|489614561|ref|WP_003519002.1| ATP-dependent endonuclease [Ruminiclostridium thermocellum]  clstr ali  20  4MYISKIQIKNFRNFKQFEAHFNNINVIIGHNNSGKSNLIKALALIF-DSNTKKHLEIDDFNKYILKNEPPKISIAITITQQEDENLMSDDLVTISNWLTKLEEPYEALLTYEFMLPVKEHERYKKKVNNLEKEEEIWEVINRDFLR--LYTYKIWGGDPINKTVADSESLQKFDFQFLNAIRDVERDMFTGRNTLLKSVLDFFIDYDIKSDKEKTEDEK-LSEISEIKRKFSIDANNLIKSLQKRMEKGKKEILSYAYNIGASFDNSYPNFDGNI------SDVQLYSALSLIVEYKTGIKIPVSHNGLGYNNLIFMALLLAKMQINSSNAKVFPILVIEEPEAHLHPSMQYQLLKFLNTNIKQNRQIFVTTHSTHI. 383
226 2.000e-67gi|960412474|ref|WP_058304429.1| ATP-dependent endonuclease [Gorillibacterium sp. SN4]  clstr ali  20  1MYIHKMMINNFRNFKEQVIEFNDVNVIIGHNNAGKSNLFKALALVL-DSQRTKRLNVYDFNKNELIENPPQINISLVIKQSLNENLNSDDLVTVGNWLTKLDEPYEAVLTYDFFLPEKERVSYVEAIR--NAPDLDIAWKIINHDFIRHYVYKIWGGDKTTRNVADSESLQKFDFQFLDAIRDVERDMLSGRNSLLRDVLDFFMDYEIKSDLDKSEEVKKMEIKQKKKDFSEIADT-LLRDLQNRMSVGKEQILSYAKDTGASFNKAIPNFEGSL------SDVEIFSALRLIVEYESGIKIPATHNGLGYNNLIFMSLLLSKMQVNASNAKVFPILAIEEPEAHLHPAMQYQFLKFLKKNKNEKRQVFVTTHSTHI. 380
227 2.000e-67gi|408003492|gb|EKG43669.1| hypothetical protein Pav013_0143 [Pseudomonas syringae pv. avellanae str. ISPaVe013]  clstr ali  16  22MHLSKVSLVNYRNFEFAKFVFKGVNTIIGENGSGKSNLFRAIRLLLDSNIYRHELSEGDFFRKKTSWKGHWIVISLEFDDISTDESIQSLFVHVNKATYNLIFRPNSHIRTKLAALSAGDKATVDDYEVWFTGRSDVDFTAPARYREIVGDFDNVWFPALDSKLIGTKIPHQLSVAKEVSFTFVKALRDVVSDFNGNRQNPLLNLLTRKSQEIDKSKYETITNTVKSLNLDIEALQDVQDVRGDIRTTISETAGDAYAPASLHIRSDLPSEAEKLLQSLK----------LFVGEADENYAGDISELSLGGANLIYLTLKLLEFKYQKQRETAANFLLVEEPEAHIHTHIQKTLFDNIN---YSNTQIIYSTHSTQI. 406
228 3.000e-67gi|752541217|ref|WP_041212661.1| ATP-dependent endonuclease [Aeromonas caviae]  clstr ali  21  1MKIQSVRIRNFRALKDVTIPFDSVTTFIGPNGAGKSTVLRALDWFFNGKPGS--LTEKDCSFGA---IDQDIEVQVTFSDLTEKDREALG-------KYAPEGISTFTAWKRRSSDGTNAKGFPDFNAIKAASAVAEKKALYVNLKTSRPELELPTANTGTAIEQAMTIWEAAHTDLLEDALESLQTNFFGFNSGGKMSGLFDFVLVTADLRASEESLDGKSSIIGRILERSVDRAAADEEIAKIVEESRAQQQKVYEEITSQLNEVVASYSPGRSVTVSPAEVELKKTTFEVAVLDGTTETAVDRQGHGFQRTILISALQLLAQSGAASAEGVICLAIEEPELFQHPIQAQAFAKVLRALAEDSSQVAYATHSPYFL 384
229 4.000e-67gi|586607268|gb|AHJ69027.1| Putative membrane spanning protein [Granulibacter bethesdensis CGDNIH2]  clstr ali  17  20MRIKGVEIENFRLLRDVAVGLEETTLIVGRNNSGKTSIAELFRRLLGEKAPSFRM--EDFSLGCHECFWTAFEAFRTEASEPDVVALLPSIKVTIDITYDVNDLGPLSDCIVDLDPNCSDTRLILTYGPRPAAPTTL-----------FADLTVGEDVAVNRATLFRALGSRISGAYTASLEAVDNDATNRKALEPKTLTALVRGGFINAQRGLDDDTHRERDVLGKVVEVLFQDPAKRTTAEQLKAAVEQIQGDLHAGFNAKLTSLLPTFDLFGYPGLSDPVDKLLNDHTKVRYVGNGMTLPETYNGLGVRNLVYMLLQLLRFFREYQAEPGVHLIFIEEPEAHLHPQMQEVFIRQLDQILNENVQFVVTTHSPHM. 418
230 4.000e-67gi|499838344|ref|WP_011519078.1| ATP-dependent endonuclease [Cupriavidus metallidurans]  clstr ali  20  1MKIQTVRIRNFRTLKDVTIPFDSVTTFIGPNGAGKSTVLRALDWFFNGKPGS--LTEEDCSFGAT---DEDIEVQITFADLTEKDREALG-------KYAPEGVGTFTAWKRRSPDGADAKGFPDFNGIKAAGGATAKRELYASLRRDRPELDLPAANTGPAVEQSMTTWEAAHTDQLLDAPEALQTNFFGFNSGGKMSGLFDFVLVTADLRASEESIDGKASIIGRILERSIDRTAADEAIAEIQQVYEEKFKEQLGAITTQLNEVVTTYAPGRAITVSPAEVELKRTTFDVAVLDGTTETAVERQGHGFQRTLLISALQLLAQSGAASAEGIICLAIEEPELFQHPIQAQAFAKVLRSLAEKRIQVTYATHSPYFL 384
231 5.000e-67JGI.Meta 7007620410 SRS065504_LANL_scaffold_48971__gene_93752 hypothetical protein [Human Stool microbiome from visit number 2 of subject 76  ali  18  1MYISKLSLINYRNFANTQVLFNKINTIIGENGSGKTNLFRAIRLLLDDNMSAYRLDETDFHRGLKRWQGHWIIISLEFKEISADEAVQALFQHRIDKETAGEATYNLIFRPKKALDAILDKITIKDYETIFTGRSEANFNNESFYKEVVGDFDNVKFNKELEFSIGSRIPSVLSVSKEIAFTFVQALRDVVAEFHNSRTNPLLTLLKGKSGDINPNQFAEITDKVKNLNDSIEILPDVQKVRTDIRDTIKDAVGEAYSPSSLSIKSDLPDEAGRLFQSLK----------LFVGESDENHEGPIHDLSLGGANLIFLTLKVLEFKYQKARQSIANFLLIEEPEAHIHTHIQKTLFDNLN---YDDTQIIYSTHSTHI. 386
232 7.000e-67gi|491240083|ref|WP_005098304.1| MULTISPECIES: hypothetical protein [Acinetobacter]  clstr ali  42  1MQLKSITLENFRGYKEATLLVDNFTGITGKNDAGKSTVLEALDIFFGNSSVDR----EDKNIDAEG----SIKITCIFDNYPQFLSLDSGSQTSLEREYLLNENNLLQVCKTFDFTTSSEKVSLICMHPSNEGLNDLIYLKRDDLKKRITARGLDVADLRSNTSIRNFLYESEHLNF--SEQEILLNKEDAKDIWTSLLKHLPIYALFKSDRNSNDQDSEVQDPLKLAIKLALA--DIQPQLDEIQRHIKTRVENVAQRTLAKLAEMDSSLAEDLIPDF--TKEPDWKTLFK-LSLSSEKGIAINKRGSGVRRLILLNFFRAEAERKMSESSSNIIYAIEEPETSQHPSNQEMLIKALIKLSEPKTQVMVTTHVPAL. 371
233 1.000e-66gi|817614085|ref|WP_046601752.1| ATP-dependent endonuclease [Neorhizobium galegae]  clstr ali  17  1MYISRLQLVNYRNFAQADVIFKKVNTIIGENGSGKTNILRAIRLLLDESMIRYRLDEQDFHRGLKDWRGHWLIISLEFSEVSEHESVQSLFLHNAGNTYNLLFRPKAAIRDLPGLASIRSKIELDDYEPVFTGKSSVNFCDPGIYRSVVGDFDDVVFPEGLHSILGGIIPGGFSITREISFTFVQALRDVVADFQSNRTNPLLSLLKRKSGEIDPVSFEPISAKVKDLNGAIEALPDVRTVRSDIRETITDAAGETYSPRGLSIRSDLSDEADRLFQSLK----------LFVAENDELYEGGIHELSLGGANLIYLTLKLLEFKYRSRKESFANFLLIEEPEAHIHTHIQKTLFDRLN---YADTQVIYTTHSTHI. 387
234 1.000e-66gi|496279132|ref|WP_008991170.1| hypothetical protein [Galbibacter marinus]  clstr ali  37  1MKLNKLKLKNFRSYSETEIDVSDLNVIIGKNDVGKSTILEALEIFFNGKP--------DKHDLCISNDNSQIEITCVFDDLPDTLILDDTIETSLKDEFLLNVSKKLEIKKKFPVSSISEESVIICEYPDNENLTDLLSKKRTTLKLQFEELDIEGVNRRRSKELRNAIRNHFFTDTEIKIDGKLDNEDNRKKIWAGLKKYLPIYSLFFVDKPLTDQDSDIQDPMRQIIKEVLKRDHIKPLLEQLKEAVQNASTSLADDTINKLNELDSSLAETLRSNFP---KEPTWNSIFKLTLEDDRGVPLNKRGSGMRRLVLLSFFRAQVENRRTANAPNIIYALEEPETSQHPDFQLMIVNALGELSEENAQVFFTTHNSNL. 380
235 2.000e-66gi|1005372906|gb|AMP98681.1| chromosome segregation protein SMC [Pedobacter cryoconitis]  clstr ali  19  1MYISKITLNGFRNFPENEILFNDINVIIGHNNAGKTSLLRAIGLLISSEDS-RRLEVDDFSKDFLQANPPSVTISLDIVQSVNEDLASDDLVTVANWLTKLEAPYEAKLTYRFYLPVEKFIDYKEELVHATTKDQAWSMIKHEFLR--FYTYKIFGGDPTLQVVADSESLNKFDFQFLNAIRDVERDMFTGRNTMLRDVLDFFMDYEIKSASETEKSLTEKQKEIKDLKKIFSSNADLIGELQRRMHAGKEHILAYAHQTGATFNNAKPDFDGAI------SDVDMYSALRLIIYDALDIKIPASHNGLGYNNLIFMSLLLAKMQVNSSNAKIFPVLAIEEPEAHLHPAMQYKFLKFLKENKDKRRQIFVTTHSTQI. 383
236 2.000e-66gi|983536977|ref|WP_060688590.1| ATP-dependent endonuclease [Persicobacter sp. JZB09]  clstr ali  21  1MYISDIKIENFRNFKSKTIEFEGVNVIIGHNNAGKSNLLKALALVLNNDAS-RRLDIDDFNKNILKDIPPKVVITVTIKKGNDE--TSDDLVTVGNWLTKLDASYEAKLTYEFFLPEKETENYKAELNRITESNKDKAWKTIKYNFIRLYTYKIWGGDIRAKTVADSESLQKFDFQFLDAIRDVERDMLTGKNTLLRDVFQFFLDYNLKEDNTLSEADQNERKDNIRTNREEFSTDSALSQLQRRMEKGKEQILSYANETGASFNNAMPDFEGSL----SEIEMFSALKLIIKYETGIDIKVPATHNGLGYNNLIFMSLLLAKMQYMGSNAKVFSTLVIEEPEAHLHPSMQHKFLKFLKDSKNKARQIFVTTHSTHI. 388
237 2.000e-66gi|1000080500|gb|KXJ48890.1| hypothetical protein AXW11_01235 [Marinobacter sp. Hex_13]  clstr ali  40  1MKLDIVKIKNFRCYKDISIPFSDLTALVAKNDIGKSSVLEALDAFFNSE----KLEPGDRSAGLTN--SDDIEITCVFKDFPEQLIIDTDNLISPANEYLLNPDGKLEIKKIFSSASPKEQIFIRAVHPTAEYFNDLFSLTITQLKARARELGVDLANATIKSALRHAIWLSTPDENLAK---QLVELEVKSKIWKPLQNTLPLFQLFKSDRPSSDQDAEAQDPIKFAIKEAIRQKAAE--LDAIGDHVKRQVEEVTRLTIEKIREMDPDLASQLNPNFSNFN----WGKVFSVSLTNEDKIPLNKRGSGVRRLFLINFFRAKAEQLASEDVQDVIFAIEEPETSQHPNNQXXXXXXXXXXXXETHQVIFTTHNPIL. 368
238 3.000e-66gi|759010439|ref|WP_043069713.1| chromosome segregation protein SMC [Aneurinibacillus migulanus]  clstr ali  21  1MFISQINIQNFRNFKNNVVEFEGINIIIGHNNSGKSNLLKALDLVLNVGSS-KKLSVDDFNKEELREKPPKVSITVTFSESANEPEFSEDLVTVSTWLTELKSPYKAQLTYVFYLPEKEEAEYKREMSLLSSSNINEYWLTIKHNFLRKYKSAIYGGNPDYKNSVDTEALKKIDFQFLDAIRDVERDLFTGRNTLLREVIDFFMDYEIKSNKEI-DKSQQLSEINQLKKEFSQEAAKLINSLKRRMERGTKEMLTYANHTGASFGNSEPDFDGYI------LDSELYSVLRLIIKYQTGITVPATHNGLGYNNLIFISLLLAKMQKDASNAKIFPILVIEEPEAHLHPAMQYKFLKFLKEKSQKARQIFITTHSPNI. 383
239 4.000e-66gi|817108831|ref|WP_046482098.1| ATP-dependent OLD family endonuclease [Pseudomonas veronii]  clstr ali  17  1MRIHQVQIKNFRLLADVEMALEDTTVVVGRNNSGKTSLSEVIRRLLAEG--TAKFQLEDFSSTCYDNFCEA--LQAHKDDAPDDEV------------RALIPAIELRLKFQYDPAQPRLGPLSPFVIDLDPTCTEALVVIRYELDELFEEQPVAPLNEETRTAFFRSLRERIPTHFSTRIWAEDNDPDNRRQLNPAALRGLVKTGFINAQRGLDDVTSRESDVLAKTVEGLFATXXXXXIADALKGTVQDIQSQVDDQFSRQLQSLVPALHIFGYPGITLDVGKLLSNFTKVRYGYGGVTLPESYNGLGSRNLIFILLQLAKAFRAEAKQPGVHLIFIEEPEAHLHPQMQEVFIRQLGKIAQQPVQFIVSTHSSHI. 399
240 4.000e-66gi|506343903|ref|WP_015863622.1| ATP-dependent OLD family endonuclease [Geobacillus sp. WCH70]  clstr ali  45  1MKLHSLYLKNFRGYREEVINFENMNVIIGKNDIGKSTLMEALEIFFNGENKDVKPEIEDCNVNSTEKV---MEIGACFTFEEEEIIIDSSNPTSLKEEYLLNKDGLLEIRKVWDCSKDKIKVYLVAHYPKGID-KPLITLKQEELRKELKIDDYDLINKNKNAEMRKALYKHLDTEFETRFIEIQKIDKDSKNIWDKIKSNLPLYFLFQSDRTNSDNDSEVQNPLKIATKKALA--EMEDQLSHIVEEVDKKVSAIAEDTINKLKDFNGEIANRLKTNLNL----KSWDSLFSFQLESDDGIPLNKRGSGIRRLILLSYFRAEAERIAEENNKNIIYAIEEPETSQHPNFQRMIIDSLLKISDDKHQVIITTHTPEI. 386
241 6.000e-66gi|736744422|ref|WP_034748215.1| ATP-dependent endonuclease [Bacillus wakoensis]  clstr ali  21  1MYISRVEIKNYKNFKANIIEFEGLNVIIGHNNAGKSNLLRAMALIYNPSVK-KNLSIDDFNKQLTLEELKKINVSITLSQEKEENLMGDDLVVVSQWLTKLEEPYEAKIHYEFCLPLKHQDEYEQKLSTATSVNDAWEIIDKNFLR--FYTYKIYGGNLENQITVDSEYMKKFDFQFLDAIRDVERDMFSGRNTLLKNVLDFFMDYSIKSNQGLDDDXXXXXXXXXXXXFE-DQAKVLMDSLNQRMLEGKKQILSYSKEIGASFDNAEPNFAGGI------TDVELYSALKLIVEHHDGIQLPITHNGLGYNNLIFMSLLLAKMQVNASNAKVFPMLVIEEPEAHLHPSMQKQLLKFLKKNLKKVRQIFVTTHSTHI. 380
242 6.000e-66gi|404541486|gb|EKA50843.1| ATP-dependent endonuclease of the OLD family-like protein [Pseudomonas aeruginosa E2]  clstr ali  21  1MKIQSVRIKNFRTLKDVTIPFDSVTTFIGPNGAGKSTVLRALDWFFNGKPGS--LTDKDCSFGA---IDEDIEVQITFADLTEKDREALG-------KYAPEGAATFTAWKRRGSDGANSKSYPPFNAIRGKGSAAEKKAAYNELRTSDASPGLPAWSSVDAAFQAMTAWEADHIDQLVEAPESLQTNFFGFNSGGKMSGLFDFVLVTADLRASEESIDGKSSIIGRILERSVDRAAADEEIAKIVEEYEEKFKEQLDVITTQLNEVVASYSPGRSVTVSPADVELKKTTFEVAVLDGATETAVERQGHGFQRTILISALQLLAQSGAASAEGVICLAIEEPELFQHPIQAQAFAKVLRSLAEKRIQVTYATHSPYFL 384
243 7.000e-66gi|489818620|ref|WP_003722434.1| ATP-dependent endonuclease [Listeria monocytogenes]  clstr ali  20  1MYISKVKINNYRSFINTEIDLEGINVLIGHNNAGKSNLLKALAIVLGSTS--KKMSIHDFNKDIKLEKLKRITIEIHITQSTNEDLMGDDLVTVSNWLTKLEEPYEAKLQYEFFLPVTEHDNYLKKISNAGNSEDAWFIIQHDFLR--LYIYKIWGGNPDNQITADSESLNRFDFQFLDAIRDVERDMYSGKSALLKDVIDFFVDYDIKSNKEITLDEQTRQINVRKEAFKVNADL-LLKSINERLTKGKNEILSYTDDIGASFNNSYPSFDGAL------TENELYSVLNLIVEQESGMKLPIAYNGLGYNNLIFMSLLLTKMQVNSSNAKVFPVLAIEEPEAHLHPTMQNQFIRFLQQNIKKRKQVFITSHSTHI. 379
244 8.000e-66 GL0105276 [Lack 3`-end] locus=scaffold8221_3:1572:2624:+  ali  41  1..........................LIGKNDVGKSTILEALDIFFNQS----KIDSVDRNVF---HTGEETVIGCVFDDLPAEITLE-NVTTSFSKEYLINRDGNLEVLKKY-PTNGKTTIWIYANHPSNDGFNDLLLKKNNELKAMIRAAHLEDGNLSINSAMRAALWASLGDTITFEVREISADQADEKKLWPKIEPLLPSYRLFKADRPSSDEDQEAQDPMQHAMKTAL--EEQSEQLNAIANEVQRKVSEVATNTIQKLREFDPELAATLTPKFK---KEPTWEKAFSFSLTGENSIPLNKRGSGIRRLVLFSFFRATTESALFEG-KNIIYAVEEPETSQHPDAQRMIVNTFKEMTEKNCQIIITTHVP... 336
245 8.000e-66gi|545158659|ref|WP_021513685.1| ATP-dependent endonuclease [Escherichia coli]  clstr ali  17  1MYIHQVEIKNFRLLADAELVLEETTVIVGRNNSGKTSLSEIIRRFLADGSATFQL--EDFSSSCYDRFCDALE------------ALKEGMEDHLVRE--LIPAIELRLKFQYDPAQPQLGPLSPFVIDLDPACSEAQVVVRYELKDFLESHTEMPLSREDRLAFLRILRERIPNNFCVKIWAEDNDPDNRRELPPSALRGLVKSGFINAQRGLDDVTSRESDVLAKTVENLFATASDKQIADALKGAVQDIQTQIDTNFGNQLNSLIPALETFGYPTLLDVSKLLSNFTKVRYSGYSGIALPESYNGLGTRNLIFILLQLAGFYKAEVTEPGVHLIFIEEPEAHLHPQMQEVFIRQLAKIAQQPVQFVVSTHSPHI. 399
246 8.000e-66gi|518820394|ref|WP_019976348.1| ATP-dependent endonuclease [Empedobacter brevis]  clstr ali  19  1MYISKIQINNFRNFKEKEIEFNDVNVIIGHNNAGKTNLIKALSLVI-DTQNHKRLDTDDFNKSLTELKANPPKITIAITIEKGKEQEPDDLVTISNWLTKLESDYEALLTYEFFLPEKKHEDYITELSDDDEKAIDKVWKIIKHDFIRFYTYKIWGGDPINQSIADNESLSKFDFQFLNAIRDVERDMLTGRNTLLREVFDFFMDYEIKKDPDKTNEQKHL-EIKGKKIQFSEKADTLIKELSERIDEGKKEILSYAKNTGASFNKATPNFEGSV------SENEMYSVLKLIVEYETGIKIPATHNGLGYNNLIFMSLLLAKMQVNADNAKVFNTLAIEEPEAHLHPAMQYKFLKFLNENMKEKRQIFVTTHSTHI. 383
247 1.000e-65gi|671633772|ref|WP_031595928.1| ATP-dependent endonuclease [Ferrovum myxofaciens]  clstr ali  19  1MRIHRVKIRNFRLLADVELVLEETTLIVGRNNSGKTSLSELMRRLLTDSAATFQL--EDFSSACYDDFCTAL-------DARNQGLEDDAIRA-------LIPAIEFRLRCRYDPAQPELGPLSPFVIDLDPACTEAVVVIRYELKKLASLFDTEPLNNEIRAAFFRALRERIPNEFGVKIWAEDPNDDNRRQMQPSALRNLVKTGFINAQRGLDDVTSRESDVLAKIVEGLFADAGDQLVAETLKTAVQDIQTQIDTSFGGQLKSLIPTLQSFGYPTVLDVRRLLSNFTKVRYSGYGGVALPESYNGLGARNLIFILLQLYKAFKAELTAPGVHLVFIEEPEAHLHPQMQEVFIRQLAKIAEDNTQFVVSTHSSH.. 398
248 1.000e-65gi|948285013|ref|WP_056929372.1| ATP-dependent endonuclease [Ferrovum sp. JA12]  clstr ali  21  1MKIQIVRVKNFRTLKDVTIPFDSVTTFIGPNGAGKSTVLRALDWFFNGKPSS--LTENDCSFGAIE---EDIEVQVTFADLTEKDREALG-------KYAPDGVVTFTAWKRRSPDGSDAKGFPDFNAIKAANGATAKKDLYAQLRQDTPDLNLPVANTGAAVEQAMTAWEASHTDQLVDAPEALQTNFFGFNSGGKMSGLFDFVLVTADLRASEESIDGKSSIIGRILERSIDRAAADEEIAKIVEEYEEKFKEQLDAITTQLNEVVASYAPGRAVTVSPADVELKRTTFDVTVLDGTTQTAVERQGHGFQRTLLISALQLLAQSGSASAEGVICLAIEEPELFQHPIQAHAFAKVLRSLAEKRIQVTYATHSPYFL 384
249 1.000e-65gi|229002236|dbj|BAH57702.1| hypothetical protein [Staphylococcus aureus PM1]  clstr ali  22  12MYISSVKIKNFRNFDNIDIDFEGVNVLIGHNNSGKSNLLRALSLIFDGSVR-KQLSVEDFNKESLKKEAPKIVISVHITQSENERLMSDELITVSNWLTKLEEPYEARIQYEFFLPKDEEKNYIDLVKNIDEKEEIWNLIRSQFIRLYVN--KIWVGNPEHQIPIDNDSLNKFDFQFLDAIRDVERDMFSGKNTLLKSVIDFFIDYDIKSDETITEEEQKEKLEERRK-EFSDNSSDLIETIHKRLDSGNQKILSYTNGIGASYDKSTPDFKGNL------TESEIYTVLQLIIKHETGMTLPITHNGLGYNNLIFMALLLSKMQADSSNAKVFPILAIEEPEAHLHPTMQNEFIKFLKNNIREKKQIFITTHSTHI. 391
250 2.000e-65gi|517509867|ref|WP_018680075.1| hypothetical protein [Acinetobacter tjernbergiae]  clstr ali  38  1MKLVSITLENFRGYKETTLLVDSFTGITGKNDAGKSTVLEALDIFFGNS----NIDKEDKNIDSYGSTK----VTCTFDDYPIFLSLDSGSQTNLKSEYLLNNNGLLEICKTFDFGTSKEKISLKCMYPSNEGLNDLIYLKQTELKKRVGLKLEDVSDLRSNTSIRQFLYSSENLNLLEQEIFL--NKEDAKDIWISLAKHLPIYALFKSDRNSNDQDSEVQDPLKLAIKLALS--DIQSQLDEIQEHIRTKVIDVAQRTLEKLEEMDASLAEDLVPDFT---KEPDWKSLFKLSLSSEKGIAINKRGSGVRRLILLNFFRAEAERKINESSGNIIYAIEEPETSQHPSNQEMLIKALIKLSDPKAQVIVTTHVPAL. 371
251 2.000e-65gi|524023150|emb|CCY06326.1| sMC domain protein [Eggerthella sp. CAG:1427]  clstr ali  21  1MYISHIKVKGFRNFKDSDIEFNDLNVLIGHNNAGKTNLLKALQLVIEPHYRYRRLNANDFNRDNLKSQSPSVTISVTFKNSNIEYNEQEEDLRVVANWFTDMENGYAMLTYRFYLPAEKEDDYKAAMADVEDIKNGWSILENDFLRYYVYKLLAGPLDAPIQPEMDK--LERFDFQFLGAMRNVEDDMFYGRSTMLKDVLNFFIDYGIKTDKTKEEKESELKDVRNDFGNEATA---LMTSLLERLSEGKDVMLDYAHETGASFNNALPDFKSTL------TEQDLFSALKLIIKYGEDIEISATHNGLGYNNLIYMSLLLAKMQYMGDNAKVYPILAIEEPEAHLHPAMQYKFLKFLDKNLKVDHQIFITTHSSQI. 383
252 2.000e-65gi|428761242|gb|EKX83477.1| hypothetical protein CSV86_19455 [Pseudomonas putida CSV86]  clstr ali  16  11MRIERVEIQNFRLLQNVSLGLEDTTLIVGRNNCGKTSIAEVFRRLLSDRAPSFRL--EDFSLGSHEEFWTAFNAFHGEIARSDVAAMLPVVRVTLDISYDIDDLGPLSECIVDLDPDCSCARIVLTYGPRATALESLFAEIIA--------PNAEQGDQR--PGFFSLIKKRLAAAYEPRLEAVDNDPTNRKDLDLKALTTLIRGGFINAQRGLDDDTHRERDVLGKVVEVLFQDPEKRTTAEQLHGAVEKIQKELHDGFNAGLTSLLPTFELFGYPGLDDPERLLKDHTQVRYRGVNGLTLPESYNGLGVRNLVYILLQLLKFFREFQATPAVHLIFIEEPEAHLHPQMQEVFIRQLQQLNDSPVQFVISTHSPHM. 410
253 3.000e-65gi|494957396|ref|WP_007683423.1| MULTISPECIES: ATP-dependent endonuclease [Sphingomonadaceae]  clstr ali  16  1MRINRAKIENFRLLRDVEIGFEETTLIVGRNNSGKTSIAELFRRLLSD--RALSFRLEDFSLGCHECFWTSLVSFRAQQDSSETLGQLPAIKLVLDIGYDVDAAD-LGPLSECIIDLNPDCHEARLEFRFAPKANALQAL-------FVDLTEPLEDPEADRARLYRELGNRIASAYAGSLEAVDNDPTNRKTLEPKILSALVGGGFINAQRGLDDDTFRERDVLGKVVEVLFQSALTDETAEQLKEAVDQIQGDLHIGFNAKLTSLLPTFDLFGYPGLVDPDKLLSNHTRLRYRGVNGVTLPETYNGLGARNLVYMLLQLLRFFREFQGTPGVHLIFIEEPEAHLHPQMQEVFIRQLEYIANAPVQFVVTTHSPHM. 400
254 3.000e-65 [eggNOG:NOG70858]  ali  19  1MKIQSVRIKNFRALKDITITFDSVTTFIGPNGAGKSTVLRALDWFFNGKPGA--LTEKDCSFGAG---DEDIEVQITFTELTQNDREALG-------KYAPDGATTFTAWRRQSPDGSDAKGFPDFNAIKAANGANAKKELYNELRARRPELELPAAKTGPAVEEAMTTWEASHTEQLDDVLESLQTNFFGFNSGGKMSGLFDFVLVTADLRASEESMDGKSSIIGRILERSIDRTVADAEIATIEEKFKTQLETITTKLNAVVTSYSPGRAVTVAPAEVELKAPK--TTFEVSVLDGATETAVERQGHGFQRTILISALQLLAQSGSASADGVICLAIEEPELFQHPIQAQAFAKVIRSLVENPIQVTYATHSPYFL 384
255 3.000e-65gi|917273998|ref|WP_051880710.1| hypothetical protein [Buttiauxella agrestis]  clstr ali  42  1MKIAQLKLVNFRGYQNVSVNFDDFNVVIGRNDIGKSTILEAMEIFFNNEI--VKIDINDCNVFCETKI---MSIQLSFIPDKTSYTID-TIPTNFKDEYLLDENGWLTIKKTWDCSKDKLKTALVSFYPDNFP-IPLVNLKITELRKILTDLDVDAVKKNTSSQIRQAIYNSTENIKL-KTTEIDIDKEDGKKIWTVLQSDLPLFFLFQSDRENRDSDKEVQSPLKTITKTAIAELEEELE--QVKEKIITKAIQIGNETLEKLKEMSPEIASVLNPEMTN----KAWDSLFSFSFSCDDGIPVNKRGSGVRRLILLNYFRAEAERKTSGN-RNVIYAIEEPETSQHPEWQLKLFQALMDLKNERTQVIVTTHSPSL. 374
256 4.000e-65gi|954628905|gb|ALP53989.1| ATP-dependent endonuclease [Candidatus Tenderia electrophaga]  clstr ali  17  1MHIQKVTVKNFRLLADVELVLEDQTTLVGRNNSGKTSLSEAIRRFLVDHNP--KFEIEDFSNASYDDFCEALKA----KNRGEQDDIVRALLPSI----------ELRLLFRYDPDQLDLGPLSDFIIDLNPDCNEALVVARYELRDLFADQRDGDLTDKERLAFFQVLRDRVPALFIARVWAEDPDPINQKQMTVSALRVLLKTGFVNAQRGLDDDSSRDTDVLAKILEGLFANEGEQRIAEALQEAVRDIQQSIDRGFKEELRKLMPTLRTFGYPGLDDVERLLSRHTKVRYAGHHGILLPESYTGLGVRNLIFILLQIVSFYRTETSAPGVHLVFIEEPEAHLHPQMQEVFIRQVSKIAQQPVQFIVSTHSSH.. 398
257 4.000e-65gi|501244806|ref|WP_012287824.1| ATP-dependent endonuclease [Caulobacter sp. K31]  clstr ali  17  1MRIKHVEIENFRLLRKVAIGLEETTLIVGRNNSGKTSIAELFRRLLSE--RTLAFKLEDFSLGCHECFWTAFEAFRAGADSSDVRSHLPSITIALDIAYDVDDLGPLSDCIIDLNPDCTEARLVLTFGPRTTAAETLFAGIVAPGEDVAAD----------RIALFRALGSRLPAAYASSLEAVDNDPTNRKTLEPKTLTALIHGGFINAQRGLDDDTHRERDVLGKVVEVLFQDPEKRTTAEQLKAAVEQIQGDLHVGFNAKLTSLLPTFDLFGYPETSFDVDKLLNDHTKVRYVGNGVTLPETYNGLGVRNLVYMLLQLLRFFREYQASPGVHLVFIEEPEAHLHPQMQEVFIRQLDQILNENVQFVVTTHSPHM. 400
258 7.000e-65gi|737216937|ref|WP_035201642.1| ATP-dependent endonuclease [Agrobacterium tumefaciens]  clstr ali  17  1MRIKRVEIENFRLLRSVTVGFEGTTLIVGRNNSGKTSIAELFRRMLSEK--AIGFRLEDFSLGSHQGFWRSGEAFSDNEPGEECLAHLPMIKVALDISYDVASPDLIGDCIIDLNPECTHARLVLMYAPRPTAIAALF----ADLITPGGIGDIE------RAVFFREIANRLPFAYAATLEAVDNDSENRKSLDLKLLSTIVRGGFINAQRGLDDDTFREKDVLGKVVEVLFQDAGKRSTAEQLKIAVEQIQGDLHTGFNANLTSLLPTFDLFGYPGLADPEKLLSNHTKVRYTGVNGTTLPETYNGLGVRNLVYMLLQLLRFFREYQTAAGVHLVFIEEPEAHLHPQMQEVFIRQLDHIAQTPVQFVVTTHSPHM. 400
259 7.000e-65gi|501173691|ref|WP_012217425.1| ATP-dependent endonuclease [Burkholderia multivorans]  clstr ali  21  1MKIQSVRIKNFRTLKDVAIPFDSVTTLIGPNGTGKSTVLRALDWFFNG--RPGLLTERDCSFGAS---DEDIEVQVTFDDLTEKDRAELG-------KYAPEGTTTFTAWKRRSKDGANSKSYPPFNDIRSKGSAGDKKVEYNRLRESDPSLGLPPWSSVDAANQAMTTWEANHTDQLIDAPESLQTNFFGFNSGGKMSGLFDFVLVTADLRASEESLDGKSSIIGRILERSVDRAAADEEIAKIVEESRAKQQSVYEKFKAQLEEMTAQLNDVVSVSPAEVELKAPRTTFEVAVLDGTTETAVERQGHGFQRTLLISALQLLAQSGAASAEGVICLAIEEPELFQHPIQAQTFAKVLRSLAEKRIQVTYATHSPYFL 384
260 8.000e-65gi|510922981|ref|WP_016243774.1| MULTISPECIES: ATP-dependent endonuclease [Enterobacteriaceae]  clstr ali  21  1MKIQSVRIKNFRALKDVTIPFDSVTTFIGPNGAGKSTVLHALDWFFNGKPGS--LTEKDCSFG---EASEDIEVQVTFADLTEKDREALG-------KYTPEGAATFTAWKRRSADGTDAKGFPEFNVIKTANGVAAKRELYTNLRTSRPELELPTATTGTAIDQAMTTWEASHTELLVDAPESLQTNFFGFNSGGKMSGLFDFVLVTADLRASEESIDGKSSIIGRILERSVDRAAADQEIAAIVEESRAKQQKVYEKFQAQLKVMTTQLNEVVTVSPAEVELKAPKTTFEVSVLDGTTETAVERQGHGFQRTILISALQLLAQSGAASADGVICLAIEEPELFQHPIQAQAFAKVLRSLVEDPIQVTYATHSPYFL 384
261 8.000e-65gi|916332793|ref|WP_051067839.1| chromosome segregation protein SMC [Acinetobacter junii]  clstr ali  21  1MFISKIEIKNFRNFKHQEISFEGVNVIIGHNNAGKTNLLTALSLVVNPDKNKR-LDVDDFNKNELKTSPPKISIQVTLKKGCDSLPDDLAMVAN--WLTKLESDFEAKLTYEFFLPEKEVPKYTLAMSEIDENCRNTAWKTIKNEFIRLYSYKIYGGEIANRAIADGESLSKFDFQFLDAIRDVERDMLTGKNTLLKNVFDFFMDYDIKSDSIKSEE-NKITEIKTRKNKFLSDIEPVINSIQKRMELGKEQILSYADGTGASFNKAKPNFEGNI------SDIEMFSFLRLIIEYETGIKIPATHNGLGYNNLIFMSLLLAKMQVNSDNAKVFSVLVIEEPEAHLHPAMQYKFLQFLKKNKKEGRQIFVTSHSTHI. 383
262 9.000e-65gi|452994683|emb|CCQ93710.1| RecF/RecN/SMC N domain protein [[Clostridium] ultunense Esp]  clstr ali  21  37MYISELILENYRGFKRKSIFFEGTNILIGHNNSGKTSILKALELLFSDGKS-KSLSIDDFNKNISIEELKEIRIAAKLTESKNEEEYSDDLITVSTWLTKLDKPYEALITYEFFLPEKEEKEYKNIINNINSDDVHDYWREIEYNFIRKYIYKIYVGNPDHKNVVEPETINKFDFQFLTAIRDVERDLFTGRNSLLKEVIDFFIDYEIKTDRDM-ENDEKTKKIEERKKKFSEDAGKLISSLQSRMELGKKYMLKYAEETGAAFDNLKPSFEGRI------LDTELYSALKLIVEDETGFKLPVSQNGLGYNNLIYISLLLAKMQKDASNAKIFSILAIEEPEAHLHPNMQYKFLKFLKQNQENQVQIFITSHSPNI. 418
263 1.000e-64JGI.Meta 7078864104 SRS014235_WUGC_scaffold_56102__gene_99437 recF/recN/SMC N domain protein [Human Stool microbiome from visit number 1 of  ali  20  1MYISHIKIKGFRNFKDSDIEFNDLNVLIGHNNAGKTNLLKALQLVIEPHYRYRRLNANDFNRDNLKSQSPSVTISVTFKNSNIEYNEQEEDLRVVANWFTDIESGYAMLTYRFYLPAEKEDDYKAAMADVEDIKNGWSILENDFLRYYVYKLLAGPLDAPIQPEMDK--LERFDFQFLGAMRNVEDDMFYGRSTMLKDVLNFFIDYGIKTNKTKEEKESELKDVRNDFGNEATA---LMTSLLERLSEGKDVMLDYAHETGASFNNALPDFKSTL------IEQDLFSALKLIIKYGEDIEISATHNGLGYNNLIYMSLLLAKMQYMGDNAKVYPILAIEEPEAHLHPAMQYKFLKFLDKNLKVDHQIFITTHSSQI. 383
264 2.000e-64gi|515171990|ref|WP_016800248.1| hypothetical protein [Vibrio cyclitrophicus]  clstr ali  43  45.......IKNFRCYEEITIGFDDLTALIARNDTGKSTILEALDAFFN----LDKLENGDRSTGVSNSIS--VEITCVFKDVPRELIIDTDNRISPAHEYLLNQDGDLEICKIYKGAALKEEVTLSALHPTAENYEDLLNLTITQLRRRGNDLDLSPVNQTVKSAIRHAIWTHVSDSQLNK---QLVSLDIKSSVWKQLQNILPLYQLFKADRPSSDQDAEAQDPIKFAIKEALKDRAAE--LELLESYVREQVENVTSKTIEKLREMDPDLANQLDPKFSSFNWSKV----FSVSLTNEDQIPLNKRGSGVRRLFLINFFRAKAEQLASRDVQDVIFAIEEPENSQHPNNQLLLLDALTELSDPQHQVLFTTHNPVL. 405
265 2.000e-64gi|982166211|ref|WP_060330304.1| ATP-dependent endonuclease [Burkholderia territorii]  clstr ali  21  1MKIKSARIKNFRALKDVTIPFDSVTTFIGPNGAGKSTVLRALDWYFNGKPGS--LTEKDCSFGAA---DEEIEVQVTFADLTEKDRNELG-------KYAPAGVTTFTAWKRRGPDGTNSKSYAPFNAIRSRGTAAEKKAAYNDLRNSDASLGLPAWSNADAANQAMTTWEADHTDRLVEAPEPLQTNFFGFNSGGKMSGLFDFVLVTADLRASEESIDGKSSIIGRILERSVDRTAADEEIAKIVEESRAKQQNVYEKFKAQLDAMTTQLNEVVTVSPVEVEIKAPRTTFALAVLDGTTETAVERQGHGFQRTLLISALQLLAQSGAASTEGVICLAIEEPELYQHPIQAQTFGKVLRALAEDSSQVTYATHSPYFL 384
266 2.000e-64gi|961366903|ref|WP_058368463.1| hypothetical protein [Psychrobacter sp. ENNN9_III]  clstr ali  39  1MKIVKLQIENFRGFENVEVMLDKFNVIVGRNDVGKSTVLEALEIFFNNS--TVKIDTEDLCKFSDKDY---IEIGVSFKLQSFELRID-TIPTFLDKEYLLDEYGFLNVVKRWDCSKKSITIFIRANYPKGFN-EPLITLKNSDLKAIFGDDLPDNIKQNTNSTMRLALYESYNNSIDLKTTLIELNKEDAKKVWINLQKDIPLFFLFQSDRANKDSDKEVQDPLKAITKLAIS--EVQDDLERVINRIENLVTQVAQDTVNKMQEMDPSLAESLKPNLSQ----KNWDSLFSFTFIGDDEVPINKRGSGFRRLLLLNYFRAEAER-ANESRKPIIYAIEEPETALHPNWQLMLIQSLLDLSENNSQILITTHSPAL. 376
267 2.000e-64gi|446198079|ref|WP_000275934.1| ATP-dependent endonuclease [Bacillus sp. 7_6_55CFAA_CT2]  clstr ali  21  1MYISELTISNFRSFKKTTLNFNDINVIIGQNNAGKTTVIKALDILFNNSSSKR-LNINDFNRSASIEELKKIYISAKLQESENEGEYSDELVTVATWLTTLNKPYEATITYEYFLPEKEVAEYTNLMKKISIEDINHYWKAIEHNFLKKYVHRVYVGNPEFKNSVQNDEINRFDFQFLTAIRDVERDLFKGNNSLLREVIDFFMDYDIKSNSELXXXXXXXXXXXXXRDFSVES-KKIIESLQQRMRNGEEQILKYVNNTGAGIDESKPSFDGEI------LDTELYSALRLIVEKESGIKLPAISNGLGYNNLIYISLLLSKMQKDASNAKVFSILAIEEPEAHLHPSMQYKFLQFLKENKDSDNQIFITSHSPNI. 382
268 2.000e-64gi|410600657|gb|EKQ55184.1| putative ATP-dependent endonuclease of the OLD family [Clostridium sp. Maddingley MBC34-26]  clstr ali  20  1MYISELKLTNFRGFKDTKILFEGTNVIIGHNNSGKTTVIKALELLF-DSEKNKRLCIDDFSKNISIEELKKITITAKLVESQNEEDYSDDLVTVSTWLTKIEKPYEALITYEFFLPEKEIDDYKNIIENIKSDDVNDYWYEIDYNCLRKYTYKIYVGNPEHKNVIDGETLKKFDFQFLTAIRDVERDMFTGKNSLLKEVIDFFIDYEVKIDEKLKDNEKR-DVIIERKKEFSKNAKILINSLENRMSAGKKHMLKYAEETGASFEKLTPSFEGRI------LDTELYSALKLIVENETGIKLPANQNGLGYNNLIYISLLLARMQKNASNAKVFSMLAIEEPEAHLHPNMQYKFLKFLNENKEEVRQIFITSHSPNI. 382
269 3.000e-64gi|519026759|ref|WP_020182634.1| hypothetical protein [Methylotenera sp. 1P/1]  clstr ali  43  1MKISKLQLENFRGYDLLEVNFDNFNVIIGRNDIGKSTILEALDIFFEGG--TIKADIDDCNVHATERV---MSISVSFLPEDKDYTID-TVPTNLKSEFLLDKNGFLTLKKHWDCSKDKLKTYLVSNYPSIITEP-LINEKITDLRKILDSYKDVLNVDEVKRNTSSAIRQAIIDTSQLSEIEVAIDKEDGKKIWDALKNDLPLFFLFQSDRQNKDSDKEVQDPLKAITKTAISQ--LEDRLEAVKIEIIKKAEEIGKETIAKLSEMNPEIASILAPQMSS----KAWDSLFSFSFNCDDGIPINKRGSGVRRLILLNYFRAEAERKNT-ASKNIIYAIEEPETSQHPDWQIELFNALIKLTDNPTQVITTTHSPSL. 373
270 3.000e-64gi|754695744|ref|WP_042072920.1| chromosome segregation protein SMC [Acinetobacter gerneri]  clstr ali  20  1MFISAIKIENFRNFKHQEINFEGVNVIIGHNNAGKTNLLTALSLVVNPDKNKR-LDVDDFNKNELKTSPPKISIQVTLKKGCDSLPDDLAMVAN--WLTKLESDFEAKLTYEFFLPEKEVPKYISAMSEIDENCRNTAWKTIKNEFIRLYSYKIYGGEIANRAIADGESLSKFDFQFLDAIRDVERDMLTGKNTLLKNVFDFFMDYDIKSDSIKSEE-NKITEIKTRKNNFLSDIEPVINSIQKRMELGKEQILSYADGTGASFNKAKPNFEGNI------SDIEMFSFLRLIIEYETGIKIPATHNGLGYNNLIFISLLLAKMQVNSDNAKVFSALVIEEPEAHLHPAMQYKFLQFLKKNKKEGRQIFVTSHSTHI. 383
271 3.000e-64gi|504886924|ref|WP_015074026.1| ATP-dependent endonuclease [Gluconobacter oxydans]  clstr ali  20  1MKINIVRIKNFRALKDVTIPFDSVTTFIGPNGAGKSTVLRALDWFFNGKPGT--LTEKDCSFGAT---DEDVEVQVTFTDLSEKDREALG-------KYAPEGVSTFTAWRRRSPDGSDAKGFPRFNAIKAASAAGTKKSLYAELQRVQPELNLPAVKTGPAVEEAMTAWEASHTDQLAEVPESLQTNFFGFNSGGKMSGLFDFVLVTADLRASEESVDGKSSVIGRILERSVDRAVADEEIAKIVEESRAQQQKVYEKFQAQLETMTTQLNAVVSVSPAEVELKAPKTTFEVAVLDGATETAVERQGHGFQRTILISALQLLAQSGAASADGVICLAIEEPELFQHPIQAQAFAKVLRSLVEDPIQVTYATHSPHFL 384
272 3.000e-64gi|917081286|ref|WP_051687998.1| hypothetical protein [Curtobacterium sp. S6]  clstr ali  19  1MHISRVSLTNYRNFARTNVALTGVNTIIGENGSGKSNLFRAIRLLLDDTFATRRLRDTDFHRGLSDWRGHWIVIKIEFGDVSDDEAVQSLLLQHTADDSKRNELSTLTTGDHKGLLALQEAITLDDYERVLLGKMSVDLTNPDEYARIVGDFDNVIFPSTKNNSLDMSLWREFSLSYVPALRNVVADFNDPRK------NPLRTLLSIRSEEIPEGDFDDILEMVRELNESIEGRDDVQDVTRGIKKTFKDAVGETYSPTSMKIQSELP-----------LKSSDLFQSLKLYVSEHGDSALRLHEMSLGGANLVYLTLKLLEFEYQSKRQAIANFLLIEEPEAHIHTHVQKTLFN---RVTFENTQIIYSTHSTHI. 392
273 3.000e-64gi|970374605|ref|WP_058699393.1| ATP-dependent endonuclease [Myroides odoratimimus]  clstr ali  21  1MYISKIQINNFRNFKNKEIDFNDVNVIIGHNNAGKTNLIKALSLIIDSTNSKR-LEVDDFHKNELKSAPPKISISITIKKGKEEEPDD--LVTISNWLTKLDSDYEAVLTYEFFLPEKKIEEYNNEMSLIEDEDDKAIHKAWKILKIRYYVYRIWGGDIVNQATADSESLQKIDFQFLNAIRDVERDMLTGRNTLLKEVFDFFMDYDIKID-TTKDNEQKYQEIKAKKILFSEKADLLVKDLTSRIEQGKKEILSYAKKTGASFNKANPNFEGSI------SESEMYSVLKLIVEYEAGITIPATHNGLGYNNLIFMSLLLAKMQVNADNAKVFTTLAIEEPEAHLHPAMQYKFLKFLNENKKKVRQIFVTTHSTHI. 383
274 4.000e-64gi|652258550|ref|WP_026706564.1| hypothetical protein [Flavobacterium soli]  clstr ali  37  1MKLVSIKLRNFRIYQDLTINLGDLNCIIGKNDIGKSTILEAINIFFNDG-----IEKTDLSVNSNDDL---IEITCLFDDFREKLVLDSTVETSLKEESLLNQNGLLEIKKTFKIGGAITKTYIIAEHEIHEKLLYILTLKNSPLKALAAELEIDGINKTKNPPIRKAIKENLQSQKQLIELKVDGSLDTENNLWSKLKDYLPIFTLFKVDKTINDKDKDVQDPMNQAIKETLAIPEIKELLDKIEVEIKAKSTIVAEQTLEKLKEIDASLAEKMKSDFS---KLPSWDKIFDLTLLNENNVPLNKRGSGVKRLVLLSFFQAQAEKKKETSAPSIIYAIEEPETAQHPNHQKILINSLIKLSESNIQVFFTTHSANLV 376
275 5.000e-64gi|491189442|ref|WP_005047799.1| hypothetical protein [Acinetobacter calcoaceticus]  clstr ali  40  1MELISIVLENFRGYHKHTILIDELTGIIGKNDAGKSTIFEALDIFFENSS----FEKNDRCIFATEEQNT--SITCVFKDFPESLSLDATSQTTLESEYLLNNNSFLEIKKTFRVNQKITTEVIIANYPSNPDLNSLITLKNAELKSLIKTKGLDIDDQRSNTCLRKFLFS--SEALTFQTKEISLNKEDAKNLWENIKSFLPIFALFKSDRNSSDQDSEVQDPMKLAIKAALS--EIQPKLTEIQEYIRTNVEDVAKRTLNKLGEMDSNLAKDLIPNFS---KDPKWDSIFSMTLTSELGIPVNKRGSGVRRLILLNFFRAEAEKKFKEANRSIIYAIEEPETSQHPNYQEMLIKALLELSSPKTQILVTTHTPAL. 372
276 5.000e-64gi|696501073|ref|WP_033039086.1| hypothetical protein [Pseudoalteromonas sp. S3431]  clstr ali  39  1MKLEKIKIKNFRCYEEITIPVTELTALIAKNDVGKSSVLEAVDAFFNSD----RLESGDRSSGLRN--SDNVEITCVFGDIPESLIIDTDNLISPLNEHLLNSESKLEIRRVYSGAALKEEIYLNAVHPTAENFNDLFSLSVTQLRSRARQLEIELDNQTIKSALRHAIWSSVPVNALSKEV---VELEIKAKIWKPLQNILPLFQLFKSDRPSSDQDAEAQDPIKFAIKEALKEKSVD--LDAIGEFVQRQVEEVTNLTIDKIREMDPELASQLNPNFSNFNWSKV----FSVSLTNEDQIPLNKRGSGVRRLFLINFFRAKAEQLASEDVQDVIFAIEEPETSQHPNNQLLLLDALKELSEDNHQVIFTTHNPIL. 368
277 5.000e-64gi|1011754429|ref|WP_062577889.1| ATP-dependent endonuclease [Rhizobium sp. Leaf391]  clstr ali  16  1MRIKSVEIENFRLLRQVAVGLEETTLVVGRNNSGKTSIAELFRRLLSEKSLSFRL--EDFSLGCHEGFWAAFEAFQAGQPVPDVVAMLPAIKVAIEITYDVDSPDLLSDCIVDLDPDCTDARLILTYGP-----------RPTAPELLFSGVAVGDDVAVNRLNLFRTVGAGLSGAYGASLEAVDNDPTNRKLLEPKMITALIRGGFINAQRGLDDDTHRERDVLGKVVEVLFQDPEKRTTAEQLKAAVEQIQGDLHAGFNAKLTSLLPTFDLFGYPGLSDPVDKLLNDHTKVRYVGNGMTLPETYNGLGVRNLVYMLLQLLRFFREYQTSAGVHLIFIEEPEAHLHPQMQEVFIRQLDQIINENVQFIVSTHSPHM. 399
278 9.000e-64gi|89336831|dbj|BAE86426.1| hypothetical protein [Desulfitobacterium hafniense Y51]  clstr ali  21  39MYISRLKIQNYRCFQDVEIEFEGLNVIIGENNCGKTTILKALQCFFKGSNTGSAMGIDDFNKGIIGEKPPEITFVLTIQSSKHEKAQDKAVVAS--WLTKLVSPWEATLTYKFFLPEADQKRYIRCIQDDDDRNSKKWAVLERHLKK--YTPRIYGGNYESKNRADQEYLDKFHCEVLDALRDVESKMFTGRNALLKQVLNFFV------DSDLIEKEETERETLQVQRNQTFESTSSSLVANMIERVSVSKIFELTEKTGAAVGGQ-PTLGGQLD------ESDVLSVLKLMIKKETGIEVPIVNNGMGYNNLIYISLLLSKFKEMGENAKVFPMLLIEEPEAHLHPALQYSFLRFLKDEMDKSRQIFITTHSTHI. 411
279 1.000e-63gi|1010969821|ref|WP_061928801.1| ATP-dependent endonuclease [Gluconobacter japonicus]  clstr ali  18  1MHISKLQIVNYRNFKRANVVFNKVNTIIGENGSGKTNLFRAIRLLLDDNLLAYKLDDQDFHRGLDDWRGHWIIISLEFDEVSKDEAIQALFLHSIEADTVERATYNLIFRDKEGLALIRKDITIADYESVFSGRSPADLCDPSIYRKIVGDFDVEFPDELKPPEIGIEIRSMLSLAKEVSFTFVQALRDVVSDFQNQRTNPLLTLLKRKSGEIDPATSGPISKMVSELNDTIGDLDEVKTIRSEISETILHAAGETYSPRSLAIKSELPEEAEHLFQSLK----------LFVGEAEEGYQGAIHELSLGGANLIYLSLKLLEFKYRKQNESFASFLVIEEPEAHIHTHIQKTLFDRLN-FAE--TQIIYSTHSTQI. 386
280 1.000e-63gi|515578733|ref|WP_017011481.1| hypothetical protein [Enterovibrio calviensis]  clstr ali  15  1MHISRLNLVNYRNFKNVKLEFNKINTIIGENASGKTNLFRAMRLLLDNSMPRSKLSESDFCRSLGSWKGHWIIISCEFDDISSDENIEGDEEIVTKATYNLIFRPKAHIRDTTALEEYLIDISIDDYETVLTGKSTANFSDPEVYKAIVGDFHAVVFPKELNSEIGIRLPYILNMPNEVSFTFIKALRDVVSDFHNNRTNPLLTLLKNKSGEISQEDFQPIAELIGTLNENIEGLNDVCDVRDDIASTVGDTVGDTYSPSSISIRSSLTDDSDQLFQSLK----------LFVAESNDGHEGAIHEMSLGGANILYLTLKILEFKYQKSNQSIANFLLIEEPEAHIHTHIQKSLFDNIK---YDNTQIIYSTHSSHI. 388
281 1.000e-63gi|501970824|ref|WP_012680400.1| ATP-dependent endonuclease [Bacillus cereus]  clstr ali  20  1MYISRLTLKNFRTFKNTTVQFEGTNVIVGHNNAGKTTIIKALELLFDANKSKR-LSIDDFNKNQLKESAPKITISATLVESEKEEIYSDDLVTVSTWLTKLEKPYEAKLTYEFFLPEKELEDYYNDIRKIEGTNINDYWNEIKNNYLRKYVHKIYVGNIENKNLIDTDSINKFAFQFLTAIRDVERDLFTGSNTLLKEVIDFFIDYEIKTDISITDXXXXXXXXXXXXLFS-KGAQSLIQSLQDRMREGKKHMLQYVENTGAAFDKMQPSFEGGI------LDTELYSALKLIVENETGIKLPAVNNGLGYNNLIYISLLLAKMQKDASNAKVYSILAIEEPEAHLHPNMQYKFLKFLKQNREEVRQIFITSHSPSI. 382
282 1.000e-63gi|950591608|ref|WP_057453626.1| ATP-dependent endonuclease [Pseudomonas syringae]  clstr ali  17  1MYLSKTTLVNYRNFERARFVFKGVNTIIGENGSGKSNLFRAIRLLLDANISAYAMEETDFFRRKECWKGHWIIISLEFDEIDQNEAIQSLFLHRGKATYNLIFRPNQSIRMRDSLRELQAQISITDYESYFTGRSIADFADVAVYRNIVGDFKKVTFPAVSSHLIGSPIPNQLSVAKEVSFTFVKALRDVVSDFSGNRQNPLLNLLKRKSEEINIEKYKLITDKVKALNSDIEILPDVQDVRFDIIDTIAETAGEAYAPAALHIKSDLPTEAEKLFQSLK----------LFVGENDESYSGDISELSLGGANLIYLTLKLLEFKYQRKKEAVANFLIIEEPEAHIHTHIQKTLFGNIQ---YENTQIIYSTHSTHI. 385
283 1.000e-63gi|502796291|ref|WP_013031267.1| ATP-dependent endonuclease of the OLD family-like protein [Nitrosococcus halophilus]  clstr ali  37  15....................................................................GDSVSITCEFAELPHSLILDAGAETTLADEYLLTEAGTLKIRKIYDCSKPKPEVFVVAQHPTAKDVDSLLELKEKDPQKIVKELGLEVPLKG-NPGMRKAIWNELDLKLAETQIPITKLKGDSKCIWEQLESYLPLFALFQSDRRSQDSDGEVQNPMKAA--VAAAIAEVKSEIEQIQLKIEEKAKTIAESTHEALKTIDSSLAKELKPQFTQPTPAKWVGLF-SVNMTTDHGIPLNKRGSGIRRLVLVSFFKAEAERQIATNRRNIIYAIEEPETAQHPNNQRVLIKAFKELSEPGCQVLLTTHSP... 322
284 2.000e-63gi|503107516|ref|WP_013342271.1| ATP-dependent endonuclease [Burkholderia sp. CCGE1003]  clstr ali  20  1MKIQSVRIRNFRALRDVTIPFDSVTTFIGPNGAGKSTVLRALDWYFNGKPSS--LTEKDCCFG---ETGEEVEVQVTFSDLTDKDRDALG-------KYAPAGAQTFTAWKRWATNGSNAKGFPEFNAIKSASGAVAKRELYGNLRSNRPDLNLPAANTGTAVDQAMTTWESSHTDLLVDAPEALQTNFFGFNSGGKMSGLFDFVLVTADLRASEESVDGRSSIIGRILERSVDRTAADEEIEKIVEESRAKQQSVYK---EKFKAQLDSLTAQLNQVVTSVELKAPRTVFEVAVLDGKTETAVERQGHGFQRTLLISALQLLAQSGAASAQGVICLAIEEPELYQHPTQAQTFAKVLRSLAEKRVQVTYATHSPYFL 384
285 2.000e-63gi|918751628|ref|WP_052604679.1| ATP-dependent endonuclease [Acidithrix ferrooxidans]  clstr ali  20  1MKIRYVRIKNFRTLKDVSIEFDVVTTFIGPNGTGKSTVLRALNWFFNGSKNG-DLTEEDCSFGA---VDEDIEVQVTFGNLSDADRAELG-------KYAPDGVDTFTAWKRRTPEGDEYKGYTVFNEIKAAATVTAKKEHYAALRTAQPGLELPSASTGPTIDSALTTWEASNTDRLEDVPESLQTNFFGFNSGGKMSGLFDFVLVTADMRASEESQDVKASIIGKILERSIDRAAADEEIGKIVKESQLAQQKVYDEMTASLNDVVSSYAPGRSVSITPSNVELKRTTFDVFVLDGVTSTAVERQGHGFQRTLLISALQLLAQSGAASSDGVICLAIEEPELFQHPIQAQAFAKVLRSLAEDDTQVCYATHSPYFV 385
286 2.000e-63gi|951138972|ref|WP_057620711.1| ATP-dependent endonuclease [Yersinia enterocolitica]  clstr ali  16  1MLVKNVEIQNFRLLRDVSLRLENITLVVGRNNSGKTSIAELFRRLLSDKGPSFRL--EDFSLGCHEGFWAAFEALQAGKLSEDIYHHLPSIIIKLDVEYDVDSPDLGPISDCI-IDLNPDCNFVRMVLTFGPSSVATESL-------FADVTVPPEGMNIERTALFRAVEMRLTQSYECKLEAVDNDPTNRKNLDLKTIKILINGGFINAQRGLDDDTHRERDVLGKIIEVLFQDSNKRTIAAQLKMAVEQIQTELHVGFNEKLTSLLPTFDLFGYPETSFDVDKLLNNHTKVRYVGNGITLPETYNGLGMRNLVYILLQLLRFFREYQTAAGVHLIFIEEPEAHMHPQMQEVFIRQLSKITKSPVQFVISTHSPHM. 400
287 2.000e-63gi|797183751|ref|WP_045850658.1| chromosome segregation protein SMC [Domibacillus enclensis]  clstr ali  23  1MYISNININNYKNFRNNSIDFNNINVIIGHNNAGKSNLLRALALIFN-SNSKKHLSIDDFNKNIPIEELKEIKITATLKQDGCEKLMSDDLVTVSNWLSKLEEPYEAKLQYTFYLPTKFHELYKSAIDKAKDIFEVWQTIQDEFLR--LYSYKIWGGDPTNQITADSESLNKFDFQFLDAIRDVERDMFSGKNTLLKNVLDFFMDYNIKSDGSLAKEEKEAT--IKEKKKEFGDLANLIALLNQRMTEGKKHILSYANDIGASFDKSTPNFDGSI------TDIELYSALKLIVEYETGIKMPIINNGLGYNNLIFMSLLLSKMEYLGSNAKVYPMLIIEEPEAHLHPTMQRQLLNFLKRNLSDKRQIFVTTHSTHI. 380
288 2.000e-63gi|652411602|ref|WP_026807265.1| chromosome segregation protein SMC [Arcobacter lanthieri]  clstr ali  20  1MYISKVKITNFRNFKSEEILFNDINVIIGQNNAGKSNLIKALSLVL-DGERIKRLDIDDFNKSLTFNKDNPPKITISVSISKGKDETPDDLPTISNWLTKLDASYESMLTYEFFLPEKKHEEYISTITPEGDDRTEKTWKIVKNDFLRFYTYKIWGGDLINQAQADSESLKKIDFQFLDAIRDVERDMLTGRNTLLREVFDFFMDYEIKIDETKSPETK-FSEIKDRQMEFSEKADILIQELTARIASGKEEILSYAKNTGASFNKANPNFEGTF------SETEMYSVLKLIVEYESGIKIPATHNGLGYNNLIFMSLLLAKMQVNADNAKVFTTLVIEEPEAHLHPAMQYKFLKFLNENRKEKRQVFVSTHSTHI. 382
289 2.000e-63 GL0097775 [Complete] locus=scaffold8340_3:2530:4392:-  ali  40  1MILKRLKLKNFRGYTDIVVDFDNMNVIIGKNDVGKSTILEALEIFFNSEK--IKIDISDLSVFNSEPI---IEITCCFDVGDGRILVDATNYSTCKDEFLLNNEGLLEVKHTWDCSKGKIKTYIVAMYPTKYNIQEKISNLQKRYDLYKDDPIYVPETRTKSAELRKAIYKELNDPIELSLTDIDISKEDGKKIVESISKQLPMFCLFESDRKNTDKDAEIQDPLKAVTKSVIS--DMEDQITQMQEEVKQKVEEIGRKTIKKLSELDSSIAQNIQPKVTL----KPIDSSFSFDLVSDNDIPLNKRGSGVRRLILLSYFRADAEEKRENDNRQMIYAIEEPETSQHPDYQRMILSTLLELSEKDTQIIVTSHTPEI. 378
290 2.000e-63gi|489508233|ref|WP_003413100.1| ATP-dependent endonuclease [Pseudomonas syringae]  clstr ali  16  1MQIERVEIRNFRLLQDVSLGLEGTTLIVGRNNCGKTSIAEVFRRLLSDRAPSFKL--EDFSLGCHELFWTAFDALHNGVPRADVAEMLPAVQVTLDISYDIKDLGSLSECIVDLNPNCSCARIVLTYGP-----------KPTALDSLFEAIPLPGDEQFDRSAFFNLIKVRLASSYEARLEAVDNDPINRKSLELRYLNALIRGGFINAQRGLDDDTHRERDVLGKVVEVLFQDPQKRTTAEQLHGAVEKIQKDLHDGFNAGLTSLLPTFELFGYPGLDDPERLLKDHTQVRYRGVNGLTLPESYNGLGVRNLVYILLQLLKFFREFQATPAVHLIFIEEPEAHLHPQMQEVFIRQLHLIKGEPVQFVISTHSPHM. 399
291 2.000e-63gi|504873661|ref|WP_015060763.1| SMC domain protein [Psychrobacter sp. DAB_AL62B]  clstr ali  37  1MKIVKLYIDNFRGFVSTEINLDKFNVIVGKNDVGKSTILEAFEIFFNNS--TVKIDLDDLCKFSDEDY---VEIGVSFKLDNFDLRID-TIPTSLVKEYLLDDNGFLTIIKRWDCSKKSEKIFIKANYPKAIG-EPLICLKNAELKELFSDNIPTDVNKRINSTMRLAIYDFYGKDTEIDLMLIEVNKEDAKKVWDNLEKDIPLFFLFQSDRANKDSDKEVQDPLKAITKLAIS--EVQQDLERVINRIEELVTEITQDTIDKMQEMDSDLAKSLKPSLSQ----KNWDSLFSFSFIGDNEVPINKRGSGFRRLLLLNYFRAEAER-ANESRRPVIYAIEEPETALHPNWQAMLISSLLELSDNNTQVIITTHSPAL. 375
292 3.000e-63gi|517249927|ref|WP_018438745.1| ATP-dependent endonuclease [Burkholderia sp. JPY347]  clstr ali  20  1MNIQSVRIKNFRTLKDVTIPFDTVTTFIGPNGAGKSTVLRALDWYFNGKAGS--LTEKDCSFGAT---GEDIEVQVTFADLTEKDRDALG-------KYAPDGVATFTAWKRRSPDGSDAKGFPDFNAIKAASGATAKKDLYADLRRSRSDLNLPAANTGAAVEQAMTTWEASHTDQLVDAPEALQTNFFGFNSGGKMSGLFDFVLVTADLRASEESLDGKSSIIGRILERSVDRAAADDEIAKIVEESRAKQQHVYEEITTQLNTVVTSYSPGRAVTVSPAEVELKRTTFEVTVLDGTTETAVERQGHGFQRTLLISALQLLAQSGAASTEGVICLAIEEPELFQHPIQAQTFAKVLRSLAEKRIQVTYATHSPYFL 384
293 3.000e-63gi|730386499|ref|WP_034003574.1| ATP-dependent endonuclease [Pseudomonas aeruginosa]  clstr ali  19  1MYIQQAEIKNFRLLSDVELALEQTTVIVGRNNSGKTSLSEVIRRLLADGSVAFQL--EDFSSVCYDDFCKAL---VAFNEGQDEAEL-----------RKLIPAIELRLSIQYDPAQPQLGPLSPFIIDLNPACTEARVVIRYELKDLLDGLPKEPLTPETRVTFFRTLRERIPAEFATKIWAEDNDVENRRQLQPGVLRSLIKTGFINAQRGLDDVTSRESDVLAKIVESLFADSADKQIAAALEGAVHDIQNQIDENFGGQLKSLIPALKTFGYPTETLLDVRKLLSNFTKVRYTGGITLPESYNGLGARNLIFILLQLAKAYRAETTQPGIHLIFIEEPEAHLHPQMQEVFIKKLSEIAQKPVQFVVSTHSSHI. 399
294 4.000e-63gi|656029976|ref|WP_029069166.1| hypothetical protein [Jonesia quinghaiensis]  clstr ali  15  1MHISRITLVNYRNFSSADVRLQGVNTIVGENGSGKTNLFRAVRLLLDENLVGRNLNEIDFHRGLGDWRGHWIAVNIEFSDISKDESMQALFMHRTADDDSPVERATYGFLFRPTLQAIRQTISLDDYETVIMGRGTADLTDLDTYRRIVGDFDSVIFSRDENPELGVSVPRYFSLAKEFSFSYIAALRDVVRDFQINRNNPLRVLLNAKSEEIPPGDFDSIVAQVEVLNSAIESRNDVTEIRDEIRSTFKQTVGETYSPTSLSIKSELPLEATRLFQSLKLY----------VGEHGETYEGGLNELSLGGANLVFLTLKLLEFQYRSARKAIANFLIIEEPEAHIHTHVQKTLFERVE---YRNTQIIYSTHSTHI. 390
295 4.000e-63JGI.Meta 7049124007 C5191500__gene_360004 SMC domain protein [Human Stool microbiome from visit number 1 of subject 158499257]  ali  20  1MYISTLKIKGYRNFVNQTIEFNDTNMIIGPNNGGKTNILRALRLIFEPHCRFRRMTINDFHRPIDKAHSPQIIITATLKPSPSNESEDDLRLIRM-WLTKLDDDYEACLSYVFALPASYEDEYHQAMETVADTVSAWNL--IEELFLRRYKYYIIGGKPSRMERADSDLLNGFDVQSLEALRNVENDLFGSRSSLLKEVLDFYIDYDIKNDDSLSKEEKDT-KQKEVREDFKRNSTTVIQQIIGRLETGKQQMLNYAENTGASFNNAKPDFNGEI------SEQDLYSALSIIVKYETGVDLPISHNGLGYNNLIYISLLLAKIQRMGENAVIYPILIIEEPEAHLHPSMQYKFLSFLKNHTNKVRQIFVSTHSTQI. 381
296 5.000e-63gi|489068701|ref|WP_002978684.1| MULTISPECIES: ATP-dependent endonuclease [Chryseobacterium]  clstr ali  18  1MYISQIKITNFRNFENTTVDFNDINVVIGHNNAGKSNLVSALSLVMDNSKSKR-LNIDDFYKAHLLTSPPKVSIEITIKKGSYE--TEDDLVTVSTWLTRLEEDYEAKLTYEFFLPEKHVENYLVREIPENENQNKNIWNTIKHDFLRLYVVKIWGGNVVNQSTADVDSLQKFDFQFLDAIRDVERDMLTGRNTLLRDVFDFFMDYDIKIHPTKTAPEKHM-DIKERKIEFSEKAEELVGLLHRRIASGKEEILSYAKDTGASFNNAVPDFEGVI------SETELYSVLKLIVEYETGIKIPATRNGLGYNNLIYMSLLLAKMQVNNSNAKIFSMLAIEEPEAHLHPAMQFKFLKFLDENKRKVRQIFVTTHSTHI. 382
297 5.000e-63gi|940075009|gb|KPW96007.1| putative uncharacterized protein pph95c [Pseudomonas syringae pv. castaneae]  clstr ali  17  10.HISRLQLVNYRNFECANVVFNKVNTIIGENGSGKTNLFRALRLLLNDTLLRYRLDEKDFHRGLGDWRGHWVVISLEFDEVSQDEAIQSLFLHIGKATYNLIFRPKAAVRRTLALAEARSKITISDYETIFTGKSTANFLDPETYRQLVGDFDAVKFPQETIPAIGGVIPGMLSISREVCFTFVQALRDVVTDFQNNRTNPLLTLLKCRSGEIDPQSFEPITALVKGLNDAIEGLPDVETIRTDIRDTITDAAGETYSPRSLSIRSDLSDEADRLFQSLK----------LFVGESEEEYEGAIHELSLGGANLIYLTLKLLEFKYQKQKESFANFLVIEEPEAHIHTHIQKTLFDRLNF---DDTQIIYSTHSTHI. 394
298 6.000e-63gi|881047050|ref|WP_048765899.1| hypothetical protein [Acinetobacter sp. 243_ASPC]  clstr ali  40  1MIISKLYIKNFRGYKEQTIYLDNLNVIIGKNDVGKSTILEALEIFFNNEL--VKIDVSDLSKKRELESDSDIIIQVSFQVAQGKSYTIDTVPTYLTNEYLLDSEKFLTIRKVWSASTKSLKTFIVSDYPNKKFATPLVNKKISELKKDLALFDSSHDNKAKSSSIRQAIYNFSDVQIDLSETFIPIDAEDGKKIYEAIKSDFPLYFLFKADRENKDSDTEVQSPLKVITKSILA--NMQTQLDELKAQIISATEEVGQRTITKLREMNPEIADQLIPNVST----KAWDTLFSFTFEDEAGIPINKRGSGVRRLILLNYFRAEAERKRSND-RTVIYALEEPETAQHPDWQVMLYSALVELSEKDTQIFLTTHSPSL. 380
299 6.000e-63gi|1006963472|ref|WP_061832160.1| hypothetical protein [Legionella pneumophila]  clstr ali  44  1MKLKKLHIKNFRTYQNITIPFDGFNVIVGKNDIGKSTILEALAIFFEHE--TIKLEINDLCINADKQT---ISIGCVFEDREKKYNIDSTQQASLQDEFLLNSDGLLEVWKEWDCSKKSPKIFFKANYLEEFAETPLINLKNSELKIIYDKRNLTCKDKKINAQLRCAIYQSIENQNKRQIS-IDTDKEDGKKVWNYLKEEIPLYFLFQSDRANQDSDKDVQNPLKVITKKAVS--EVESQLNNITNAIKAKIDDVAKQTIEKLKEMAPEVANHLSTNIST----KSWDSLFSFSFEDDRGISINKRGSGVRRLILLNYFRAEAERKNTTG-RSVIYSIEEPETSQHPNHQLILFDALKKISEDSNQVIITTHTPEF. 372
300 8.000e-63gi|446617651|ref|WP_000694997.1| MULTISPECIES: hypothetical protein [Vibrio]  clstr ali  18  1MKIKNVRIKNYRLLKDVSFSIDKTTLIVGRNNTGKTSFAEAFRSFLNPAGPKVR--YEDFNQSCLTGFEDAL---NALQGGAEDDVVRSMLPT-----------IELELLINYQDNADEYGVLGDFIIDFDDQLFETIILISYQLKDGKISEFLGGLDSVNRKQYFADLRSRIGLHYEANVYAVEPTNLNNKRLEFSSFKKLLLSGLINAQRGLDDETHNERDVLGKSLGHIFKSEAFKAQSAEINTVVEELQEIVDTDFQQKVQALLPTLNIFGYPGLHDPNSLLESHTRVFYQRDDHFTLPETYNGLGMRNLIFILFRIYEYFREFQSPPKGHVIFIEEPEAHLHPQMQEVFIRQLEQIVEQPVQFIVSTHSSHI. 394
301 9.000e-63gi|493491930|ref|WP_006446616.1| ATP-dependent endonuclease [Alicyclobacillus hesperidum]  clstr ali  23  1MYISKVRIQNFRCFKDCTIEFNDLNVLIGSNNAGKTTVIKALELVFKRGTTKSN-SVDDFYKGVDLSTPPEVNITATLRSSKTDTVDDKAIVAS--WLTKLESPWEAELTYRFFLPEQYHASYLEEYDKT-SNQKERWRLVERTLKRYVSR--IYGGNIVNNIRAEADYLDKIHCETLDALRDVESKLSTGKNSLLRQLLEYFKDNHTESTDTNTGNDDDFAEHSEILVRNLIGRVN------------QKEILDFAEKTGASVGG-VPTLDGSLE------ESDVLSTLRLIVKDQTGIEIPIVNNGMGYNNLIYISMILSKFTVITSNDKTFPILLIEEPEAHLHPALQYNFLKFLKEEVNVSRQIFITTHSTQI. 361
302 1.000e-62gi|951386702|ref|WP_057762703.1| hypothetical protein [Psychrobacter sp. P11G3]  clstr ali  39  1MVISKLYIKNFRGYTEQTIEIKDLNVIIGKNDVGKSTILEALEIFFNND--TVKIDVLDLNKKRLNGADSDITIQVSFKIDSKKSYTIDTIPTQLSQEYLLDSEEYLTIRKVWNASGSNIKTYIVADYPYAKFNNPLICRKITDLKKELALFHSSHDTTVVNKTICSEIRKAIYEFSNIQSSDIPIDAEDGKKIYDAIKVDLPLYFLFKADRENKDSDSEVQGPLKVITKSILS--GMQEDLDKLKDKIVTATEEVGLRTIEKLREMNPEIANALTPTVST----KAWDSLFSFTFEDEDGIPINKRGSGVRRLILLNYFRAEAERQRVSEKTV-IYALEEPETAQHPDWQKMLYSALVDLSEENTQILLTTHSPSL. 380
303 1.000e-62gi|1006038920|ref|WP_061721693.1| hypothetical protein [Legionella pneumophila]  clstr ali  41  1MKLKKLYIKNFRAYQDIVIPFNDFNVIVGKNDIGKSSILEALAIFFEHES--IKIDNTDLNIKATQPI---ISIGCAFEDKNKKYNIDSTQQASLADEYLLNKDGLLEIWKEWDCSKKSLKTYFQAHYLEEFAETPLINLKNAELKKIYEDKKLDTCKDKKINALLRYSIYESSECENKKLTQIDIDKEDGKKIWDYLKEDLPLYFIFQSDRANQDSDKDVQNPLKIITKKAIG--EVEAELLAITNKIKDKIDEVAKQTIDKLKEMAPEIANHLKTNIST----KSWDSLFSFSFDDDRGISINKRGGGVRRLVLLNYFRAEAERKNTSGKTV-IYSIEEPETSQHPNHQLILFDALKRLSEDNNQILITTHTPEF. 372
304 1.000e-62gi|737651495|ref|WP_035621440.1| ATP-dependent endonuclease [Flavobacterium hydatis]  clstr ali  19  1MYIARIKISNFRNFTDQTVLFEGVNVIIGHNNAGKTNLLKALSLVL-DSNASKRLETDDFNKNQLQAAPPKISISLTIKKGSHTELDD--LVTVGNWLTVLDTKYEALLTYEFFLPEKDIPDYLAAMKSITDKARETAWKIIKHDFIRLFVARIWGGNLVNRTAADHESLQKFDFQFLDAIRDVEKDMLTGRNTLLREVFDFFMDYGIKNEPEVTKSKSKKLAEIKQLKDFSLQADQLISTLHTRMKEGKDQILSYANKTGASF-------DAPPNFEGSMSDIEMYSVLKLIVEYESGIKIPATHNGLGYNNLIYMSLLLAKMQVNSSNSKVFATLAIEEPEAHLHPAMQYKFLKFLRENKKENRQIFVTSHSTNI. 385
305 2.000e-62gi|935443102|ref|WP_054397975.1| hypothetical protein [Lactobacillus plantarum]  clstr ali  35  1MKLIKFGIKNFRGFGNQEVKIDNFTCLVGKNDAGKSSIFDAMDVFFNG---FKNIDSDDAHIDSHGNRAKKVELSGTFDVEDSQIKIES-VPTSLGAEGLLNSEGQLKIVQEISSPSKSIKTFIMAFLPDLDEVKDIHTLKNSALKKRFNKIKEDNIPQTTNTLMRKAIINYYENKLPAQSSKVPIDKEGGKDLWSSINKGLPLFQLFKTDRDNNDSDAEIQNPLKAITKKTLQGK-LQEQLDTITSTIKAETIKQANKTLEKLNEMDPDLASQITPTFDDPS---WQNIFKFSLDTD--QIPLNKRGSGTRRLILLNFFRAEAEQAKDESNSNNIYAFEEPETAQHIDHQKILMESFKKIAEQNQQVLITTHSPEL. 382
306 2.000e-62gi|513468638|gb|EPF16491.1| hypothetical protein HMPREF0201_02854 [Cedecea davisae DSM 4568]  clstr ali  17  8MRIQQVQIKNFRLLADVELMLEETTVIVGRNNSGKTSLSEIIRRFLADGSSAFQL--EDFSSTSYD----------CFCEALDALNQGAEENIIRQ----LIPAIELRLKFQYDPTQPQLGPLSPFVIDLDPGCTEALAVIRYELKQFLENQPNKPLTYETRILFLRTLRERIPNNFSTKIWAEDNDPDNRRELQPSALRGLVKTGFINAQRGLDDVTSRESDVLAKTVESASADTADKQIAEALKDTVQDIQAQIDTNFGGQLKSLIPALKTFGYPTLLDVGKLLSNFTKVRYAGYGGVALPESYNGLGARNLIFILLQLAKAFRAETKEPGVHLIFIEEPEAHLHPQMQEVFIRQLAKIAQQPVQFVVSTHSSHI. 406
307 2.000e-62gi|737365484|ref|WP_035347621.1| chromosome segregation protein SMC, partial [Bacillus hemicellulosilyticus]  clstr ali  21  1MYISGIEIKNFRSFDNINVEFEGVNVLIGHNNSGKSNLLRALAIIF-DSSVRKQLSVEDFNIESLKSESPKIVISVRITQSENENLMTDELVTVSNWLTRLEEPYEAKIQYEFFLPISEERNYINIVSKAHSTEEIWNIIRSQFIRLYINKT--WVGNPENQSPVDNDSINKFDFQFLDAIRDVERDMFSGKNTLLKNVIDFFIDYDIKSDKSITEEEQK-RKLQERKDIFSANSRELIKTIHERLNRGNKEILSYTDGIGASYDKSIPDFEGNL------TESEIYTVLQLIVKQETGMTIPITYNGLGYNNLIFMALLLAKMQVDSSNAKVFPILAIEEPEAHLHPTMQNEFIRFLNFKNKKVKQIFITTHSTHI. 380
308 3.000e-62gi|662149935|ref|WP_030099744.1| ATP-dependent endonuclease [Burkholderia sp. K24]  clstr ali  21  1MKIQFVRIKNFRTLKDVAIPFDSVTTFIGPNGAGKSTVLRALDWFFNGKPGA--LTEKDCSFGAT---GEQVEVQVTFTDLTGKDRDALG-------KYAPAEVETFTAWKRWTIGGSNAKSFPDFNVIKAAVGATAKKDLYANLRGTHPNLNLPTANTGPAVEQAMTAWESAHTDRLVDAPEPLQTNFFGFNSGGKMSGLFDFVLVTADLRASEESVDGKSSIIGRILERSIDRTAADEAIAQIVEESRAKQQSVYEKFKDQLEKITTQLNDVVTTYSPEVELKAPRTTFEVAVRDGKTETAVERQGHGFQRTLLISALQLLAQSGAASTEGVICLAIEEPELYQHPIQAQTFAKVLRSLAEKRIQVTYATHSPYFL 384
309 4.000e-62gi|775235911|dbj|GAN69568.1| hypothetical protein Abol_047_003 [Acetobacter orleanensis JCM 7639]  clstr ali  18  6MHISKLQLVNYRNFARATVKFEKVNTIIGENGSGKTNLFRAIRLLLDDNLLAHRLDDRDFHRGLGEWRGHWIIISLEFTDVSQDETIQSLFLTIDKATYNLIFRPKAAIRQRLSLSELRREISLADYETVFTGKSSADFTDPAVYQALVGDFDAVTFDELTPAEIGNIVPGMFSIAREIGFTFIQALRDVVAEFQNNRTNPLLTLLKGKSGEIDPAKFAPISGLVTDLNTAIEGLDDVRAIRTDIRDTITDAAGETYSPKSLSIKSDLSDEADRLFQSLK----------LFVGEAEAGYEGGIHELSLGGANLIYLTLKLLEFKYQKVKQTFANFLVVEEPEAHIHTHIQKTLFDRLN---YDDTQIIYSTHSTYI. 391
310 4.000e-62gi|517743007|ref|WP_018913215.1| ATP-dependent endonuclease [Thiomonas sp. FB-6]  clstr ali  20  1MKIQSVRITNFRTLSDVTIPFDSVTTFIGPNGAGKSTVLRALDWFFNGKPGS--LTEKDCSFGATT---ENIEVQVGFTDLTNKDREALG-------KYAPDVVANFTAWKRRSPDGANAKGLPEFNAIKAAGSAAAKKDLYAALRSSRAELNLPVANTGAAVEQAMTAWESSHTDQLVDAPEALQTNFFGFNSGGKMSGLFDFVLVTADLRASEESIDGKSSIIGRILERSVDRAAADDEIAKIVEESRAKQQQVYEEITTQLNEVVGSYAPGRAVTVSPAEVELKRTTFDVAVLDGTTETVVERQGHGFQRTLLISALQLLAQSGAASSEGIICLAIEEPELFQHPIQAQAFAKVLRALAEKRIQVTYATHSPYFL 384
311 5.000e-62gi|749944772|ref|WP_040327631.1| chromosome segregation protein SMC [Candidatus Clostridium anorexicamassiliense]  clstr ali  20  1MYIANVKVKNYRNLKEASIDFEGTNVIIGHNNAGKSNLLSSIGLIF-DKSSRKQLDVEDFSLDELKEKSPTIQITVLLKQSQNENLMGDELVTVSDWLVSLKEPYEAQIQYEFFLPTTED-NYYMERVKSLTSVDDVWKMINADFIR-FYTYKILVGNPANQISIGNESINKFDYQFLNAIRDVERDMFSGKNTLLKSVIDFFMDYEIKANKGMTEEDQRSQIQLRKR-EFSNTADDLIEKLKIRLASGNKEILSYASDIGASFDKSEPSFSGKI------TESEIYSVLQLIVKQETGMTIPVSRNGLGYNNLIFMSLLLAKMKYLGSNAKVFPMLIIEEPEAHLHPTMQDKFMKFLKKNIHDGKQIFITTHSTFI. 380
312 5.000e-62gi|496009298|ref|WP_008733877.1| ATP-dependent endonuclease [Alcanivorax pacificus]  clstr ali  17  1MKLRHAKIKNFRLLADVQLALEDLTVVVGRNNSGKTSLSEIIRRLLAEGSAAFQL--EDFSSACYDRFCTALEAHNNGQDDD--------------VVRALIPFIELRLTFEYDPAQPQLGPLSPFVIDLDPDCNEVLAVVRYELKDFFSGQPDTPLTDETRIAFFRSLRERIPTSFAVRVWAEDNDAENNRQLQPSALKALIKTGFINAQRGLDDITSRESDVLAKTVELLFADEADKQIAQALKEAVQDIQSQIDSSFGGQLNNLIPALKNFGYPGLGNQEKLLSNFTKVRYAGYSGVTLPESYNGLGARNLIFILLQLAGFYKSEPNSPGVHLVFIEEPEAHLHPQMQEVFIRQLAKTAQLPVQFVVSTHSSHI. 399
313 6.000e-62gi|946896042|ref|WP_055818828.1| MULTISPECIES: ATP-dependent endonuclease [Sphingomonas]  clstr ali  18  1MRIVKARIENFRLLRNVEFGFERTTLIVGRNNSGKTSIAELFRRILSGGSLALRL--EDFSLGCHESFWQALQAYRADPQSADAWEQLPSIRLVLDIEYDTDDLGPLGNCIIDLNDDCHEARLEFRFGPKATAPETFFADHLVPLEDAAND----------RSRFFRDLGQRLPTAYVGTLEAVDNDATNRKSLETKLLTTLVGVGFINAQRGLDDDTIRERDVLGKVVEVLFQNPERRTTAEQLKEVVEAIQGDVHNSFNSGLTSLLPTFDLFGYPGLSDPNKLLKDHTKVRYRGVNGMTLPETYSGLGTRNLVYMLLQLLSFFREYQTSSGVHLIFIEEPEAHLHPQMQEVFIRQLERVAQLNVQFVVTTHSPHM. 400
314 7.000e-62gi|751195004|gb|KIL80158.1| putative ATP-dependent endonuclease, OLD family [Bacillus badius]  clstr ali  38  21..LKQIYLRNFRGYEEVKIDFDGMNVIIGKNDVGKSTIMDALELFFNGKSTLVKAEVNDCNIDAT---VKEMEIAACFRNEDEKISIDASNVTNLSEEYLLNKDGLLEIKKIWDCSKVSINVLINAHYPYISEKHFISELKKEIEKIKDDIRNYEEINKTKNADLRKALYDYYDIEFREIDIEIKKIETDEKDLWRKIKDNLPLYFLFQSDRSNSDSDNEVQNPLKIATKKALA--EIEEQLKEIKEFVDETVSKIGDLTINKLQEFDPGIASKLNTKLNM----KSWDSLFSFDLESDDGISLNKRGSGVKRLILLSYFRAEAERISSENNKNIIYGIEEPETSQHPDFQRMIIDSLKSISEDKHQVIITTHTPEI. 404
315 7.000e-62gi|948285802|ref|WP_056930161.1| ATP-dependent endonuclease [Ferrovum sp. JA12]  clstr ali  20  1MKIRSVHIRNFRALKDVTIPFDSVTTFIGPNGAGKSTVLRALDWFFNGKPGS--LTDKDCSFGAT---DEDIEIQVTFAELTENDREALG-------KYAPEGVDTFTAWKRRFPDGSDEKGFPEFNAIKAASGAAAKKDMYTALRLSQPCLGLPAANTGAAVEQAMTAWEASHTDHLVNAPEPLKTDFFGFNSGGKM-SGLFDFVLITADRASEESIDGKSSIIGRILERSAIAEIVEESRAKQQKVYEEKFKTQLDAMTTQLNEVVASYSPGRAVTVSPAEVVLKRTTFEVAVLDGTTETHVERQGHGFQRTLLISALQLLAQSGAASAEGIICLAIEEPELFQHPIQAQAFAKVLRSLTEDRIQVTYATHSPYFL 384
316 7.000e-62JGI.Meta 7066607431 C191500__gene_9348 hypothetical protein [Human Anterior nares microbiome from visit number 2 of subject 158883629]  ali  22  1MYISGIEIKNFRSFDNINIDFEGVNVLIGHNNSGKSNLLRALAIIFDRTVK-KQLSVEDFNIDSLKKQSPKIVITVRIKQSENEDLMTDELITVSNWLTKLEEPYEAKIQYEFFLPISEEKNYVDTVNKANNKEEIWNIIRSQFIRLYIS--KIWGGNPENQVPIDNDNLNKFDFQFLDAIRDVERDMFSGRNTLLKSVIDFFLDYDIKSDKNITEEEQKM-KLQERKDIFSTHSSQLIKNIQERLDSGNQEILSYIEEIGASYDKSTPDFEGQL------SESEIYTVLQLIVRQTTGMSIPITHNGLGYNNLIFMALLLSKMQADSSNAKVFPILAIEEPEAHLHPTMQNEFIKFLKNNIKDKKQIFITTHSTHI. 380
317 8.000e-62JGI.Meta 7017684181 SRS016200_WUGC_scaffold_18474__gene_19210 hypothetical protein [Human Supragingival plaque microbiome from visit number  ali  19  4MHISKVSLVNYRNFRRATVELKGINTIIGENGSGKTNLFRAIRLLLDENMQANKLDEKDFNRGLDDWRGHWIVIKLEFSGVSSSETIQSLLLQNLDDNSSDIIEQPATYSLIFRPNDEKKSITIDDYETIHLGRGTADIMDEEEYKRIVGDFEIFPDPEEFTDILGIRIGRYFSLTREFSFSYIDALRDVQREFHRNHRNPLRTLLSAKSEDVDLEDFQSVVYKVKELNEEIENRNDIKYICNGIYKTFKQTVGETYSATSMSVKSELPTEA-----------DELFRSLKLYVGEHGDYEGGINELSLGTANLLFITLKLLEFQYKKAYKPVANFLLIEEPEAHIHTHIQKTLFNKIN---YDDTQIIYSTHSPQI. 394
318 1.000e-61gi|519208125|gb|EPM92456.1| ATP-dependent endonuclease of the OLD family protein [Pseudomonas syringae pv. actinidiae ICMP 19070]  clstr ali  19  39MKIQSIRIQNFRTLKDVTIPFDSVTTFIGPNGAGKSTVLRALDWFFNGKSGS--LTEKDCSFGAS---DEHIEVQVTFGELT---KKDREALGKYAPEGVNTFTWRLRSPDGLDVLSANAKGFPEFNAVKAAGSAAAKKELYATLRRERPELNLPAANTGPAVEQAMTAWEAAHTGQLLDAPEALQTNFFGFNSGGVMSGLFDFVLVTADLRASEESIDGKTSIIGRILERSIIAEIVADSRAKQQKVYEEKFTKQLETITTQLNEVVATYAPGRGITVSPAEVELKRTTFDVAVLDGTTKTPVERQGHGFQRTLLISALQLLAQSGAASAEGVICLAIEEPELFQHPIQAQTFAKVLRSLAEKRIQVTYATHSPYFL 422
319 1.000e-61gi|959361837|ref|WP_058120183.1| ATP-dependent endonuclease [Photobacterium kishitanii]  clstr ali  16  1MHISKLSLVNYRNFSNSKLLFSKINTLIGENGSGKTNLFRAIRLLLDNTMPRSRLQENDFCRNLGDWRGHWIIISLEFNDIADDEVSQSLFLHVEKATYNLIFRPKAYIRQSLSLEKLRDTICIDDYETIITGKNDSDFNDESIYQMIVGDFENVKFPRTVELKIGALIPNILSMSDEVSFTFVKALRDVVSDFHNNRTNPLLTLLKRKGGEIKKEDFDPIAEMVDSLNISIESLPDVGQIRADIKETINDSVGDTYSPKSISIKSGLSDEADQLFQSLK----------LFVDESDDGYEGGIHEMSLGGANLIYLTLKLLEFKYQKGNQLIANFLLIEEPEAHIHTHIQKSLFDKIN---YSNTQIIYSTHSSHI. 386
320 1.000e-61gi|492378451|ref|WP_005825419.1| ATP-dependent endonuclease [Bacteroides uniformis]  clstr ali  19  1MYISKVSLVNYRNFENAFFLFNKINTIIGENASGKTNLFRAIRLILDDSSSAYKLNENDFNRNLKSWKGKWIIISLEFNEISNDEAIQSLFIITKKATYNLFFRPKPEIRKKDGLNGILDKITIEDYETFFTGKSTADFNDKNVQRELMGDFDNVIFNFDDESKYGGRIPHQLSISREVSFTFIKALRDVVSDFQDNRKNPLLTLLKNKSEDIKEEDFKPISIKVDDLNKSIEELDDIQMITNNISETIKEAVGTTYSPSSLSIKSNLPSEAEKLLQSLK----------LFIGEPEEDYEGGIHELSLGGANLIFLTLKLLEYKYRKEKDKIANFLLIEEPEAHIHTHIQKALFDKLN---YTDTQIIYSTHSTHI. 386