current user: public

Announcement: our server is upgraded to a faster system. If you experience any issues during this period please let us know.

Query: PF00543.17; O54449_AZOVI/4-105; Nitrogen regulatory protein P-II, from PfamA26U

Results of PSI-BLAST search in nr85s
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
2 1.000e-58Oral.Meta HOMD aaph_c_1_5625 Aggregatibacter aphrophilus NJ8700 [1535066 - 1534614] GlnK protein  ali  69  43IEAIIKPFKLDDVREALSDIGITGMTVTEVRGFGRQKGHTELYRGAEYMVDFLPKVKMEIVVPDELLEQCLDAIIDTAQTGKIGDGKIFVYEVERVIRIRTG 144
3 1.000e-58Oral.Meta HOMD bdim_c_10_135 Brevundimonas diminuta ATCC 11568 [40029 - 39457] nitrogen regulatory protein P-II  ali  65  83IEAVIKPFKLDEVKDALQDIGVQGMTVLEAKGYGRQKGHSELYRGAEYVIDFLPKIKIEVVVADDLAPAVVETIQNAARTGKIGDGKIFITPLEDVIRIRTG 184
4 1.000e-58Oral.Meta HOMD nbac_c_14_286 Neisseria bacilliformis ATCC BAA-1200 [63946 - 63479] nitrogen regulatory protein P-II  ali  66  48IEAIIKPFKLDDVREALTDIGITGMTVTEVKGFGRQKGHTEVYRGAEYAVDFLPKVKIEMVLRDEQVEQAVDVIIETARSGKIGDGKIFILPVEEAVRIRTG 149
5 2.000e-58gi|114327623|ref|YP_744780.1| nitrogen regulatory protein P-II [Granulibacter bethesdensis CGDNIH1]  clstr ali  71  77IEAVIKPFKLDEVKEALHEVGLQGITVMEAKGFGRQKGHTELYRGAEYVVDFLPKVKIEVVCEDDQVERAVEAIVNAARTGRIGDGKIFVTPVEDVIRIRTG 178
6 3.000e-58JCVI_PEP_1096696408303 /source_dna_id=JCVI_ORF_1096696408302 /offset=0 /translation_table=11 /length=180 /full_length=180  ali  70  71IEAIIKPFKLDDVKEALQEIGLQGLTVIEAKGFGRQKGHTELYRGAEYVVDFLPKMKIELVVPDARVDAAVEAIQNAARTGRIGDGKIFITPVESAIRIRTG 172
8 3.000e-57JCVI_PEP_1096699795925 /source_dna_id=JCVI_ORF_1096699795924 /offset=0 /translation_table=11 /length=160 /full_length=160  ali  76  51IMAIIKPFKLDEVREALSEVGVSGITVTEVKGFGRQKGHTELYRGAEYIVDFLPKVKIEVAVPDDVVERAVEAIEKSARTGKIGDGKIFVADVEQVIRIRTG 152
9 3.000e-57JCVI_PEP_1096699561719 /source_dna_id=JCVI_ORF_1096699561718 /offset=0 /translation_table=11 /length=398 /full_length=398  ali  69  289IEAVIKPFKLDEVKEALQEIGIQGLSVIEAKGFGRQKGHTELYRGAEYVVDFLPKVKIEVVVSDDQSEQAVDAIVQAARTGKIGDGKIFIYPVEQAVRIRTG 390
10 3.000e-57gi|343518834|ref|ZP_08755821.1| nitrogen regulatory protein P-II [Haemophilus pittmaniae HK 85]  clstr ali  70  17IEAIIKPFKLDDVRENLSDIGISGMTVTEVRGFGRQKGHTELYRGAEYMVDFLPKVKIEIVVPDELLEQCLETIVETAQTGKIGDGKIFVYDVERVIRIRTG 118
11 3.000e-57JCVI_PEP_1096698268521 /source_dna_id=JCVI_ORF_1096698268520 /offset=0 /translation_table=11 /length=144 /full_length=144  ali  69  35VVAIIKPFKLEEVKDALAEIGIEGMTVTEVKGFGRQKGHTEIYRGSEYTVDFLPKVKIEAAVADEQVDKAISTISKAAHTGKIGDGKIFVYSLSEVVRIRTG 136
12 4.000e-57JCVI_PEP_1096682266495 /source_dna_id=JCVI_ORF_1096682266494 /offset=0 /translation_table=11 /length=211 /full_length=211  ali  77  102ITAIIKPFKLDEAREALSAIGVSGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIEAAVSDDIVDQAIEALERAARTGKIGDGKIFVTPIEQVIRIRTG 203
13 4.000e-57gi|416060172|ref|ZP_11580818.1| nitrogen regulatory protein P-II [Aggregatibacter actinomycetemcomitans serotype e str. SCC393]  clstr ali  68  27IEAIIKPFKLDDVREALSDIGITGMTVIEVRGFGRQKGHTELYRGAEYMVDFLPKVKMEIVVPNDLLDRCLDAIIDTAQTGKIGDGKIFVYEVERVIRIRTG 128
14 4.000e-57JCVI_PEP_1096701563465 /source_dna_id=JCVI_ORF_1096701563464 /offset=0 /translation_table=11 /length=445 /full_length=445  ali  73  336ITAIIKPFKLDEVREALAEVGLTGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKMKIEVVVAEAQVDQVIDAVIGAARTGKIGDGKIFVSDVERVIRIRTG 437
15 8.000e-57JCVI_PEP_1096666075017 /source_dna_id=JCVI_ORF_1096666075016 /offset=0 /translation_table=11 /length=202 /full_length=202  ali  87  29VTAVVKPFKLDDVREALSDIGMQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIEVATSDDQADQVIEAISKAANTGKIGDGKIFVVNLEQAVRIRTG 130
16 8.000e-57gi|254247109|ref|ZP_04940430.1| Nitrogen regulatory protein P-II [Burkholderia cenocepacia PC184]  clstr ali  75  34ITAIIKPFKLDETREALSALGVSGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKMKIEAAVSDDLVDQAVEAIERAARTGKIGDGKIFVTPIEQVIRIRTG 135
17 1.000e-56gi|225075299|ref|ZP_03718498.1| hypothetical protein NEIFLAOT_00302 [Neisseria flavescens NRL30031/H210]  clstr ali  68  17IEAIIKPFKLDDVREILTEIGITGMTVSEVKGFGRQKGHTEIYRGAEYAVDFLPKVKIELVLADDKVDQAVDAILETAHSGKIGDGKIFIYPVEEAIRIRTG 118
18 1.000e-56gi|384260506|ref|YP_005415692.1| Nitrogen regulatory protein P-II [Rhodospirillum photometricum DSM 122]  clstr ali  73  74IMAIIKPFKLDEVREALAALDVQGLTVSEVKGFGRQKGQTEIYRGAEYQVNFLPKVKIEVAVRDEVVDRAIEAITTAAGTGKIGDGKIFVSSLEQAVRIRTG 175
19 1.000e-56Oral.Meta HOMD kden_c_2_764 Kingella denitrificans ATCC 33394 [210184 - 210582] nitrogen regulatory protein P-II  ali  69  25IEAIIKPFKLDDVREALTELGITGMTVSEVKGFGRQRGHTEVYRGAEYAVDFLPKVKIEVVLPDDQIERTVEAIIEAARSGKIGDGKIFVLPVEEVIRIRTG 126
20 1.000e-56Oral.Meta HOMD haeg_c_3_439 Haemophilus aegyptius ATCC 11116 [37579 - 37172] nitrogen regulatory protein P-II  ali  72  28IEAMIKPFKLDDVRESLSDIGISGMTITEVRGFGRQKGHTELYRGAEYMVDFLPKVKLEVVVPDELVDQCIEAIVETAQTGKIGDGKIFVYHVERAIRIRTG 129
22 3.000e-56gi|387129413|ref|YP_006292303.1| nitrogen regulatory protein P-II [Methylophaga sp. JAM7]  clstr ali  81  4IEAIIKPFKLDDVREALSEIGVTGMTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKMEIVLADDQVDGCIEAITKAAHTGRIGDGKIFVSPLEQAIRIRTG 105
23 3.000e-56gi|37680932|ref|NP_935541.1| nitrogen regulatory protein PII [Vibrio vulnificus YJ016]  clstr ali  73  24INAIIKPFKLDDVREALADVGIEGMTVSEVKGFGRQKGHTELYRGAEYQVDFLPKVKLEIATQAENVDRVIEAITKAAHTGKIGDGKIFVYDLSHAVRIRTG 125
24 3.000e-56Oral.Meta HOMD atum_c_1_6118 Agrobacterium tumefaciens str C58, ATCC 33970 [1753678 - 1754169] nitrogen regulatory protein PII  ali  73  56IEAIIKPFKLDEVKEALQEVGLQGITVTEAKGFGRQKGHTELYRGAEYVVDFLPKVKVEVVLADENAEAVIEAIRNAAQTGRIGDGKIFVSNIEEVIRIRTG 157
25 5.000e-56gi|347761641|ref|YP_004869202.1| nitrogen regulatory protein PII [Gluconacetobacter xylinus NBRC 3288]  clstr ali  68  37VTAIIKPFKLDDVREALTPLGIQGLTVSEVKGFGRQKGQTEIYRGAEYHVSFLPKIKIEVAVADEMVEQAVETILEAAHTGKIGDGKIFISPLDSVIRIRT. 137
26 5.000e-56gi|196233118|ref|ZP_03131965.1| nitrogen regulatory protein P-II [Chthoniobacter flavus Ellin428]  clstr ali  60  56IEAIIKPFKLEEVKDALADLGVEGMTVTEVKGFGRQKGHTEIYRGSEYTVDFLPKVKLEIVLGDEIAEKAVATIVAAAKTGKIGDGKVFTFSVESATRIRT. 156
27 8.000e-56Oral.Meta HOMD nelo_c_12_369 Neisseria elongata ATCC 29315 [25230 - 24865] nitrogen regulatory protein P-II  ali  66  14IEAIIKPFKLDDVREALTDIGITGMTVTEVKGFGRQKGHTEVYRGAEYAVDFLPKIKMELVLRDDQVDQAVDVIIETARSGKIGDGKIFIFPVEEAIRIRTG 115
28 1.000e-55JCVI_PEP_1096676294985 /source_dna_id=JCVI_ORF_1096676294984 /offset=0 /translation_table=11 /length=207 /full_length=207  ali  76  98ITAVIKPFKLDDAREALSGIGVQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKIRLEIAVDDSMVEQIIEVLMKAASTGKIGDGKIFVHDLEQVIRIRTG 199
29 1.000e-55JCVI_PEP_1096693782573 /source_dna_id=JCVI_ORF_1096693782572 /offset=0 /translation_table=11 /length=164 /full_length=164  ali  69  55ITAVIKPFKLDDVREALTDVGIEGMTVTEVKGFGRQKGQAEIYRGAEYTIAFLPKVKIDIAVDDAAAEKVIEAIQQSANTGKIGDGKIFVQELTNAVRIRTG 156
30 1.000e-55Oral.Meta HOMD axyl_c_1_9518 Achromobacter xylosoxidans A8 [2842549 - 2842932] nitrogen regulatory protein P-II 2  ali  77  20VTAIIKPFKLDEVREALAEVGVSGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKIRVEVVLPDSQVEAAIEAVVKAARTGKIGDGKIFVTPVEQAIRIRTG 121
31 2.000e-55gi|335043331|ref|ZP_08536358.1| nitrogen regulatory protein PII [Methylophaga aminisulfidivorans MP]  clstr ali  79  4IEAIIKPFKLDDVRQSLSDIGVTGMTVTEVKGFGRQKGHTEFYRGAEYVVDFLPKVKLEIAVADDKVDSVIEAVIKAANTGRIGDGKIFVTPLEQAIRIRTG 105
32 2.000e-55gi|322513351|ref|ZP_08066470.1| nitrogen regulatory protein P-II [Actinobacillus ureae ATCC 25976]  clstr ali  66  4IEAIIKPFKLDDVREALTDAGITGMTVTEAKGFGRQKGHTELYRGAEYAIDFLPKIQLEIVVADDQVDACIEAIIDTAQTGKIGDGKIFIYDIERVIRIRTG 105
33 2.000e-55Oral.Meta HOMD pflu_c_1_21134 Pseudomonas fluorescens Pf0-1 [6171957 - 6171409] nitrogen regulatory protein P-II  ali  96  75VTAIIKPFKLDDVRESLSEIGVQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIDVAIDDKDLDRVIEAITKAANTGKIGDGKIFVVNLEQAIRIRTG 176
34 2.000e-55gi|261855413|ref|YP_003262696.1| nitrogen regulatory protein P-II [Halothiobacillus neapolitanus c2]  clstr ali  68  4IEAIIKPFRLDDVRTALMELGINGMTATEVKGFGRQKGHTELYRGAEYVVDFLPKIKLEIVVSDGLVDAVLDAIIKAAHSGKIGDGKIFVFPVERAVRIRTG 105
35 2.000e-55Oral.Meta HOMD ngon_c_28_160 Neisseria gonorrhoeae DGI2 [446 - 54] nitrogen regulatory protein P-II  ali  67  23IEAIVKPFKLDDVREALTEIGITGMTVSEVKGFGRQKGHTEIYRGAEYAVDFLPKVKIELVLADDAVERAIDVIVEVARSGKIGDGKIFVLPVEEAIRIRTG 124
36 2.000e-55gi|386389048|ref|ZP_10073880.1| nitrogen regulatory protein P-II [Haemophilus paraphrohaemolyticus HK411]  clstr ali  71  31IEAIIKPFKLDDVREALTDAGITGMTVTEVKGFGRQKGHTELYRGAEYAIDFLPKVKVEVIVLDEQVDECIEAIMDVAQTGKIGDGKIFVYEADRAIRIRTG 132
38 2.000e-55gi|288575545|ref|ZP_05977159.2| nitrogen regulatory protein P-II [Neisseria mucosa ATCC 25996]  clstr ali  69  40IEAIIKPFKLDDVREALTEIGITGMTVSEVKGFGRQKGHTEIYRGAEYAVDFLPKVKVELIIADEDVERVIDVIIENARSGKIGDGKIFVLPVEEAIRIRTG 141
39 2.000e-55gi|332284523|ref|YP_004416434.1| hypothetical protein PT7_1270 [Pusillimonas sp. T7-7]  clstr ali  72  4ITAIIKPFKLDEVREALSELGIQGMTVTEVKGFGRQKGHTELYRGAEYTVDFLPKLRLEMAVSDHLVEQAIENLCAAAHTGKIGDGKIFVTSIEQAIRIRT. 104
40 3.000e-55gi|110804478|ref|YP_687998.1| nitrogen regulatory protein P-II 2 [Shigella flexneri 5 str. 8401]  clstr ali  78  50VTVIIKPFKLEDVREALSSIGIQGLTVTEVKGFGRQKGHAELYRGAEYSVNFLPKVKIDVAIADDQLDEVIDIVSKAAYTGKIGDGKIFVAELQRVIRIRTG 151
41 4.000e-55gi|418469308|ref|ZP_13039929.1| nitrogen regulatory protein P-II, partial [Streptomyces coelicoflavus ZG0656]  clstr ali  66  1.EAIVKPFKLDDVKEALQDVGVQGMTVLEAKGCGRQKGHSELYRGAEYVIDFLPKIKIEVVVADDLAPAVVEAIQTSARTGKIGDGKIFVSDVADVIRIRTG 101
42 4.000e-55JCVI_PEP_1096674698807 /source_dna_id=JCVI_ORF_1096674698806 /offset=0 /translation_table=11 /length=537 /full_length=537  ali  76  428VTAIIKPFKLDDVRSALSEIGVQGVTVTEVKGFGRQRGHTELYRGAEYVVDFLPKLKLEIATSAEQLDQIVDTIIAAASTGKIGDGKIFVSELEQVVRIRTG 529
45 5.000e-55gi|386815871|ref|ZP_10103089.1| nitrogen regulatory protein P-II family [Thiothrix nivea DSM 5205]  clstr ali  74  4IQAIIKPFKLDDVREALTEIGVTGMTAIEVKGFGRQKGHTELYRGAEYVVDFLPKVKLEIVVKEEDVDRCIETIQKAAHTGKIGDGKIFVFPVEQAIRIRTG 105
46 5.000e-55gi|330990992|ref|ZP_08314946.1| Nitrogen regulatory protein P-II [Gluconacetobacter sp. SXCC-1]  clstr ali  65  35IEAIIKPFKLDEVKDALHEIGLMGITVIEAKGFGRQKGHTELYRGAEYIIDFLPKVKLEIVCPDDMTERAIEAIMGAARTGRIGDGKIFVTPVTDVIRIRTG 136
47 6.000e-55JCVI_PEP_1096686837219 /source_dna_id=JCVI_ORF_1096686837218 /offset=0 /translation_table=11 /length=158 /full_length=158  ali  72  49IEAIIKPFKLDEVKEALHEVGVKGLTVTEAKGFGRQKGHTELYRGAEYVVDFLPKVKIEVVIEDSMVESAVEAIQQAAHTGRIGDGKIFVSAVEDVLRIRTG 150
49 7.000e-55gi|71906926|ref|YP_284513.1| nitrogen regulatory protein P-II [Dechloromonas aromatica RCB]  clstr ali  72  4IEAIIKPFKLDEVREALSEIGISGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKIKIEIVVNSNNVEPAIDAIIKAARTGKIGDGKIFVMPVEQVVRIRTG 105
50 8.000e-55gi|117619045|ref|YP_855191.1| nitrogen regulatory protein P-II [Aeromonas hydrophila subsp. hydrophila ATCC 7966]  clstr ali  74  4ITAIIKPFKLDDVREAIANLGVEGLTVSEVKGFGRQKGHTELYRGAEYQVDFLPKVKLEIATADDNVEGVIEAICKAAYTGKIGDGKIFVYDLLQAVRIRTG 105
51 9.000e-55gi|332140417|ref|YP_004426155.1| GlnB protein [Alteromonas macleodii str. `Deep ecotype`]  clstr ali  67  4IEAIIKPFKMDDVREALAEVGIAGMTVSEVKGFGRQKGHTELYRGAEYQVDFLPKIKIELVLDDDRVEQAVEAIQSSAKTGKIGDGKIFVYSVESAVRIRTG 105
52 1.000e-54gi|85711027|ref|ZP_01042087.1| Nitrogen regulatory protein PII [Idiomarina baltica OS145]  clstr ali  72  4VEAIIKPFKLDDVREALSEVGIAGMTVSEVKGFGRQKGHTELYRGAEYMVDFLPKVKLEVVVADTDVERCIEAIMETAQTGKIGDGKIFVSDIERVIRIRTG 105
54 1.000e-54gi|160895751|ref|YP_001561333.1| nitrogen regulatory protein P-II [Delftia acidovorans SPH-1]  clstr ali  78  4VTAIIKPFKLDEVREALSDIGVQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKLRLEAAVPDALVDQVIDAIEAAARTGKIGDGKIFVLPIEQAVRIRTG 105
55 2.000e-54gi|109899467|ref|YP_662722.1| nitrogen regulatory protein P-II [Pseudoalteromonas atlantica T6c]  clstr ali  74  4VEAIIKPFKMDDVREALAEVGVSGMTVTEVKGFGRQKGHTELYRGAEYNVDFLPKMKLEVVIPDGQVELAIEAIMKTAQTGKIGDGKIFVYEVERVIRIRTG 105
56 2.000e-54gi|421595624|ref|ZP_16039625.1| nitrogen regulatory protein PII [Bradyrhizobium sp. CCGE-LA001]  clstr ali  63  4VVAIIKPFKLDEVRQALTAIGIHGMTVTEVKGYGRQKGHTEIYRGAEYVVNFLPKLRIEIAVASDIADKAVSVITATARTGQIGDGKIFVTPIDHALRIRTG 105
57 2.000e-54gi|254491109|ref|ZP_05104290.1| nitrogen regulatory protein P-II [Methylophaga thiooxidans DMS010]  clstr ali  80  4VVAIIKPFKLDDVRESLSEIGVQGLTVSEVKGFGRQKGHTELYRGAEYVVDFLPKLKLEIAVDDDIVEQVIEAIIKGANTGKIGDGKIFVYPLEQVVRIRTG 105
58 3.000e-54gi|374334785|ref|YP_005091472.1| nitrogen regulatory protein PII [Oceanimonas sp. GK1]  clstr ali  69  4IEAIIKPFKLDDVREALAERGITGMTVSEVKGFGRQKGHTELYRGAEYMVDFLPKVKLELVVQDELVEACIEAIETTARTGKIGDGKIFVLDVGQVIRIRTG 105
59 3.000e-54gi|89091839|ref|ZP_01164794.1| regulatory protein, P-II 2, for nitrogen assimilation by glutamine synthetase [Neptuniibacter caesariensis]  clstr ali  83  4VTAVIKPFKLDDVREALSEIGIQGVTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIEIAVDDDMIDQVIEAISKTANTGKIGDGKIFVTPLEQVIRIRTG 105
60 3.000e-54gi|53803646|ref|YP_114475.1| nitrogen regulatory protein P-II [Methylococcus capsulatus str. Bath]  clstr ali  77  4ITAIIKPFKLDDVREALSDIGVSGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKLEIAVADTLVDAAVDAIVKAANTGKIGDGKIFITSIDQAIRIRTG 105
61 3.000e-54gi|152990242|ref|YP_001355964.1| nitrogen regulatory protein P-II [Nitratiruptor sp. SB155-2]  clstr ali  64  4IEAVIKPFKLEDVKEALTEIGIIGMTVTEVKGYGRQQGHSELYRGAEYAVDFLPKIKIELVVSDENVDSCIDAIMNSARTGKIGDGKIFVSDIEKVVRIRTG 105
62 4.000e-54JCVI_PEP_1096698264283 /source_dna_id=JCVI_ORF_1096698264282 /offset=0 /translation_table=11 /length=169 /full_length=169  ali  96  60VTAIIKPFKLDDVRESLSEIGVQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIDVAIDDKDLDRVIEAITKAANTGKIGDGKIFVVNLEQAIRIRTG 161
63 4.000e-54gi|423075019|ref|ZP_17063738.1| nitrogen regulatory protein P-II [Desulfitobacterium hafniense DP7]  clstr ali  59  33IEAIVRPGKLDDVQSALDDFGVSGLTVTQVLGCGNQKGHTQVYRGVEYKVYLLPKVKIEVVVTDQDVDQVISIITQAARTGEVGDGKIFVYPVEEAIRIRTG 134
64 4.000e-54gi|334143769|ref|YP_004536925.1| nitrogen regulatory protein P-II [Thioalkalimicrobium cyclicum ALM1]  clstr ali  71  4ITAIIKPFKLDDVRDALHDIGIHGMTVTEVKGYGRQKGHTEMYRGAEYVVDFLPKLKLEIATDDEQVDSAIEVIVAAAQTGKIGDGKIFVTSIEQTVRIRTG 105
65 4.000e-54gi|375337363|ref|ZP_09778707.1| nitrogen regulatory protein P-II [Succinivibrionaceae bacterium WG-1]  clstr ali  73  4ISAIIKPFKLDDVREAISALGIDGMTVTEVKGFGRQKGHTELYRGAEYQVDFLPKVKLEVVVSDDSCDQVIEAIIKAARTGKIGDGKIFVYDCEHIVRIRTG 105
67 5.000e-54gi|183601073|ref|ZP_02962566.1| hypothetical protein PROSTU_04696 [Providencia stuartii ATCC 25827]  clstr ali  73  4IIAIIKPFKLDEVREALSDIGIQGLTMTEVRGFGRQKGHSELYRGAEYTVDFLPKVRLEIAVSDEFADLVIESIEKAANTGQVGDGKIFVLELEQAIRIRTG 105
68 5.000e-54gi|386827411|ref|ZP_10114518.1| nitrogen regulatory protein PII [Beggiatoa alba B18LD]  clstr ali  71  4IEAIIKPFRLDDVREALSNIGVTGMTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKLELIVASEQVEPCIDAIIQAARTGKIGDGKIFVTPVDKIIRIRTG 105
69 6.000e-54Oral.Meta HOMD mlot_c_1_51002 Mesorhizobium loti MAFF303099 [240177 - 239764] nitrogen regulatory protein P-II  ali  73  30IEAIIKPFKLDEVKEALQEAGLQGITVTEAKGFGRQKGHTELYRGAEYVVDFLPKVKIEVVLGDDAVEGAIEAIRKAAQTGRIGDGKIFVSNIEEVVRIRTG 131
70 6.000e-54gi|114321697|ref|YP_743380.1| nitrogen regulatory protein P-II [Alkalilimnicola ehrlichii MLHE-1]  clstr ali  76  4VEAIIKPFKLDDVREALSDIGITGMTVTEVKGFGRQKGHTELYRGAEYVVDFLPKMRLEVVIADDQVDRCLEVITKAAHTGKIGDGKIFVSDVERVIRIRTG 105
71 6.000e-54gi|352086176|ref|ZP_08953755.1| nitrogen regulatory protein P-II [Rhodanobacter sp. 2APBS1]  clstr ali  82  4VVAIIKPFKLDDVREALAEVGVQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKIKLEVAVADDQLDRVIEAIQSSARTGKIGDGKIFVSTLEQVIRIRTG 105
72 6.000e-54gi|84389773|ref|ZP_00991325.1| nitrogen regulatory protein P-II [Vibrio splendidus 12B01]  clstr ali  65  6IEAIIKPFKLDDVREALAEVGITGMTVSEVKGFGRQKGHTELYRGAEYMVDFLPKVKLEIVVTDEVADQCVDTIIETAQTGKIGDGKIFITDVERVVRIRTG 107
73 6.000e-54gi|83309794|ref|YP_420058.1| nitrogen regulatory protein PII [Magnetospirillum magneticum AMB-1]  clstr ali  71  18IEAIIKPFKLDEVKEALHEVGLQGLTVTEAKGFGRQKGHTELYRGAEYVVDFLPKVKIELVIEDNLVERAVEAIQQAAHTGRIGDGKIFISTVEEAIRIRTG 119
74 7.000e-54gi|354593801|ref|ZP_09011844.1| nitrogen regulatory protein P-II [Commensalibacter intestini A911]  clstr ali  69  5IEAIIKPFKLDEVKEALQEIGLQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIELVCSEDLVERAVDIIMHTARTGRIGDGKIFVMPVENAIRIRTG 106
75 7.000e-54gi|188996994|ref|YP_001931245.1| nitrogen regulatory protein P-II [Sulfurihydrogenibium sp. YO3AOP1]  clstr ali  67  4IEAIIKPFKLDEVKDALTNIGIYGMTVTEAKGFGRQKGHTELYRGAEYVIDFLPKLKIEVVVDDAQVEKVVEAIMQAARTGRIGDGKIFIIPIEDVIRIRTG 105
76 7.000e-54gi|373853802|ref|ZP_09596601.1| nitrogen regulatory protein P-II [Opitutaceae bacterium TAV5]  clstr ali  67  4IIAIIKPFKLENVKEALSGIGIEGMTITEVKGFGRQKGHTEIYRGSEYTVDFLPKTKIEIVVSDDMLDKAINAILQAAKTGKIGDGKIFVLPIEEAVRIRT. 104
77 7.000e-54gi|118578924|ref|YP_900174.1| nitrogen regulatory protein P-II [Pelobacter propionicus DSM 2379]  clstr ali  69  4IEAIIKPFKLDEVKDALNEIGIEGITVSEVKGFGRQKGHTELYRGAEYVVDFIPKIKLEIAVSDDLLGKVIETIQTTARTGRIGDGKIFVLPLEDAVRIRTG 105
78 7.000e-54gi|162146351|ref|YP_001600810.1| nitrogen regulatory protein [Gluconacetobacter diazotrophicus PAl 5]  clstr ali  66  4IEAIIKPFKLDEVKDALHEIGLMGITVTEAKGFGRQKGHTELYRGAEYIVDFLPKVKLEIVCADNLVDRAVETIMAAARTGRIGDGKIFILPVEDVIRIRTG 105
79 7.000e-54gi|34497500|ref|NP_901715.1| nitrogen regulatory protein P-II-1 [Chromobacterium violaceum ATCC 12472]  clstr ali  74  4VEAIIKPFKLDEVREALSEIGINGLTVSEVKGFGRQKGHTELYRGAEYVVDFLPKVKIEVVLPDDLVERAIETIVETARTGKIGDGKIFVVPVEQVVRIRTG 105
80 7.000e-54gi|410635226|ref|ZP_11345841.1| nitrogen regulatory protein P-II 1 [Glaciecola lipolytica E3]  clstr ali  73  4IEAIIKPFKLDDVRASLTEAGVSGLTVTEVKGYGRQKGHTETYRGAEYNVDFLPKVKIEVVVPDADVDRCIEAIMEVAATGKIGDGKIFVTPVAQAIRIRTG 105
81 7.000e-54JCVI_PEP_1096672834661 /source_dna_id=JCVI_ORF_1096672834660 /offset=0 /translation_table=11 /length=172 /full_length=172  ali  70  63IEAIIKPFKLDEVKEALHEVGIQGITVLEAKGFGRQKGHTELYRGAEYVVDFLPKVKIEVVVEESLSERVVDAIQQAAQTGRIGDGKIFISTIDEAIRIRTG 164
82 8.000e-54gi|303257763|ref|ZP_07343775.1| nitrogen regulatory protein P-II [Burkholderiales bacterium 1_1_47]  clstr ali  74  4VVAIIKPFKLDEVREALAEIGVQGMTVTEVKGFGRQKGHTELYRGAEYVVDFLPKMKIECVVDDSLVNMAVEAIMKTARTNKIGDGKIFVMPVEEVIRIRTG 105
83 8.000e-54gi|254468211|ref|ZP_05081617.1| nitrogen regulatory protein P-II [beta proteobacterium KB13]  clstr ali  70  4IDAIIKPFKLDEVREALAEVGIEGLTVTEVKGFGRQKGHTELYRGAEYVIDFLPKMKLEIVVSDKMVDKVIETIKNTAHTGKIGDGKIFVSPVEKAIRIRT. 104
84 8.000e-54JCVI_PEP_1096677668385 /source_dna_id=JCVI_ORF_1096677668384 /offset=0 /translation_table=11 /length=176 /full_length=176  ali  86  67VTAIIKPFKLDDVRESLSEIGVQGMTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIEVAIDDGQLDSVVEAISKAANTGKVGDGKIFVAGLDEVVRIRTG 168
85 9.000e-54JCVI_PEP_1096696580405 /source_dna_id=JCVI_ORF_1096696580404 /offset=0 /translation_table=11 /length=159 /full_length=159  ali  82  50VTAVIKPFKLDDVREALSTIGVQGITVSEVKGFGRQKGHTELYRGAEYVVDFLPKVKIDIAIADGMVDQTIEAISKAAQTGKIGDGKIFVSSLEHVTRIRTG 151
86 9.000e-54gi|289209197|ref|YP_003461263.1| nitrogen regulatory protein P-II [Thioalkalivibrio sp. K90mix]  clstr ali  67  4IEAIIKPFKLEDVREALTEMGIAGMTATEVQGFGRQKGHTELYRGAEYVVDFLPKVKLELVVDDDRVDACIDAIVKASRTGKIGDGKIFVSDMARVVRIRTG 105
87 9.000e-54gi|306843879|ref|ZP_07476474.1| nitrogen regulatory protein P-II [Brucella inopinata BO1]  clstr ali  73  42IEAIIKPFKLDEVKEALQEVGLQGITVIEAKGFGRQKGHTELYRGAEYVVDFLPKVKVEVIVADETADSAIEAIRKAAQTGRIGDGKIFVSNIEEVIRIRTG 143
88 1.000e-53gi|389872169|ref|YP_006379588.1| nitrogen regulatory protein [Advenella kashmirensis WT001]  clstr ali  78  4ITAIIKPFKLDEVRESLADIGVSGLTVAEVKGFGRQKGHTELYRGAEYVVDFLPKVRVEVVISDSLVDSAIEAIIKAARTGKIGDGKIFVTPVERAIRIRTG 105
89 1.000e-53gi|114328800|ref|YP_745957.1| nitrogen regulatory protein GlnK [Granulibacter bethesdensis CGDNIH1]  clstr ali  73  41IVAVIKPFKLDDVREALTPLGVQGLTVTEVKGFGRQKGQTEIYRGAEYHVSFLPKVKIEVAVPASLAEQVVEAIMKAANTGKIGDGKIFVLDIERAVRIRTG 142
90 1.000e-53gi|90019883|ref|YP_525710.1| nitrogen regulatory protein P-II [Saccharophagus degradans 2-40]  clstr ali  74  4ITAVIKPFKLDDVRNALSEIGVQGMTVTEVKGFGRQKGHTELYRGAEYVIDFLPKVKLELVLGDELIDQAVEAISKAAQTGKIGDGKIFITPCEEVIRIRTG 105
91 1.000e-53gi|192361217|ref|YP_001983844.1| Nitrogen regulatory protein P-II [Cellvibrio japonicus Ueda107]  clstr ali  75  4ITAVVKPFKLDDVRTALSDVGVQGMTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIELAVDDSMVEQAVEAITKAAQTGKIGDGKIFISPLDEIIRIRTG 105
92 1.000e-53Oral.Meta HOMD lmir_c_3_1379 Lautropia mirabilis ATCC 51599 [327269 - 326898] nitrogen regulatory protein P-II  ali  77  16ITAIIKPFKLDEVREALAAVGVTGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKLKIDVVVSDENLDAVIDAIVKAARTGRIGDGKIFVRSVEQVIRIRTG 117
93 1.000e-53Oral.Meta HOMD axyl_c_1_38864 Achromobacter xylosoxidans A8 [2414925 - 2414533] nitrogen regulatory protein P-II  ali  74  23IIAIIKPFKLDEVRVALSGIGVQGLTVTEVKGFGRQKGHTELYRGAEYAVDFLPKLRVEAAVPDHLVDQVIEAIEQAARTGKIGDGKIFAAPLEQVIRIRTG 124
94 1.000e-53gi|422350583|ref|ZP_16431467.1| nitrogen regulatory protein P-II [Sutterella wadsworthensis 2_1_59BFAA]  clstr ali  75  4IVAIIKPFKLDEVREALADVGVNGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKLKIEAVVADDILEQAIEAIRKAAYTGKIGDGKIFVYEVEQAIRIRTG 105
95 1.000e-53Oral.Meta HOMD smal_c_1_473 Stenotrophomonas maltophilia R551-3 [134098 - 134490] nitrogen regulatory protein P-II  ali  74  23ISAIIRPFKLDEVREALSDAGVSGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKIKIETVVTDERADAVIEAIQSSAGTGKIGDGKIFVTAVEQVIRIRTG 124
96 1.000e-53gi|410630146|ref|ZP_11340838.1| nitrogen regulatory protein P-II 1 [Glaciecola arctica BSs20135]  clstr ali  69  4IEAVIKPFKMDDVREALSDVGVSGMTVTEVKGFGRQKGHTELYRGAEYNVDFLPKVKVELIVANEQVDRCVEAIMNTAKTGKIGDGKIFVYDVERVIRIRTG 105
97 1.000e-53gi|254515507|ref|ZP_05127567.1| nitrogen regulatory protein P-II [gamma proteobacterium NOR5-3]  clstr ali  81  25ITAIIKPFKLDDVRSALAEVGVQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKVEVAVGDDQLDTSVEAIVSAADTGKIGDGKIFVSSLEQVIRIRT. 125
98 2.000e-53JCVI_PEP_1096676354425 /source_dna_id=JCVI_ORF_1096676354424 /offset=0 /translation_table=11 /length=150 /full_length=150  ali  81  41VTAIVKPFKSDDVREALSEIGISGMTLTEVKGFGRQKGHTELYRGAEYVIDFLPKAKIEVAVEDGIVDQVIEAICKAANTGQIGDGKIFVSNLEQTIRIRTG 142
99 2.000e-53gi|375335564|ref|ZP_09776908.1| nitrogen regulatory protein PII [Succinivibrionaceae bacterium WG-1]  clstr ali  67  4ISAIIKPFKLDEVREALSAKGISGLTVSEVKGFGRQKGHTELYRGAEYVVDFLPKIKLEIVVKDEDVDACIDAIVHGAHTGKIGDGKIFVSSVERVIRVRTG 105
100 2.000e-53gi|90019881|ref|YP_525708.1| nitrogen regulatory protein P-II [Saccharophagus degradans 2-40]  clstr ali  80  4ITAVIKPFKLDAVREALSEIGVQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKTKLEVAVADNQVDSVVETISKAAHSGKIGDGKIFVSALEQVIRIRTG 105
101 2.000e-53gi|149911060|ref|ZP_01899688.1| nitrogen regulatory protein P-II [Moritella sp. PE36]  clstr ali  70  4IEAIIKPFKLDDVREALAEIGITGMTVSEVKGFGRQKGHTELYRGAEYMVDFLPKVKLDLIVQDDDVDACIDSIVETAHTGKIGDGKIFVTAVERVIRIRTG 105
102 2.000e-53gi|292490722|ref|YP_003526161.1| nitrogen regulatory protein P-II [Nitrosococcus halophilus Nc4]  clstr ali  74  4IEAIIKPFKLDDVREALSEIGVSGMTAIEVKGFGRQKGHTELYRGAEYVVDFLPKIMLEIVVGDDQVDACIEAITKAAQSGRIGDGKIFVTNVERAVRIRTG 105
103 2.000e-53gi|302878074|ref|YP_003846638.1| nitrogen regulatory protein P-II [Gallionella capsiferriformans ES-2]  clstr ali  71  4IEAVIKPFKLDEVREALSELNISGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKIKVEIVVSSEMLDTAVEAIIKAAHTGKIGDGKIFVSTVEQVIRIRTG 105
104 2.000e-53gi|296113748|ref|YP_003627686.1| nitrogen regulatory protein P-II [Moraxella catarrhalis RH4]  clstr ali  78  4ISAIIKPFKLDDVREALSEIGVNGITVTEVKGFGRQKGHTEMYRGAEYVVDFLPKIKIEIACRDEMVDSIIESIIKVANTGKIGDGKIFVSPLERVIRIRTG 105
105 2.000e-53gi|407717299|ref|YP_006838579.1| Regulatory protein, P-II 2 [Cycloclasticus sp. P1]  clstr ali  78  4ITAIIKPFKLEDVREALSAAGFEGITVTEVKGFGRQRGHTELYRGAEYVVDFLPKVKLEIAVSTEQLDSAIDAIINAANTGKIGDGKIFVTNLERAIRIRTG 105
106 2.000e-53gi|332139893|ref|YP_004425631.1| nitrogen regulatory protein P-II [Alteromonas macleodii str. `Deep ecotype`]  clstr ali  75  4VTAIIKPFKLDDVREAISEIGIDGLTVTEVKGFGRQKGHTELYRGAEYQVDFLPKVKLEIAVQDDQVERLVEAIVGAAKTGKIGDGKVFVYDLEHAVRIRTG 105
107 2.000e-53gi|163782166|ref|ZP_02177165.1| nitrogen regulatory PII protein [Hydrogenivirga sp. 128-5-R1-1]  clstr ali  63  15IEAIIKPFKLDEVKDALVEIGIGGMTVTEVKGFGQQKGHTEIYRGTEYVIDFLPKVKIEVVVKDEDVEKVLDTIVKTAQTGRVGDGKIFVLPVEEVVRIRTG 116
108 2.000e-53gi|422349561|ref|ZP_16430451.1| nitrogen regulatory protein P-II 1 [Sutterella wadsworthensis 2_1_59BFAA]  clstr ali  70  4IIAVIKPFKLDDVREALADCGVSGLTATEVKGFGRQKGHTELYRGAEYVVDFLPKIKLEIAVSDELCDKVVESIASAANTGRIGDGKIFVMDLEHVMRIRTG 105
109 2.000e-53gi|27375723|ref|NP_767252.1| nitrogen regulatory protein PII [Bradyrhizobium japonicum USDA 110]  clstr ali  70  25VMAIIKPFKLEEVRDALTAIGVHGLTVTEVKGYGRQKGHTEIYRGAEYAVSFLPKIKIEVAVASDQVDKTIDAITSAAKTGQIGDGKIFVINLDHAVRIRTG 126
110 2.000e-53gi|85711218|ref|ZP_01042278.1| Nitrogen regulatory protein PII [Idiomarina baltica OS145]  clstr ali  65  4ITALIKPFKLDDVRQALADIGCTGMTIAEVRGFGRQKGHTELYRGAEYRVDFLPKIRLELAVSDDQLERAVEVISEAAHTGNIGDGKIFVTHLEHCVRIRTG 105
111 3.000e-53gi|381204917|ref|ZP_09911988.1| nitrogen regulatory protein P-II [SAR324 cluster bacterium JCVI-SC AAA005]  clstr ali  73  4VEAIIKPFKLEEVKDSLHAAGIQGLTVSEVKGFGRQKGHTELYRGAEYIVDFLPKVKIEIVLSDDQVENAIEAILNAAKTGRIGDGKIFVVNLDQAIRIRTG 105
113 3.000e-53gi|288940532|ref|YP_003442772.1| nitrogen regulatory protein P-II [Allochromatium vinosum DSM 180]  clstr ali  71  4VEAIIKPFKLDDVREALSAAGITGMTAIEVKGFGRQKGHTELYRGAEYVVDFLPKVKIELVLADDQVEECINAITTAARTGKIGDGKIFVSDVTRVVRIRTG 105
114 3.000e-53gi|119387166|ref|YP_918221.1| nitrogen regulatory protein P-II [Paracoccus denitrificans PD1222]  clstr ali  72  4VEAIIKPFKLDDVKEALQEVGVQGLSVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIEMVLPDDLVEAAVDAIISAARTEKIGDGKIFILPVEQAIRIRTG 105
115 3.000e-53gi|383317252|ref|YP_005378094.1| nitrogen regulatory protein PII [Frateuria aurantia DSM 6220]  clstr ali  75  20ITAIIKPFTLDDVREALGEAGINGMTVTEVKGFGRQHGHTELYRGAEYVVDFLPKLKIEIAATDEQAERAIEAISTAARTGKVGDGKIFVIDLEQAIRIRT. 120
116 3.000e-53JCVI_PEP_1096684053179 /source_dna_id=JCVI_ORF_1096684053178 /offset=0 /translation_table=11 /length=173 /full_length=173  ali  59  64IEAIIRHFKLEEVKDALNAQGIKGMTVTEVRGFGRQKGHTETYRGAEYSVDFLPKVKVEVVVSDEEAQGVIGKIMNTARTGQVGDGKIFVTNLAEVVRIRTG 165
117 3.000e-53gi|323137777|ref|ZP_08072853.1| nitrogen regulatory protein P-II [Methylocystis sp. ATCC 49242]  clstr ali  71  4ITAIIKPFKLDEVREALTELGVHGMTATEVKGYGRQKGHAEIYRGAEYIVSFLPKVKIEIAIGDELVDRAIEAIKTAAHTGHIGDGKIFVTPLERALRIRTG 105
118 4.000e-53gi|389795828|ref|ZP_10198937.1| nitrogen regulatory protein PII [Rhodanobacter fulvus Jip2]  clstr ali  78  4ITAIIKPFTLDSVHEALSEAGVQGMTVTEVKGFGRQRGHTELYRGAEYVVDFLPKLKVEVAVADEQLEQVIEAISGAARTGKIGDGKVFVSDLEQAIRIRT. 104
119 4.000e-53gi|121999184|ref|YP_001003971.1| nitrogen regulatory protein P-II [Halorhodospira halophila SL1]  clstr ali  82  4VTAIIKPFKLDDVREALSAIGVQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKMKLEVAIDDSLVDRACDAIRQAANSGKIGDGKIFVFDVEQAIRIRTG 105
120 4.000e-53gi|323702014|ref|ZP_08113683.1| nitrogen regulatory protein P-II [Desulfotomaculum nigrificans DSM 574]  clstr ali  52  4IEAIIRPGKLEEVKDALNKLGIHGMTVSQVIGCGHQKGRTEVYRGAEYSINLLPKVKVEVVVRDQWVDQCVMAISEAARSGEIGDGKIFVYPLSDVIRIRTG 105
121 4.000e-53gi|261856930|ref|YP_003264213.1| nitrogen regulatory protein P-II [Halothiobacillus neapolitanus c2]  clstr ali  79  4VTAIIKPFKLDDVREALSTIGVKGITMTEVKGFGRQKGHTELYRGAEYVVDFLPKVKLEMVVDDATVEPVIDAITKAASTGKIGDGKIFVSTIEEAIRIRTG 105
122 4.000e-53gi|198282731|ref|YP_002219052.1| nitrogen regulatory protein P-II [Acidithiobacillus ferrooxidans ATCC 53993]  clstr ali  73  4IEAIIKPFKLDDVREALQELGLAGMTVTEVKGFGRQKGHTELYRGAEYVVDFLPKLKLEVVVSDEMADRAIEAIEQAARTGKIGDGKIFVGSVERVIRIRTG 105
123 4.000e-53gi|260893721|ref|YP_003239818.1| nitrogen regulatory protein P-II [Ammonifex degensii KC4]  clstr ali  52  4IEAIIRPEKLEAVKDSLGKFGIHGMTVYQVMGCGTQRGWTEVYRGREYSINLLPKVKVEIAVPDHQVEEVVKLILEVARTGEIGDGKIFVSNLEDAVRVRTG 105
124 5.000e-53gi|90408471|ref|ZP_01216630.1| Putative nitrogen regulatory protein P-II [Psychromonas sp. CNPT3]  clstr ali  66  4IEAIIKPFKMDDVREALADIDITGMTVSEVKGFGRQKGHTELYRGAEYMVDFLPKVKIELVVKKEDVERCIEVIMQTAQTGKIGDGKIFVMPVERVIRIRTG 105
125 5.000e-53gi|238754249|ref|ZP_04615606.1| Nitrogen regulatory protein P-II 2 [Yersinia ruckeri ATCC 29473]  clstr ali  76  57VTVVIKPFKLEDVREALSSIGIQGLTVTEVKGFGRQKGHAELYRGAEYSVNFLPKVKIDIAIADDQLDEVVDVISKAAYTGKIGDGKIFVAELQRVIRIRTG 158
127 6.000e-53gi|117924276|ref|YP_864893.1| nitrogen regulatory protein P-II [Magnetococcus marinus MC-1]  clstr ali  70  4VEAIIKPFKLDDVKEALAEVGIQGITVSEVRGFGRQKGHTELYRGAEYVVDFLPKLKVEVVLTDDHVERAVEAIENAARTGRIGDGKIFVSPVDTAIRIRTG 105
128 6.000e-53gi|393759474|ref|ZP_10348289.1| nitrogen regulatory protein P-II [Alcaligenes faecalis subsp. faecalis NCIB 8687]  clstr ali  69  4ITAIVKPFKVDEIREALSDLGIQGMTLTEVKGFGRQKGHTELYRGAEYAVDFLPKIRIELAIPDEQLPSVLEAIQSSARTGRIGDGKIFVQPLDHVIRIRTG 105
129 6.000e-53gi|52840829|ref|YP_094628.1| nitrogen regulatory P-II transcription regulator [Legionella pneumophila subsp. pneumophila str. Philadelphia 1]  clstr ali  72  16ITAIIKPFKLDDVHEALMEIGVPGITISETRGFGRQKGHTELYRGAEYVVDFLPKIKIELALPDNMVEAAIEAICKSAYTGKIGDGKIFVYALEQVVRVRTG 117
130 6.000e-53gi|149194696|ref|ZP_01871791.1| nitrogen regulatory protein P-II-1 [Caminibacter mediatlanticus TB-2]  clstr ali  70  4IEAIIKPFKLDDVKEALFEIGISGITVSEVKGHGRQQGHTELYRGAEYVVDFLPKVKIELVVKEEDVERVIETISKSARTGKIGDGKIFVLPVEKVIRIRTG 105
131 6.000e-53gi|408421726|ref|YP_006763140.1| nitrogen regulatory protein PII GlnB2 [Desulfobacula toluolica Tol2]  clstr ali  66  4IEAIIKPFKLDDVKEALSEIGIYGMTVTEVNGYGRQKGHKEIYRGAEYVVDFVPKIKIEIVVSDERLDEAVETVRNAANTGKIGDGKIFILPVEQVVRVRTG 105
132 7.000e-53gi|325294233|ref|YP_004280747.1| nitrogen regulatory protein P-II [Desulfurobacterium thermolithotrophum DSM 11699]  clstr ali  62  4IEAIIKPFKLDEVKDALTEIGITGMTISEVKGFGRQKGHTELYRGAEYVIDFIPKIKLEVIVPDESVEKVVEVIVNSAKTGRIGDGKIFILSVEDAVRIRTG 105
133 7.000e-53gi|182678202|ref|YP_001832348.1| nitrogen regulatory protein P-II [Beijerinckia indica subsp. indica ATCC 9039]  clstr ali  65  4IEAVIKPFKLDEVKDALHAAGVSGLTVTEAKGFGRQKGHTELYRGAEYIVDFLPKVKVEVIVPDSFVEGVVDAIRKAARTGRIGDGKIFISSIEDVVRIRTG 105
134 8.000e-53gi|71280408|ref|YP_267391.1| nitrogen regulatory protein P-II [Colwellia psychrerythraea 34H]  clstr ali  77  4ISAIIKPFKLDDVREAISEVGVEGITVSEVKGFGRQKGHTELYRGAEYQVDFLPKVKIEIAVNEELVERLVEAITKSAYTGKIGDGKIFVYNLEQAIRIRTG 105
135 8.000e-53gi|372272468|ref|ZP_09508516.1| P2-like signal transmitter protein [Marinobacterium stanieri S30]  clstr ali  79  4ISAIIKPFKLDDVREALSDIGVQGITVTEVKGFGRQKGHTELYRGAEYIVDFLPKVRIDAAVADDIVDQVLEAISKASHTGKIGDGKIFVTPLEQVVRIRTG 105
136 8.000e-53gi|145588868|ref|YP_001155465.1| nitrogen regulatory protein P-II [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1]  clstr ali  73  4ITSIIKPFKLDEVREALAEVGVTGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKVEAVVPSDRVEAALEAITKAARTGKIGDGKIFVTPVEQVIRIRTG 105
137 9.000e-53gi|337287537|ref|YP_004627010.1| nitrogen regulatory protein P-II [Thermodesulfatator indicus DSM 15286]  clstr ali  67  4IEAIIKPFKLEEVKEALAEIGVKGMTVSEVKGFGRQKGHREIYRGAEYIVDFLPKVKIELVLEDELVEKVVETIINSARTGKIGDGKIFIIPVEDAIRIRTG 105
138 9.000e-53gi|118580102|ref|YP_901352.1| nitrogen regulatory protein P-II [Pelobacter propionicus DSM 2379]  clstr ali  70  4IDAIIKPFKLDEVKEALNEIGIQGITVSEVKGFGRQKGHTELYRGAEYVVDFIPKIKLEIIVSDDMLPKVVEAIEKAAKTGRIGDGKIFVTPVEAVVRIRTG 105
139 9.000e-53gi|323144239|ref|ZP_08078870.1| nitrogen regulatory protein P-II [Succinatimonas hippei YIT 12066]  clstr ali  70  4IVAIIKPFKLDDVREALSANGISGMTVSEVKGFGRQKGHTELYRGAEYVVDFLPKAKLELVVKDEDVDVCIEAIIKGAHTGKIGDGKIFVSDIERVVRIRTG 105
140 9.000e-53gi|71278680|ref|YP_270575.1| nitrogen regulatory protein P-II [Colwellia psychrerythraea 34H]  clstr ali  67  4IEAIIKPFKMDDVREALGEIGVTGMTVSEVKGFGRQKGHTELYRGAEYMVDFLPKVKLEIVIAKEDVERCVNAILETAQTGKIGDGKIFITDVERVIRIRTG 105
141 9.000e-53gi|253998621|ref|YP_003050684.1| nitrogen regulatory protein P-II [Methylovorus glucosetrophus SIP3-4]  clstr ali  78  4IEAIIKPFKLDEVREALSEIGVNGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKIKVELIIADSLLDAAMEAIIKAARTGKIGDGKIFVSNVEQVVRIRTG 105
142 9.000e-53gi|163796430|ref|ZP_02190390.1| nitrogen regulatory protein GlnK [alpha proteobacterium BAL199]  clstr ali  69  4VMAIIKPFKLDEVRESLTALGIQGLTVSEVKGFGRQKGQTEIYRGAEYSVNFLPKVKVEVVVSDDLVTSVVEAIQKSANTGRIGDGKIFVLDVSQAVRIRTG 105
143 1.000e-52gi|74316826|ref|YP_314566.1| nitrogen regulatory protein P-II [Thiobacillus denitrificans ATCC 25259]  clstr ali  74  4IEAIIKPFKLDEVREALSEIGVTGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKLEVVVADNLVERVTEAVVNAARTGKIGDGKIFVTAVEQVVRIRTG 105
144 1.000e-52gi|167646814|ref|YP_001684477.1| nitrogen regulatory protein P-II [Caulobacter sp. K31]  clstr ali  69  4IEAIIKPFKLDEVKEALQDMGVQGMTVLEAKGYGRQKGHTELYRGAEYVVDFLPKIKVEVVVEDSQLEPALEAITNAARTGRIGDGKIFVSEITEVVRIRTG 105
145 1.000e-52gi|410637331|ref|ZP_11347911.1| nitrogen regulatory protein P-II 1 [Glaciecola lipolytica E3]  clstr ali  69  4IEAIIKPFKMENVREALSEIGVSGMTVTEVKGFGRQKGHSELYRGAEYHVGFLPKHKIDLVVPDDLVERAIEVILDNARTGKIGDGKIFVSDIERAIRIRTG 105
146 1.000e-52gi|408373471|ref|ZP_11171167.1| nitrogen regulatory protein P-II [Alcanivorax hongdengensis A-11-3]  clstr ali  75  5.TAVIKPFKVDDVRDALAQVGIQGMTVTEVKGFGRQKGHTELYRGAEYVVDFVPKVKLELAVREELLDQAIEAILKSAATGKIGDGKIFVSDLEQAIRIRTG 105
148 1.000e-52gi|118595151|ref|ZP_01552498.1| Nitrogen regulatory protein P-II (GlnB, GlnK) [Methylophilales bacterium HTCC2181]  clstr ali  70  4IEAIIKPFKLDEVREALSEIDIMGLTATEVKGFGRQKGHTELYRGAEYVVDFLPKIRLDLVVADKMVEKVVETILKTAHTGKIGDGKIFVMDVEEAIRIRTG 105
149 1.000e-52gi|170725543|ref|YP_001759569.1| nitrogen regulatory protein P-II [Shewanella woodyi ATCC 51908]  clstr ali  77  4ITAIIKPFKLDDVREALSSLGVQGLTVTEVKGFGRQKGHAELYRGAEYSVDFLPKIKLEIAISSGHEDEVIEAIINAANTGKIGDGKIFVSPLEQVVRIRT. 104
150 1.000e-52gi|146291920|ref|YP_001182344.1| nitrogen regulatory protein P-II [Shewanella putrefaciens CN-32]  clstr ali  73  28VTTIIKPFKLDDVREALTQLGINGMTVTEVRGFGRQKGHTELYRGAEYAVDFLPKIKLEMAIHTEQEDAVIEAIMTAAHTGKVGDGKIFVTDLEQVVRIRT. 128
151 1.000e-52gi|149178335|ref|ZP_01856927.1| nitrogen regulatory protein P-II (GlnB, GlnK) [Planctomyces maris DSM 8797]  clstr ali  61  4VEAVIRHFKLEEVKDALTEIGVQGMTVSEVRGFGRQKGHKEQYRGAEYTVDFLPKAKMEVIVPDDQVKAVVDTILESARTGQIGDGKIFVLPIEDIIRIRTG 105
152 1.000e-52gi|345863959|ref|ZP_08816165.1| nitrogen regulatory protein P-II [endosymbiont of Tevnia jerichonana (vent Tica)]  clstr ali  74  4VEAIIKPFKLEDVREALSAEGITGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIEVVVAEAAVQSCIEAITNAARTGKIGDGKIFVSPVEKVIRIRTG 105
153 1.000e-52gi|365857897|ref|ZP_09397870.1| nitrogen regulatory protein P-II [Acetobacteraceae bacterium AT-5844]  clstr ali  69  7IEAIIKPFKLDEVKDALHEIGLQGLTVVEAKGFGRQKGHTELYRGAEYVVDFLPKVKIEVVCSDDLAERAIEAIQAAARTGRIGDGKIFVSDIHEVIRIRTG 108
154 1.000e-52gi|344942574|ref|ZP_08781861.1| nitrogen regulatory protein P-II [Methylobacter tundripaludum SV96]  clstr ali  79  4ITAIIKPFKMDDVREALSEIGVAGVTATEVKGFGRQKGHTELYRGAEYVVDFLPKVKLEIAVADDVLDKAVETIVNAANTGKIGDGKIFVSNLEQVIRIRTG 105
155 1.000e-52gi|237745824|ref|ZP_04576304.1| nitrogen regulatory P-II protein [Oxalobacter formigenes HOxBLS]  clstr ali  76  4ITAIIKPFKLDEVREALSDANINGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIEVVVDDSVLELAIEAILKSARTGKIGDGKIFVQDIEQVIRIRTG 105
156 1.000e-52gi|338983165|ref|ZP_08632391.1| Nitrogen regulatory protein P-II [Acidiphilium sp. PM]  clstr ali  73  50IEAIIKPFKLDEVKEALHEVGLQGITVMEAKGFGRQKGHTELYRGAEYVVDFLPKVKIEVICEDAVAERAIEAITNAARTGRIGDGKIFVSTIEEVIRIRTG 151
157 1.000e-52gi|46201079|ref|ZP_00055775.2| COG0347: Nitrogen regulatory protein PII [Magnetospirillum magnetotacticum MS-1]  clstr ali  71  4IMAIIKPFKLDEVREALTPLGVQGLTVSEVKGFGRQKGQTEIYRGAEYVVNFLPKVKIEVAVNDDLVDRVVEAIQTAARTGKIGDGKVFVTEIQQAYRIRTG 105
158 1.000e-52gi|378827767|ref|YP_005190499.1| Nitrogen regulatory protein P-II [Sinorhizobium fredii HH103]  clstr ali  64  29VMAIIKPFKLDEVREALTTVGIQGLTVTEVKGYGRQKGHTEIYRGTEYAVSFLPKLKIEIAVPSEIVDKAVDAIASAAKTGQIGDGKIFVYSIDHAVRIRTG 130
159 2.000e-52gi|88857989|ref|ZP_01132631.1| regulatory protein (P-II) for nitrogen assimilation by glutamine synthetase (ATase) [Pseudoalteromonas tunicata D2] :_  clstr ali  70  4IEAIIKPFKLDDVREALSEIDITGMTVCEVKGFGRQKGHTELYRGAEYMVDFLPKVKLDIVLADEDVDRAIDVIIKTAQTGKIGDGKIFVTDIERVVRIRTG 105
160 2.000e-52gi|374336873|ref|YP_005093560.1| Nitrogen regulatory protein P-II [Oceanimonas sp. GK1]  clstr ali  70  4ICAIIKPFKLDDVRSALAGMGIDGMTVTEVKGFGRQKGHTELYRGAEYQVDFLPKIKLEIAAQSEDVERVIETITEAAGTGKIGDGKIFVYDLQQAVRIRTG 105
161 2.000e-52Oral.Meta HOMD vpara_c_1_7662 Variovorax paradoxus S110 [2525625 - 2526014] nitrogen regulatory protein P-II  ali  69  22ITAIVKPFKLEDVREALAEVGVTGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKMKVEVVVNEGDVERCIEAIVNSARTGKIGDGKIFVTGVERIVRIRTG 123
162 2.000e-52gi|307543689|ref|YP_003896168.1| nitrogen regulatory protein P-II 2 [Halomonas elongata DSM 2581]  clstr ali  77  4ITAVIKPFKLDDVREALADNGVQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKVEVAVDDDRLDTVLDAICNAANSGKIGDGKVFVTPLEDVIRIRTG 105
163 2.000e-52gi|163784539|ref|ZP_02179398.1| nitrogen regulatory protein P-II [Hydrogenivirga sp. 128-5-R1-1]  clstr ali  66  4IEAIIKPFKLDEVKEAITELGNFGITITEVKGFGRQKGHTELYRGAEYVIDFLPKIKLEIVVEDEMVEKLVEAITNAAKTGKVGDGKIFILPVEDAVRIRTG 105
164 2.000e-52gi|254446996|ref|ZP_05060463.1| nitrogen regulatory protein P-II [gamma proteobacterium HTCC5015]  clstr ali  67  4IEAVIKPFKLDDVRDALADIGVSGMTVTEVKGFGRQKGHTETYRGAEYVVDFLPKLKLEIVVAEKDADACVESITNAAKTGQIGDGKIFVSDVERTIRIRTG 105
165 2.000e-52gi|258545613|ref|ZP_05705847.1| nitrogen regulatory protein P-II [Cardiobacterium hominis ATCC 15826]  clstr ali  75  4ITAIIKPFKLDDVREALSDIGVQGITVTEVKGFGRQKGHTELYRGAEYVIDFLPKLKLEIAVSDDLAAQVIETIRDTANSGKIGDGKIFVTSLERVVRIRTG 105
166 2.000e-52gi|289207381|ref|YP_003459447.1| nitrogen regulatory protein P-II [Thioalkalivibrio sp. K90mix]  clstr ali  74  4ITAVIKPFKLDDVREAISEIGVQGMTMTEVKGFGRQRGHTELYRGAEYVVDFLPKVKLEVAVDENLVDQVVEAISKSASTGKIGDGKIFITPVEQVVRIRTG 105
167 2.000e-52gi|427402449|ref|ZP_18893446.1| nitrogen regulatory protein P-II [Massilia timonae CCUG 45783]  clstr ali  78  4ITAIIKPFKLDEVREALSEINVQGMTVTEVKGFGRQKGHTELYRGAEYVVDFLPKIKIEAAVDDAVVDQVIDAIQGAARTGKIGDGKIFVADLNQVIRIRTG 105
168 2.000e-52gi|334339371|ref|YP_004544351.1| nitrogen regulatory protein P-II [Desulfotomaculum ruminis DSM 2154]  clstr ali  50  4IEAVIRSSKLEEVKEALNEYGIQGMTVSQVMGCGKQKGRVSVYRGQEYTINLLPKIKLEIVLRDHQVDEVVELIAKVARTGEVGDGKIFIYPVANAIRIRTG 105
169 2.000e-52gi|74316258|ref|YP_313998.1| nitrogen regulatory protein P-II [Thiobacillus denitrificans ATCC 25259]  clstr ali  81  4VTAIIKPFKLDEVREALSAIGVTGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKLEVAIKADLLERVIEAIEHAANTGKIGDGKIFVSSLEQVVRIRTG 105
170 2.000e-52gi|121603037|ref|YP_980366.1| nitrogen regulatory protein P-II [Polaromonas naphthalenivorans CJ2]  clstr ali  79  4VTAIIKPFKLDEVREALSGMGVQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIEAAVPDELVDRVIEAIETSARTGKIGDGKVFVYDLEQVVRIRTG 105
171 2.000e-52gi|222054915|ref|YP_002537277.1| nitrogen regulatory protein P-II [Geobacter daltonii FRC-32]  clstr ali  69  4IEAIIKPFKLDEVKNALSEVGIEGITVTEVKGFGRQKGHTELYRGAEYVVDFIPKVKLEIVVADELVAKVIETIAESAKTGRIGDGKIFVLPLEEALRIRTG 105
172 2.000e-52gi|345864929|ref|ZP_08817124.1| nitrogen regulatory protein P-II [endosymbiont of Tevnia jerichonana (vent Tica)]  clstr ali  77  4ISAIIKPFKLDDVREALSDIGVTGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKIKVEIAVDDGVVDQVLEAISGAAKTGKIGDGKIFVMPLEQAVRVRTG 105
173 2.000e-52gi|53803783|ref|YP_114563.1| nitrogen regulatory protein P-II [Methylococcus capsulatus str. Bath]  clstr ali  83  4VTAILKPFKLDDVREALSEVGITGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKLEVAITDDQLEAVIDAITKTANTGKIGDGKIFVADLEQVVRIRTG 105
174 2.000e-52gi|304311063|ref|YP_003810661.1| P2-like signal transmitter [gamma proteobacterium HdN1]  clstr ali  82  4ITAIIKPFKLDDVRESLSDVGVEGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKLEVAVADERAETVIEAISKAANTGKIGDGKIFVTTLEQVIRIRTG 105
175 3.000e-52gi|386816780|ref|ZP_10103998.1| nitrogen regulatory protein P-II [Thiothrix nivea DSM 5205]  clstr ali  79  4VTAIIKPFKLDDVRDALGDIGIKGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKIKLEAAVAESQVDQVIEAISKAANTGKIGDGKIFVTSVEQVVRIRTG 105
179 3.000e-52gi|224367798|ref|YP_002601961.1| protein GlnB1 [Desulfobacterium autotrophicum HRM2]  clstr ali  68  4IEAIIKPFKLDDVKESLNEIGIHGMTITEVKGYGRQKGHKEIYRGAEYVVDFVPKIKLEIIVDKERADEVVETICKAANTGKIGDGKIFVMPVEQVIRVRTG 105
180 3.000e-52gi|256822304|ref|YP_003146267.1| nitrogen regulatory protein P-II [Kangiella koreensis DSM 16069]  clstr ali  70  4IEAIIKPFKLDDIREALTDLGVNGMTVTEVKGFGRQKGHTELYRGAEYMVDFLPKAKIEVVINDELVDKCVETIIEVARTGKIGDGKIFVTNVERTVRIRTG 105
181 3.000e-52gi|149195057|ref|ZP_01872149.1| nitrogen regulatory protein P-II (GlnB, GlnK) [Caminibacter mediatlanticus TB-2]  clstr ali  65  4IEAIIKPFKLDEVKEALVEADITGITVTEVKGHGRQHGHTELYRGAEYVVDFLPKVKLEIFVNDEFVEKTVEIILTHAKTGKIGDGKIFILPVEEAIRIRTG 105
182 3.000e-52Oral.Meta HOMD rcap_c_1_5680 Rhodobacter capsulatus SB 1003 [1811019 - 1811462] nitrogen regulatory protein P-II  ali  73  40VEAIIKPFKLDEVKEALQEAGIQGLSVIEVKGFGRQKGHTELYRGAEYVVDFLPKVKIEMVLPDEMVDIAIEAIVGAARTEKIGDGKIFVSSIEQAIRIRTG 141
183 3.000e-52gi|268678746|ref|YP_003303177.1| nitrogen regulatory protein P-II [Sulfurospirillum deleyianum DSM 6946]  clstr ali  66  4IEAIIKPFKLEDVKDALSNIEVTGMTVHEVKGYGRQQGHSELYRGAEYVVDFLPKIKLDIVVADENVDKVIATIMEAAKTGKIGDGKIFVSEIERVIRIRTG 105
184 3.000e-52gi|121604615|ref|YP_981944.1| nitrogen regulatory protein P-II [Polaromonas naphthalenivorans CJ2]  clstr ali  67  25ITVILKPFKLEEVREALAECGVTGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKVEVVVNTADVERCVDAIVRAARTGKIGDGKIFVTSVERVLRIRTG 126
185 3.000e-52gi|78776841|ref|YP_393156.1| nitrogen regulatory protein P-II [Sulfurimonas denitrificans DSM 1251]  clstr ali  65  4VEAVIKPFKLEDVKDALAEIGITGMTVSEVKGYGRQKGHSELYRGAEYVVDFLPKIKIEIVVDDENVEQVTTTIVEAARTGKIGDGKIFVSDIEKIIRIRTG 105
186 3.000e-52gi|223937744|ref|ZP_03629645.1| nitrogen regulatory protein P-II [bacterium Ellin514]  clstr ali  65  6IEAIIKPFKLEEVKDALGEVGIEGMTVSEVKGFGRQKGHTEIYRGSEYTVDFLPKIKLELVVADDQLDAAVTAIVKSAKTGKIGDGKVFVSNVEDAIRIRT. 106
187 4.000e-52gi|315499765|ref|YP_004088568.1| nitrogen regulatory protein p-ii [Asticcacaulis excentricus CB 48]  clstr ali  65  4IEAVIKPFKLDEVKEALQEIGVQGMTVLEAKGYGRQKGHSELYRGAEYVVDFLPKIKIELVVADDLAPAALEAIQTAARTGKIGDGKIFVSDVIDVVRIRTG 105
189 4.000e-52gi|121533996|ref|ZP_01665822.1| nitrogen regulatory protein P-II [Thermosinus carboxydivorans Nor1]  clstr ali  48  7IEIITRPGKLDELKEALNAIGVTGMTVSQVFGCGLQKGYTEIYRGKEYNINLLPKIKVEIVVCEVPVEKVLETAKQVCRTGNIGDGKIFVYPIENAVRIRTG 108
190 4.000e-52gi|258541726|ref|YP_003187159.1| nitrogen regulatory protein PII/GlnB/GlnK [Acetobacter pasteurianus IFO 3283-01]  clstr ali  66  4IEAIIKPFKLDEVKEALHELGLQGITVIEAKGFGRQKGHTELYRGAEYIVDFLPKMKIEVVCPASMVERAVEAISAAARTGRIGDGKIFVSPVDDVVRIRTG 105
191 4.000e-52gi|78485257|ref|YP_391182.1| nitrogen regulatory protein P-II [Thiomicrospira crunogena XCL-2]  clstr ali  73  4VTSIIKPFKLDDVREALHDIGVHGMTVTDVKGYGRQKGHTEMYRGAEYVVDFLPKLKIEIAVSGDKVDQVIEAITQTAQTGKIGDGKIFVTSIEQTVRIRTG 105
192 4.000e-52gi|307543687|ref|YP_003896166.1| nitrogen regulatory protein P-II [Halomonas elongata DSM 2581]  clstr ali  84  4VTAIIKPFKLDDVRESLSEIGVQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKLEVAVDNDMTEQVIDAITQVANTGKIGDGKIFVTPLEQVIRIRTG 105
193 4.000e-52gi|95928495|ref|ZP_01311242.1| nitrogen regulatory protein P-II [Desulfuromonas acetoxidans DSM 684]  clstr ali  61  4IDCIIKPFKLDDVKTALTDLGIAGMTVSEVRGFGRQKGHMELYRGAEYQTDFLPKVKVELVVDDQQVSDVVSALQKEACTGRIGDGKIFVTPVEESIRIRTG 105
194 4.000e-52gi|115522433|ref|YP_779344.1| nitrogen regulatory protein P-II [Rhodopseudomonas palustris BisA53]  clstr ali  65  4VVAIIKPFKLDEVRQALTDVGVHGMTVTEVKGYGRQRGHTEIYRGAEYLVNFLPKLRIEVGVADTLVDKAVEAITRSARTGQIGDGKIFVTPLDHALRIRTG 105
195 4.000e-52gi|319789608|ref|YP_004151241.1| nitrogen regulatory protein P-II [Thermovibrio ammonificans HB-1]  clstr ali  69  4IEAIIKPFKLEEVKDALTEIGVQGLTVSEVKGFGRQKGHTELYRGAEYVVDFIPKVKIEVVVPDSIAEKVVETIVNAARTGRIGDGKVFVIPVEDAVRIRTG 105
196 4.000e-52gi|410087003|ref|ZP_11283708.1| Nitrogen regulatory protein P-II [Morganella morganii SC01]  clstr ali  63  4IMAIIKPFKLNDVRDALNEEGIQGLTVLEVRGAGRQKGHTELYRGEEYSTDFLPKTQLTIVVPDDSLDRIIEAICRSAYTGSIGDGKIFVSDITQAVRIRTG 105
197 5.000e-52gi|320352505|ref|YP_004193844.1| nitrogen regulatory protein P-II [Desulfobulbus propionicus DSM 2032]  clstr ali  66  4IEAIIKPFKLDEVKDALNGIGIKGMTVTEVKGYGRQKGHTEIYRGAEYVVDFIPKIKIELIVQDELVDQVIETITKNARTGKIGDGKIFVLPVERIVRVRTG 105
198 5.000e-52gi|117924302|ref|YP_864919.1| nitrogen regulatory protein P-II [Magnetococcus marinus MC-1]  clstr ali  69  4IVAIIKPFKLDEVREALTSVGISGITVSEVRGFGRQKGHTELYRGAEYRVDFLPKLKVELAVDDSILEQAVEAIQKGAKTSKIGDGKIFVYDLESAVRIRTG 105
199 5.000e-52gi|325109444|ref|YP_004270512.1| nitrogen regulatory protein P-II [Planctomyces brasiliensis DSM 5305]  clstr ali  62  4IEAIIRHFKLEEVKDALTKAGVQGMTVSEVRGFGRQKGHKEQYRGAEYTVDFLPKVKLEVVIDDEAVRGVIDTILKTARTGQIGDGKIFVTDLAETIRIRTG 105
200 5.000e-52gi|348028513|ref|YP_004871199.1| nitrogen regulatory protein P-II 1 [Glaciecola nitratireducens FR1064]  clstr ali  73  4IEAIIKPFKLDDVREGLSSIGVSGITMTEVRGFGRQKGHKELYRGAEYNVDFLPKVKIELVVPDDLLDRAVETILAHAKTGKIGDGKIFVFNVEQVIRIRTG 105
201 5.000e-52gi|198284610|ref|YP_002220931.1| nitrogen regulatory protein P-II [Acidithiobacillus ferrooxidans ATCC 53993]  clstr ali  74  4ITAIVKPFKLDDVREALSAVGIQGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIEAVISDDAVDQAVEAIEKGARTGKIGDGKIFVSEVLETIRIRTG 105
202 5.000e-52gi|192362245|ref|YP_001983846.1| Nitrogen regulatory protein P-II [Cellvibrio japonicus Ueda107]  clstr ali  76  4VTAIIKPFKLDVVREALSDIGVHGMTVTEVKGFGRQKGHSELYRGAEYVVDFLPKTKVEIAVADTEADRVVEAISKAANSNKIGDGKIFVSSLEQVVRIRTG 105
203 5.000e-52gi|268680115|ref|YP_003304546.1| nitrogen regulatory protein P-II [Sulfurospirillum deleyianum DSM 6946]  clstr ali  65  4IESIIKPFKLEDVKDALAELDITGMTVSEVKGYGRQQGHSELYRGAEYVVDFLPKVKIEVVVADELVDKVIDVIIKNARTGKIGDGKIFVTDVEKSIRIRTG 105
204 5.000e-52gi|255021469|ref|ZP_05293515.1| nitrogen regulatory protein P-II [Acidithiobacillus caldus ATCC 51756]  clstr ali  71  4ITAIVKPFKLDDVREALSQAGIQGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIETVVPDNLVDIATDALIKGARTGKIGDGKIFVTEVLDAVRIRTG 105
205 5.000e-52gi|95929609|ref|ZP_01312351.1| nitrogen regulatory protein P-II [Desulfuromonas acetoxidans DSM 684]  clstr ali  60  4IECIIKPFKLDDVKNAITELGIAGMTVSEVRGFGRQKGHSELYRGAEYQIDFIPKVKIELVVSDDQVADLVASIQKAACTGRIGDGKIFVMPVEESVRIRTG 105
206 5.000e-52gi|103485644|ref|YP_615205.1| nitrogen regulatory protein P-II [Sphingopyxis alaskensis RB2256]  clstr ali  72  4IEAIIKPFKLDEVKEALHEVGVSGITVTEAKGFGRQKGHTELYRGAEYVVDFLPKVKLEVIVEDGMAERVVEAIAAAAQTGRIGDGKIFVIPVETALRIRTG 105
207 5.000e-52Oral.Meta HOMD esak_c_1_16899 Cronobacter sakazakii ATCC BAA-894 [2792905 - 2792462] nitrogen regulatory protein P-II  ali  78  40VTVVIKPFKLEDVREALSTIGIQGLTVTEVKGFGRQKGHAELYRGAEYSVNFLPKVKIDVAIADDQLDEVIEVVSKAAWTGKIGDGKIFVAELQRVIRIRTG 141
208 6.000e-52gi|392374120|ref|YP_003205953.1| glutamine synthetase regulatory protein P-II [Candidatus Methylomirabilis oxyfera]  clstr ali  64  4IEAIIKPFKLDEVKSALAEVGIQGLTVSEVKGFGRQKGHTELYRGSEYTIDFLPKVKIEVVVPDDKCDKVVETILSSAKTGRIGDGKIFIVSIDEVVRIRTG 105
209 6.000e-52gi|374414773|pdb|4AFF|A Chain A, High Resolution Structure Of A Pii Mutant (I86n) Protein In Complex With Atp, Mg And Flc  clstr ali model  58  4IEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFGRQKGQTERYRGSEYTVEFLQKLKLEIVVEDAQVDTVIDKIVAAARTGENGDGKIFVSPVDQTIRIRTG 105
210 6.000e-52gi|90416396|ref|ZP_01224328.1| regulatory protein, P-II 2, for nitrogen assimilation by glutamine synthetase, regulates GlnL (NRII) and GlnE (ATase)  clstr ali  73  4ITAIVKPFKLDEVREALGDLGVAGVTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKLEIALADEMVDSAVEAITNAAQTGKIGDGKIFISTLEEVIRIRTG 105
212 6.000e-52gi|296532467|ref|ZP_06895188.1| nitrogen regulatory protein P-II [Roseomonas cervicalis ATCC 49957]  clstr ali  69  4VMAVIKPFKLDEVREALTPLGVQGLTVTEVKGFGRQKGQTEIYRGAEYHVSFLPKLKIEVAVPSDLVDAVVEAIASTARTGKIGDGKIFVLDVERALRIRTG 105
213 6.000e-52gi|334144478|ref|YP_004537634.1| nitrogen regulatory protein P-II [Thioalkalimicrobium cyclicum ALM1]  clstr ali  70  4IVAIIKPFKLDDVREALHEIDVHGMTVTEAKGFGRQKGHTEIYRGAEYAIEFLPKVRLEIGVADDKVDTAIEAIGNAARTGKIGDGKIFVMPIEQAIRIRT. 104
214 6.000e-52gi|402850755|ref|ZP_10898944.1| Nitrogen regulatory protein P-II [Rhodovulum sp. PH10]  clstr ali  69  32VMAIIKPFKLDEVRDALTSIGVYGMTVTEVKGYGRQKGHTEIYRGTEYAVSFLPKVKVEIAVPSSQVEKVIETISGAAKTGQIGDGKIFVVGIDQAVRIRTG 133
215 7.000e-52gi|381393591|ref|ZP_09919312.1| nitrogen regulatory protein P-II 1 [Glaciecola punicea DSM 14233 = ACAM 611]  clstr ali  69  4IEAIIKPFKLDDVREALADAGVSGLTITEVKGFGRQKGHQELYRGAEYQVDFLPKVKIEVVVNDDIVDLVVESIIEVAKTGKIGDGKIFVSDVLRTIRIRTG 105
216 7.000e-52gi|171910280|ref|ZP_02925750.1| nitrogen regulatory protein P-II [Verrucomicrobium spinosum DSM 4136]  clstr ali  72  4VEAIIKPFKLEDVKEALAEVGVQGMTVVEVKGFGRQKGHTEIYRGSEYTVDFLPKVKLEVVVESDRCDTVVEAIVKAANTGKIGDGKVFVSEVAEAIRIRTG 105
217 7.000e-52gi|82703651|ref|YP_413217.1| nitrogen regulatory protein P-II (GlnB, GlnK) [Nitrosospira multiformis ATCC 25196]  clstr ali  71  4IEAIIKPFKLDEVCEALNEIGISGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKIKIEIVVLAKQVDSVIETIISSARTGKIGDGKIFVTDIEQVVRIRTG 105
218 7.000e-52gi|296274410|ref|YP_003657041.1| nitrogen regulatory protein P-II [Arcobacter nitrofigilis DSM 7299]  clstr ali  63  4IEAIIKPFKLEDVKEALVESGVTGMTVTDVKGYGRQQGHSELYRGAEYIVDFLAKIKIELIVNDEDVDKTIATISDAAKTGKIGDGKIFVTPIENVVRIRTG 105
219 7.000e-52gi|335420022|ref|ZP_08551064.1| nitrogen regulatory protein P-II [Salinisphaera shabanensis E1L3A]  clstr ali  75  4VTAVIKPFRLDDVREALAEVGVHGTTMTEVKGFGRQKGHTELYRGAEYAVDFLPKVKLEVAVADDRVDAVVEAIIEAAKTGQIGDGKIFVHNLEQVVRIRTG 105
220 7.000e-52gi|409399414|ref|ZP_11249703.1| nitrogen regulatory protein P-II [Acidocella sp. MX-AZ02]  clstr ali  68  4IEAIIKPFKLDEVKDSLGEVGLQGITVTEAKGYGRQKGHSETYRGAEYVVDFLPKVKIEIVCDDDLVERAVEAIMNAARTGRIGDGKIFVSEIEEAIRIRT. 104
221 7.000e-52gi|389872243|ref|YP_006379662.1| P2-like signal transmitter [Advenella kashmirensis WT001]  clstr ali  71  4ITAIIKPFKLDEVRAGLADIGIQGLTITEVKGFGRQKGHTELYRGAEYVVDFLPKIKLETAVADEQVEQAIETICQSGTTGKIGDGKIFVTDLEQVIRIRTG 105
222 8.000e-52gi|407772461|ref|ZP_11119763.1| nitrogen regulatory protein PII [Thalassospira profundimaris WP0211]  clstr ali  75  4VTAVIKPFKLDEVREALSALGVQGLTVTEVKGFGRQKGQTEIYRGAEYMVSFLPKVKLEVAITDNLVDQVVEAITKTAQTGKIGDGKIFVLDVNQAVRIRTG 105
223 8.000e-52gi|114776294|ref|ZP_01451339.1| nitrogen regulatory protein P-II [Mariprofundus ferrooxydans PV-1]  clstr ali  62  4IRAIIKPFKLDDVKEALAGAGISGLTVTEVRGHGRQKGHTELYRGAEYNVDFVPKTELMIVVEDDHVDGAIAAIVESARSGKVGDGKIFVSNVEKVVRIRTG 105
224 8.000e-52gi|226951728|ref|ZP_03822192.1| regulatory protein for nitrogen assimilation by glutamine synthetase, regulates GlnL (NRII) and GlnE (ATase) [Acineto  clstr ali  84  22VTAIVKPFKLDDVREALSDIGVQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIEIAISDEMVDAVIESITRVASTGKIGDGKIFVTNLEQVIRIRTG 123
225 8.000e-52gi|254294165|ref|YP_003060188.1| nitrogen regulatory protein P-II [Hirschia baltica ATCC 49814]  clstr ali  68  4IEAIIKPFKLDEVKEALHEVGLQGMTVIEAKGFGRQRGHTELYRGAEYVVDFLPKLKVEVVVADSQLDAALEAVSSAAQTGKIGDGKIFVSDVSEVVRIRTG 105
226 8.000e-52gi|377555647|ref|ZP_09785375.1| nitrogen regulatory protein P-II [endosymbiont of Bathymodiolus sp.]  clstr ali  73  4ISAILRPHQLDDVREALSEVGVSGITVTEVKGFGRQKGHTEMYRGAEYQVDFLPKVKLEIAVAASELDSVIETIAKTANTGKVGDGKIFVSNLEKVVRIRTG 105
227 9.000e-52gi|414153815|ref|ZP_11410137.1| Nitrogen regulatory protein P-II [Desulfotomaculum hydrothermale Lam5 = DSM 18033]  clstr ali  51  4IEAIIRPGKLEEVKEALNKLGIHGMTVCQVMGCGHQKGRTEVYRGAEYSINLLPKVKVEIIIDDRWADACVKAIAETARSGEIGDGKIFVYPVSNVIRIRTG 105
229 9.000e-52gi|406912054|gb|EKD51729.1| nitrogen regulatory protein PII [uncultured bacterium]  clstr ali  68  12IEAIIKPFKLDDVKEAISELGVKGMTVSEVKGFGRQRGHTELYRGAEYIVDFLPKIKIELVIKDEDTAKVVEAIQNAAKTGRIGDGKIFILPVEEVIRIRT. 112
230 9.000e-52gi|312113329|ref|YP_004010925.1| nitrogen regulatory protein P-II [Rhodomicrobium vannielii ATCC 17100]  clstr ali  69  4IEAVIKPFKLDEVKEALQEIGLQGITVTEAKGFGRQKGHTELYRGAEYVVDFLPKVKIEIVLPEDMVEKACEAIKNSARTGRIGDGKIFILNVEDAIRIRTG 105
231 9.000e-52gi|56461264|ref|YP_156545.1| nitrogen regulatory protein PII [Idiomarina loihiensis L2TR]  clstr ali  65  5.VALIKPFKLEDVKQALFEIGCKGLTVTEVRGVGRQKGHTELYRGAEYQVDFLPKMKIELAVPDETVERALEVVIAAAHTGNIGDGKIFVMPLEQCVRIRTG 105
232 9.000e-52gi|197124762|ref|YP_002136713.1| nitrogen regulatory protein P-II [Anaeromyxobacter sp. K]  clstr ali  71  9VEAIIKPFKLDEVKQALSEVGVAGLTATEVKGFGRQKGHTELYRGAEYVVDFLPKVKVEVVVADSLVGRVVEVIERAAKTGRIGDGKIFVLPVEEVIRIRTG 110
234 1.000e-51gi|94501622|ref|ZP_01308138.1| regulatory protein, P-II 2, for nitrogen assimilation by glutamine synthetase, regulates GlnL (NRII) and GlnE (ATase)  clstr ali  88  5VTAVIKPFKLDDVREALSEIGVQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKLEIAIDEAQLDKVIEAITEAANTGKIGDGKIFVTNLEQIIRIRTG 106
235 1.000e-51gi|170743594|ref|YP_001772249.1| nitrogen regulatory protein P-II [Methylobacterium sp. 4-46]  clstr ali  66  4VMAIIKPFKLEEVRDALTSIGVHGLTVTEVKGYGRQKGHTEIYRGAEYAVSFLPKLKIEVAVAADLVASVVDTIAAAARTGQIGDGKIFVLPLEKAVRIRTG 105
236 1.000e-51gi|297568115|ref|YP_003689459.1| nitrogen regulatory protein P-II [Desulfurivibrio alkaliphilus AHT2]  clstr ali  64  4VEAIIKPFKLDEVKEAVTALGVHGMTVTEVKGFGRQKGHTEVYRGAEYVVDFVPKVKLEIVVASEMVEQVVETIIQAARNGKIGDGKIFVLPVESVCRIRTG 105
238 1.000e-51gi|254443442|ref|ZP_05056918.1| nitrogen regulatory protein P-II [Verrucomicrobiae bacterium DG1235]  clstr ali  70  4VVAIIKPFKLEEVKEALSEIGIEGMTVTEVKGFGRQKGHTEIYRGSEYTVDFLPKVKIEIAVPDDVVSKAAEAIVKSAKTGKIGDGKVFVIPLEEAVRIRT. 104
239 1.000e-51gi|372269301|ref|ZP_09505349.1| nitrogen regulatory protein P-II GlnK [Alteromonas sp. S89]  clstr ali  81  4VTAIIKPFKLDAVRDSLAEAGVSGITVSEVKGFGRQKGHTELYRGAEYVVDFLPKTMLQIAVEDSQVDAVLEAIGKAAQSGKIGDGKIFVANLEQAIRIRTG 105
240 1.000e-51gi|157736461|ref|YP_001489144.1| nitrogen regulatory protein PII [Arcobacter butzleri RM4018]  clstr ali  61  4IEAVIKPFKLEDVKDALQEAGITGMTVSDVKGYGRQQGHSELYRGAEYVVDFLPKIKIELIVADENVDNIISVIIEAARTGKIGDGKIFVSPIEKIVRIRTG 105
241 1.000e-51gi|347541266|ref|YP_004848692.1| nitrogen regulatory protein P-II [Pseudogulbenkiania sp. NH8B]  clstr ali  81  6VTAIIKPFKLDEVREGLSSIGVQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKLEIAIDDALLDQVVEAIEKSARTGKIGDGKIFVFDLQQVVRIRTG 107
243 1.000e-51gi|407717271|ref|YP_006838551.1| Regulatory protein for nitrogen assimilation by glutamine synthetase (ATase) [Cycloclasticus sp. P1]  clstr ali  74  4VTAVLKPFKLDDVREALSDIGVSGITVTEVKGFGRQKGHTELYRGSEYVVDFLPKVKVEIALSDEQVEEAVDSIIKAANTGKIGDGKIFITELEKVVRIRTG 105
244 1.000e-51gi|386289574|ref|ZP_10066703.1| nitrogen regulatory protein P-II [gamma proteobacterium BDW918]  clstr ali  79  4VSAVIKPFKLDDVRAALSEIGVQGVTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKLEIAVTDDQVEKVIDTVTKAACTGKIGDGKIFVTSLEQVIRIRTG 105
245 1.000e-51gi|114797943|ref|YP_760780.1| nitrogen regulatory protein P-II [Hyphomonas neptunium ATCC 15444]  clstr ali  70  4IEAIIKPFKLDDVKEALQEIGLQGMTVIEAKGFGRQRGHTELYRGAEYVVDFLPKLKIEVVLPDSAVEGAVEAIKKAAHTDKIGDGKIFVSDVIDAVRIRTG 105
246 1.000e-51gi|149928336|ref|ZP_01916577.1| nitrogen regulatory protein P-II [Limnobacter sp. MED105]  clstr ali  75  4VSAIIKPFKLDEVREALSEVGVTGLTVTEVKGFGRQRGHTELYRGAEYVVDFLPKVKIELVIEDKLVDQAIDAIQNAARTNKIGDGKIFVTDVERVIRIRTG 105
247 1.000e-51gi|195952512|ref|YP_002120802.1| nitrogen regulatory protein P-II [Hydrogenobaculum sp. Y04AAS1]  clstr ali  58  4IEAIIKPFKLDEVKDALTEIGIGGMTVIEIRGFGQQKGHTEVYRGTEYVIDFLPKIKIEIVVKDEEVEKVVNTIMKSAQTGRVGDGKIFILPVEDVIRIRTG 105
248 1.000e-51gi|152991172|ref|YP_001356894.1| nitrogen regulatory protein P-II [Nitratiruptor sp. SB155-2]  clstr ali  69  4VEAIIKPFKLDDVKEGLSEIGITGMTVTEVKGYGRQQGHSELYRGAEYVVDFLPKVKIEVIVPSDMVESVVETIMQNARTGKIGDGKIFVSDIEKVVRIRTG 105
249 1.000e-51gi|227358091|ref|ZP_03842433.1| nitrogen regulatory protein P-II [Proteus mirabilis ATCC 29906]  clstr ali  69  15IIAIIKPFKLEDVRESLSELGINGMTISEVKGYGRQKGHAELYRGAEYEVNFLPKVKIELAVCDGQLEPVLQAISQVTDTGKVGDGKIFVLELLQAIRIRTG 116
250 1.000e-51gi|209966053|ref|YP_002298968.1| nitrogen regulatory protein pZ [Rhodospirillum centenum SW]  clstr ali  73  4VMAVIKPFKLDEVREALTGLGIQGLTVSEVKGFGRQKGQTEIYRGAEYSVSFLPKVKIEVAVTDDLTDAVVEAIQKAANTGRIGDGKIFVLELAQAIRIRTG 105
251 1.000e-51gi|149910071|ref|ZP_01898719.1| nitrogen regulatory protein P-II [Moritella sp. PE36]  clstr ali  71  4ISAIIKPFKLDDVREAIADFGVEGLTVTEVKGFGRQKGHTELYRGAEYQVDFLPKVKLEIATQSENVDRLIEAISSAAYTGKIGDGKIFVYDLKQVVRIRTG 105
252 2.000e-51gi|225848965|ref|YP_002729129.1| nitrogen regulatory protein P-II [Sulfurihydrogenibium azorense Az-Fu1]  clstr ali  64  4VEAIIKPFKLEEVKDVLASIGNFGITVSEVRGFGRQKGHTEFYRGAEYTIDFLPKLKIEVVVDDEMVEKVVEAIVSTARTGKVGDGKIFIIPVEEAIRIRTG 105
253 2.000e-51gi|121594130|ref|YP_986026.1| nitrogen regulatory protein P-II [Acidovorax sp. JS42]  clstr ali  70  4ITAVIKPFKLEEVREALAECGVTGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIEVVVRTEDVDRCVDAIVGAARTGKIGDGKIFVTAVERVVRIRTG 105
254 2.000e-51gi|290474649|ref|YP_003467529.1| regulatory protein (P-II 2) for nitrogen assimilation, regulates GlnL (NRII), GlnE (ATase), and AmtB (ammonium trans  clstr ali  68  16ITTIIKPFKLEEVREALSDIGIQGMTVTEVKGFGRQKGHSELYRGAEYNVNFLPKVKIDIATHDERVEEVIHVIQQSAFTGKMGDGKIFIFELQHAVRIRTG 117
255 2.000e-51gi|381152169|ref|ZP_09864038.1| nitrogen regulatory protein PII [Methylomicrobium album BG8]  clstr ali  79  4ITAIVKPFKLDDVREALSEIGVTGVTVTEVKGFGRQKGHTELYRGAEYVVDFLPKTKVEVAVSSALVDQAVEAITKAAGTGKIGDGKIFVTTLEQVIRIRTG 105
256 2.000e-51gi|347735359|ref|ZP_08868246.1| nitrogen regulatory protein [Azospirillum amazonense Y2]  clstr ali  69  4IIAVIKPFKLDEVRDALTGLGVQGLTVTEVKGYGRQKGQTEIYRGAEYAVSFLPKMKIEVAVPDDLADKAVEAIQAAANTGKIGDGKIFVLELAQAVRIRTG 105
257 2.000e-51gi|254515510|ref|ZP_05127570.1| nitrogen regulatory protein P-II [gamma proteobacterium NOR5-3]  clstr ali  84  11ITAIVKPFKLDDVRESLSEIGVQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIEVAVAEGMVDQTIEAITKSANTGKIGDGKVFVSSLEQVIRIRTG 112
258 2.000e-51gi|209883505|ref|YP_002287362.1| nitrogen regulatory protein P-II [Oligotropha carboxidovorans OM5]  clstr ali  64  4VMAVIKPFKLEEVRDALTAVGVHGLTVTEVKGYGRQKGHTEIYRGAEYAVSFLPKIKLEIAVADADVTRAIEAICTAARTGQIGDGKIFVSDIEHAVRIRTG 105
259 2.000e-51gi|296445766|ref|ZP_06887719.1| nitrogen regulatory protein P-II [Methylosinus trichosporium OB3b]  clstr ali  72  4VTAIIKPFKLDEVRDALTNIGVHGLTVTEVKGYGRQKGHTEIYRGAEYAVSFLPKLKIEVAVTSELVAKAIEAITTAAHTGQIGDGKIFVLPLEQTIRIRTG 105
260 2.000e-51gi|329895329|ref|ZP_08270954.1| Nitrogen regulatory protein P-II [gamma proteobacterium IMCC3088]  clstr ali  78  4VTAIIKPFKMDDVRLALSEIGVQGITGTEVKGFGRQRGHTELYRGAEYVVDFLPKLKLEIAVAESQVDATIDAILKSASTGKIGDGKIFVSPLEQVIRIRTG 105
261 2.000e-51gi|288942036|ref|YP_003444276.1| nitrogen regulatory protein P-II [Allochromatium vinosum DSM 180]  clstr ali  76  4VSAVIKPFKLDDVREALGDIGVSGITVVEVKGFGRQKGHTELYRGAEYVVDFLPKIKVEIAVDDAMVDQVIEAISNAARTGKIGDGKIFVFELDQVIRIRTG 105
262 2.000e-51gi|397691387|ref|YP_006528641.1| nitrogen regulatory protein P-II [Melioribacter roseus P3M]  clstr ali  55  4IEAIIRPHKLDEVQEALSDAGFQGLSVSEVRGYGRQKGHKEVYRGTEYNINFVPKVKIEMICTDDRLEKAVDIIIKTAKTGEVGDGKIFIYDLKDAIRIRTG 105
263 2.000e-51gi|338738134|ref|YP_004675096.1| nitrogen regulatory protein P-II [Hyphomicrobium sp. MC1]  clstr ali  73  4IEAIIKPFKLDEVKEALQEIGLQGITVIEAKGFGRQKGHTELYRGAEYVVDFLPKVKIEVVLSDDMLEKAIESIQKAAKTGRIGDGKIFISSIEDAIRIRTG 105
264 2.000e-51gi|34556979|ref|NP_906794.1| P2-like signal transmitter protein GlnB [Wolinella succinogenes DSM 1740]  clstr ali  64  4IEAVIKPFKLEEVKSALVERGISGMTVSEVKGYGRQKGHTELYRGAEYVVDFIPKIKLEIVVRDEEVEGIIEAIIKSAKTGKIGDGKIFVTPVERAIRIRT. 104
266 2.000e-51gi|217976617|ref|YP_002360764.1| nitrogen regulatory protein P-II [Methylocella silvestris BL2]  clstr ali  73  4IEAIIKPFKLDEVKEALHEAGVAGITVTEAKGFGRQKGHTELYRGAEYIVDFLPKVKVEVVVADSIVDAAVEAIRKAAQTGRIGDGKIFISNIEGAIRIRTG 105
267 2.000e-51gi|294635336|ref|ZP_06713832.1| nitrogen regulatory protein P-II [Edwardsiella tarda ATCC 23685]  clstr ali  69  20VSAVIKPFKLDEVRDALSAMGICGLTVTEVKGFGRQKGHAELYRGAEYAVNFLPKVKIEIALADDRLEAVIEAICQAAGSGKIGDGKIFVADLTRVVRIRTG 121
268 2.000e-51gi|182414296|ref|YP_001819362.1| nitrogen regulatory protein P-II [Opitutus terrae PB90-1]  clstr ali  63  4ISAIIKPFKLEDVKTALGEAGVEGMTATEVKGFGRQKGHTEIYRGSEYTIDFLPKVKIEIAVPDALVPKVIDAIIASAKTGRIGDGKIFVTSLDEVVRVRTG 105
269 2.000e-51JCVI_PEP_1096695812017 /source_dna_id=JCVI_ORF_1096695812016 /offset=0 /translation_table=11 /length=150 /full_length=150  ali  66  41ITAIIKPIKLEEVRAALSEVNALGMTVTEVKGFGRQKGQTELYRGTEYRNDFLPKTKIELAVKDEDTDSVINAISSVSNTGKVGDGKIFVYDLEKAVRIRTG 142
270 3.000e-51gi|119475305|ref|ZP_01615658.1| nitrogen regulatory protein P-II [marine gamma proteobacterium HTCC2143]  clstr ali  77  4ITAVIKPFKLDDVRQALSEVGVTGITATEVKGFGRQKGHTELYRGAEYVVDFLPKVKLEIAINDDQVETVIEAISGAANSGKIGDGKIFVAPLEHIVRIRTG 105
271 3.000e-51gi|254472137|ref|ZP_05085537.1| nitrogen regulatory protein PII [Pseudovibrio sp. JE062]  clstr ali  66  42VMAIIKPFKLDEVRDALTTLGIQGLTVTEVKGYGRQKGHTEIYRGTEYAVTFLPKLKVEVAIASDMADKVVEAIGNAAQTGQIGDGKIFVYSIDQVVRIRTG 143
272 3.000e-51gi|312114958|ref|YP_004012554.1| nitrogen regulatory protein P-II [Rhodomicrobium vannielii ATCC 17100]  clstr ali  65  4VMAIIKPFKLEEVRQALDGLGVEGLTVSEVKGYGRQKGHTEIYRGAEYEVNFIPKIKIEVVVADEQADKVIEAISSTAKTGQIGDGKIFVSTIEHTVRIRTG 105
273 3.000e-51gi|32472258|ref|NP_865252.1| nitrogen regulatory protein P-II [Rhodopirellula baltica SH 1]  clstr ali  60  25VEAIVRHFKLEDVKNALTEQGIHGMTVSEVRGFGRQKGHTEIYRGTEYAIDFVPKVKIEVVCTSDNLQTVIDTILQTAQTGQIGDGKIFVTNLEESVRIRTG 126
274 3.000e-51gi|304321727|ref|YP_003855370.1| P2-like signal transmitter protein GlnB [Parvularcula bermudensis HTCC2503]  clstr ali  69  4VEALIKPFKLDDVKEALQALGLKGMTVSEARGFGRQKGHTELYRGAEYVVDFLPKLKIEIVIEDSLVDDVLRAITEAAQSGRIGDGKIFVTTVERAVRIRTG 105
275 3.000e-51gi|88810935|ref|ZP_01126191.1| Nitrogen regulatory protein P-II [Nitrococcus mobilis Nb-231]  clstr ali  68  4VVAIIKPFKLDDVREALSGVGLRGLTVSEVKGFGRQKGHTELYRGTEYRADLLPKIKVEAALDDDRVEEAIEAICQAAHTGKVGDGKIFVLPLEQSVRIRT. 104
276 3.000e-51gi|389878995|ref|YP_006372560.1| nitrogen regulatory protein P-II [Tistrella mobilis KA081020-065]  clstr ali  64  4ISAIIKPFKLQAVREALTDLGIQGLTVTEVKGYGRQKGQTEIYRGAEYEVNFVPKLKIEIALNDDLLEAAVEAIQTNAQTGKIGDGKIFVFDLERVVRIRTG 105
277 3.000e-51gi|24375312|ref|NP_719355.1| regulatory protein for nitrogen assimilation GlnK [Shewanella oneidensis MR-1]  clstr ali  70  4ITAIIKPFKIDDVREALTQLGIHGMTVTEVRGFGRQKGHTELYRGAEYAVDFLPKMKLEIAIHSELEEAVIEAIIQAAHTGKVGDGKIFVTPLEQVIRVRT. 104
278 3.000e-51gi|254447668|ref|ZP_05061134.1| nitrogen regulatory protein P-II [gamma proteobacterium HTCC5015]  clstr ali  81  4VTAIIKPFKLDDVREALAEVGVQGVTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKLEVGIDDSAVDQVIEAISGAAHTGKIGDGKVFVTPLESALRIRTG 105
279 3.000e-51gi|254362745|ref|ZP_04978829.1| nitrogen regulatory protein PII [Mannheimia haemolytica PHL213]  clstr ali  66  4IEAIIKPFKLDDVREALTDVGVSGMSITEIKGFGRQKGHTELYRGAEYAIDFLPKVKVEIVIPDELEEQCIEAIMETAQTGKIGDGKIFVYDVGRVIRIRTG 105
280 3.000e-51JCVI_PEP_1096684430361 /source_dna_id=JCVI_ORF_1096684430360 /offset=0 /translation_table=11 /length=258 /full_length=258  ali  61  149.IAIIKPFKLDDVRKALTQIGVEGLTASEVRGFGRQRGQTEIYRGTEYSVSFVPKLKIELAVPDELEEKVLETLNKSANTGQIGDGKIFVFDIKSATRIRTG 249
282 4.000e-51gi|94309626|ref|YP_582836.1| regulatory protein P-II for glutamine synthetase [Cupriavidus metallidurans CH34]  clstr ali  74  4ITAIIKPFKLDEVREAMADVGVTGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKIKIEVVVAENQLDTVLDAIVKAAHTGKIGDGKIFVTEIERVIRIRTG 105
283 4.000e-51gi|344942576|ref|ZP_08781863.1| nitrogen regulatory protein P-II [Methylobacter tundripaludum SV96]  clstr ali  79  4ITAVVKPFKLDDVREALSDIGVSGVTVTEVKGFGRQKGHTELYRGAEYVVDFLPKAKIEVAVADNMLEQAVEAITKAANTSKIGDGKIFVTNLEQVVRIRTG 105
284 4.000e-51gi|424863563|ref|ZP_18287475.1| nitrogen regulatory protein P-II [SAR86 cluster bacterium SAR86A]  clstr ali  68  4ITAIIKPFKVEEVRSSLDEIGVSGMTMTEVKGFGRQKGHTELYRGAEYTIDFLPKIKIEIAVKDDLVDQVKNAIIKSAGSGKIGDGKIFVSPIDEVIRIRTG 105
286 4.000e-51gi|87120722|ref|ZP_01076615.1| regulatory protein, P-II 2, for nitrogen assimilation by glutamine synthetase, regulates GlnL (NRII) and GlnE (ATase)  clstr ali  79  4VTAIVKPFKLDEVREALSEIGINGITVTEVKGFGRQRGHTELYRGAEYVVDFLPKVKLELAVEDDQTDRAIEVIQQSANTGKIGDGKIFVTSLEQIIRIRTG 105
287 4.000e-51gi|196234254|ref|ZP_03133085.1| nitrogen regulatory protein P-II [Chthoniobacter flavus Ellin428]  clstr ali  64  4IEAIIKPFKLEDVKEALSEIGIEGMTISEVKGFGRQKGHTEIYRGSEYTVDFLPKVKFEIVLADDRVTRAVEAIVSSAKTGKIGDGKVFILPIEDAIRIRT. 104
288 4.000e-51gi|237745634|ref|ZP_04576114.1| nitrogen regulatory protein P-II [Oxalobacter formigenes HOxBLS]  clstr ali  75  4ISAIVKPFKLDEVREALASIGIQGMTVTDVRGFGRQKGHTELYRGAEYVVDFLPKTKIEVAIADELLEQAIEAIGKSASTGKIGDGKIFIVDLEQVIRIRTG 105
289 4.000e-51gi|148651989|ref|YP_001279082.1| nitrogen regulatory protein P-II [Psychrobacter sp. PRwf-1]  clstr ali  77  4ITAVLKPFKLDDVREALSEIGVKGVTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKVEVAVTDEMVEPAIEAITRIASTGKIGDGKIFISPLEQVIRIRTG 105
290 4.000e-51gi|407792624|ref|ZP_11139661.1| nitrogen regulatory protein P-II 2 [Idiomarina xiamenensis 10-D-4]  clstr ali  72  4ITALIKPFKLDDVRAALAEIGCKGLTVTEVRGFGRQKGHTELYRGAEYRIDFLPKVKIDIAASDDQVEAIIDAISDAAHTGNIGDGKIFITQLEQALRIRTG 105
291 5.000e-51gi|294056091|ref|YP_003549749.1| nitrogen regulatory protein P-II [Coraliomargarita akajimensis DSM 45221]  clstr ali  66  4VKAIIKPFKLEEVKEALADIGIEGMTVTEVKGFGRQKGHTEIYRGSEYTVDFLPKVMIEIVVDDADAEKTGEAIVKAAKTGKIGDGKVFIIPVEAAIRIRT. 104
292 5.000e-51gi|332284231|ref|YP_004416142.1| hypothetical protein PT7_0978 [Pusillimonas sp. T7-7]  clstr ali  76  4VSAIIKPFKLDEVREALADIGVSGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKLRIDVVLPATMVDTAIDAIIKAAFTGKIGDGKIFVSAVEQAIRIRTG 105
293 5.000e-51gi|384260810|ref|YP_005415996.1| Nitrogen regulatory protein PII [Rhodospirillum photometricum DSM 122]  clstr ali  67  4ITAIIKTFKLDEVREALTAIGIEGMTVAECKGYGRQKGQTEIYRGAEYVVNFLPKLKIEIAVADDRVEQVIETISQVARTGKIGDGKIFVFSLENAIRIRTG 105
294 5.000e-51gi|319942737|ref|ZP_08017042.1| regulatory protein [Sutterella wadsworthensis 3_1_45B]  clstr ali  73  4VTVIIKPFKLDDVREALSAAGVHGLTVTEVKGFGRQRGHTELYRGAEYVVDFLPKIRIDIAVTDDAVDTVIEAVLASARTGKVGDGKIFVSPLEHVVRIRTG 105
296 5.000e-51gi|283781891|ref|YP_003372646.1| nitrogen regulatory protein P-II [Pirellula staleyi DSM 6068]  clstr ali  58  4VEAIVRHFKLEEVKNALAERGVHGMTICEVRGFGRQKGHTEMYRGTEYAVDFVPKVKLEVVCSDANLALVIDTIMRSAQTGQIGDGKIFVHDLLDVVRIRTG 105
297 5.000e-51gi|374620729|ref|ZP_09693263.1| nitrogen regulatory protein PII [gamma proteobacterium HIMB55]  clstr ali  78  4VTAVIKPFKLDDVREALSTIGVQGITVSEVKGFGRQKGHTELYRGAEYVVDFLPKTKVEVAVSEEMLEQTIEAISGAAQTGNIGDGKIFVTSLEQSIRIRTG 105
298 5.000e-51gi|404495552|ref|YP_006719658.1| nitrogen regulatory protein P-II [Geobacter metallireducens GS-15]  clstr ali  68  4IEAIIKPFKLDEVKDALTEIGVEGITVSEVKGFGRQKGHTELYRGAEYVVDFIPKVKIEIAVADEVVAKVVETIENTAKTGRIGDGKIFILPLDEAVRIRTG 105
299 5.000e-51gi|410657181|ref|YP_006909552.1| Nitrogen regulatory protein P-II [Dehalobacter sp. DCA]  clstr ali  51  32IECIIRPAKLENVKEALGKFGIKGMTVTNVIGCGLQQGKTEVYRGNAYTINLLPKYKIEIIVPDESVDKVIEIITETARTGEIGDGKIFVYDVLNAVRIRTG 133
300 5.000e-51gi|190576187|ref|YP_001974032.1| nitrogen regulatory protein P-II [Stenotrophomonas maltophilia K279a]  clstr ali  76  4VMAVIKPFKLDDVREALAERGVTGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKLEVAVTDDQVEAVVEAIVKAAGTGKIGDGKVFVYDLGSVVRIRTG 105
301 5.000e-51gi|87311181|ref|ZP_01093304.1| nitrogen regulatory protein P-II [Blastopirellula marina DSM 3645]  clstr ali  58  4VEAIIRHHKMEDVKMALNDMGVHGMTVSEVQGYGRQKGHTENYRGAEYSVDFVPKHKIEIICSDGNLQLVIDTILKSAQTGQIGDGKLFIYDVKQAIRIRTG 105
302 5.000e-51gi|197105036|ref|YP_002130413.1| nitrogen regulatory protein P-II [Phenylobacterium zucineum HLK1]  clstr ali  67  4IEAIIKPFKLDEVKEALQELGVQGMTVIEAKGYGRQKGQTELYRGAEYVVDFLPKIKIEVVVADDQLSRALEAISAAARTGRIGDGKIFVSEVLDVMRIRTG 105
303 5.000e-51gi|297569695|ref|YP_003691039.1| nitrogen regulatory protein P-II [Desulfurivibrio alkaliphilus AHT2]  clstr ali  64  4VEAIIKPFKLDEVKKALHELGVQGMTITEVKGYGRQKGHTEIYRGAEYEVEFIPKVKVEVIVNADQVEAVVACIREAANSGKIGDGKIFVLPVEEVIRVRTG 105
304 5.000e-51gi|399020189|ref|ZP_10722328.1| nitrogen regulatory protein PII [Herbaspirillum sp. CF444]  clstr ali  78  4VTAIIKPFKLDEVRESLAEVGVTGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIEVVVDNSVVEPVVDAIIKAARTGKIGDGKIFVQEVEQVIRIRTG 105
305 5.000e-51gi|334339373|ref|YP_004544353.1| nitrogen regulatory protein P-II [Desulfotomaculum ruminis DSM 2154]  clstr ali  49  4IEAIVRPGKLEDVKDALNNAGIHGMTVSQVIGCGHQKGRKEVYRGTEYSINLLPKIKVEVIVQDSKVDGCVKVICDAARSGEIGDGKIFIYPVTNAIRIRTG 105
306 6.000e-51gi|189219214|ref|YP_001939855.1| Nitrogen regulatory protein PII [Methylacidiphilum infernorum V4]  clstr ali  66  6IEAIIKPFKLEEVKEALTEIGIAGLTVTEVKGFGRQKGHTEIYRGSEYTVDFLPKVKVEIVLTEDILPKAVEAIIKSAKTGKIGDGKIFVLPVSEAIRIRT. 106
307 6.000e-51gi|238759248|ref|ZP_04620415.1| Nitrogen regulatory protein P-II 2 [Yersinia aldovae ATCC 35236]  clstr ali  77  38VTVVIKPFKLEDVREALSSVGIQGLTVTEVKGFGRQKGHAELYRGAEYSVNFLPKVKIDVAIADDQLDEVIDVISKAAYTGKIGDGKIFVAELQRVIRIRTG 139
308 6.000e-51gi|319779598|ref|YP_004130511.1| nitrogen regulatory protein P-II [Taylorella equigenitalis MCE9]  clstr ali  73  4VTAIIKPFKLDEVREALGEVGITGLTVTETKGFGRQKGHTELYRGAEYAVDFLPKVKIELLVKDTEVDSALEAIVEAARTGKIGDGKIFVTNVEQVVRIRTG 105
309 6.000e-51gi|385810857|ref|YP_005847253.1| nitrogen regulatory protein PII [Ignavibacterium album JCM 16511]  clstr ali  56  4IEAIIRPFKLDDVKQALLEEGVRGLTISEVRGYGRQKGHTETYRGSEYHIEFVPKIKIEVVVNDNMVDKIVDAIIKTAKTGQVGDGKIFISEISEVIRIRT. 104
310 6.000e-51gi|110679806|ref|YP_682813.1| nitrogen regulatory protein P-II [Roseobacter denitrificans OCh 114]  clstr ali  70  4IEAVIKPFKLDEVKEALQEVGVQGLSVIEVKGFGRQKGHTELYRGAEYVVDFLPKVKIEIVLDDDMVESAIEAIVSAAKTEKIGDGKIFVTPVEQTIRIRTG 105
311 6.000e-51gi|224371618|ref|YP_002605782.1| protein GlnB4 [Desulfobacterium autotrophicum HRM2]  clstr ali  61  4IEAIIKPFKLDEVKEQLNKIGITGMTLSEVKGFGRQKGHTEIYRGAEYQVDFVPKIHLSLVVDDALVEMAVAAIIKSAATGKIGDGKIFIVPVEDAVRIRTG 105
312 7.000e-51gi|302036715|ref|YP_003797037.1| nitrogen regulatory protein PII [Candidatus Nitrospira defluvii]  clstr ali  67  4IEAIVKPFKLDEVKDALLEIGIQGMTVTEVKGFGRQKGHKETYRGQEYTIEFVPKVKIEVAVNDSQVQRVLETITRAAKTGSIGDGKIFVRELTSAVRIRTG 105
313 7.000e-51JCVI_PEP_1096682930799 /source_dna_id=JCVI_ORF_1096682930798 /offset=0 /translation_table=11 /length=147 /full_length=147  ali  55  38IIAVIKPFKLEEVRDALKDIGIQGLMVSEIKGYGRQDGHSEVYRGAEYTVSFVPKLKLEIVVADEDTSKTVETISEVAKTGKIGDGKIFVTPVESALRIRT. 138
314 7.000e-51gi|338814685|ref|ZP_08626671.1| nitrogen regulatory protein P-II [Acetonema longum DSM 6540]  clstr ali  52  7IDIITRPAKLEELKEAMNVIGVTGMTVTQVYGCGLQKGHTEVYRGKEYTINLLPKVKVEIVVCEVPVEKVLEAAKKACHTGQIGDGKIFVYPIENAIRIRTG 108
315 8.000e-51gi|319956765|ref|YP_004168028.1| nitrogen regulatory protein p-ii [Nitratifractor salsuginis DSM 16511]  clstr ali  61  4IEAIIKPFKLEDVKEALIEAGIEGMTVSEVKGYGRQQGHSELYRGAEYVVDFIPKVKIEIVVSEEYMRAAVDAIKESARTGKIGDGKIFVSPVEHVVRIRTG 106
316 8.000e-51gi|340787936|ref|YP_004753401.1| nitrogen regulatory protein P-II [Collimonas fungivorans Ter331]  clstr ali  74  10ITAVIKPFKLDEVREALAEVGVTGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKVELVIDDALTERAVDAIIKAARTGKIGDGKIFVRNIEQVIRIRTG 111
317 8.000e-51gi|258514304|ref|YP_003190526.1| nitrogen regulatory protein P-II [Desulfotomaculum acetoxidans DSM 771]  clstr ali  50  4IEAVIRPSKLEEVKDGLGKCGVLGMTVSQVLGCGLQKGRTGIYRGHEYSINLLPKVRLEIIVVDELVDKVIDIIIKAARTGEVGDGKIFVLPVENALRIRTG 105
318 8.000e-51gi|300024810|ref|YP_003757421.1| nitrogen regulatory protein P-II [Hyphomicrobium denitrificans ATCC 51888]  clstr ali  62  4ITAVIKPFKLEEVRSALTDLALQGMTVTEVKGYGRQKGHTEIYRGAEYAVSFLPKIKIEVVVPAAQVDKAIAAIQRSAKTGQIGDGKIFVSPIEHTVRIRTG 105
319 9.000e-51gi|338972523|ref|ZP_08627896.1| nitrogen regulatory protein P-II [Bradyrhizobiaceae bacterium SG-6C]  clstr ali  63  4ITAVIKPFKLEEVRLALTAIGVHGMTVTEVKGFGRQKGHTEIYRGAEYIVNFLPKLRIEIAVGSDLADQAVEVITASARTGQIGDGKVFVTPIENAVRIRTG 105
320 9.000e-51gi|148242994|ref|YP_001228151.1| nitrogen regulatory protein P-II [Synechococcus sp. RCC307]  clstr ali  55  4VEAIIRPFKLDDVKMALVNAGIVGMTVTEVRGFGRQKGQVERYRGSEYTVEFLQKLKLEIVVDEPQVETVVNAVQEAARTGEIGDGKIFVSPVDSVVRIRTG 105
321 9.000e-51gi|339025064|ref|ZP_08646926.1| nitrogen regulatory protein PII [Acetobacter tropicalis NBRC 101654]  clstr ali  70  4VTAIIKPFKLDDVREALAPLGIQGLTVSEVKGFGRQKGQTEIYRGAEYRISFLPKIKVEIAVSDTLVDQVIEAVLDAAHTGKIGDGKIFVSELERVIRIRT. 104
322 9.000e-51JCVI_PEP_1096695796853 /source_dna_id=JCVI_ORF_1096695796852 /offset=0 /translation_table=11 /length=281 /full_length=281  ali  56  172IIAAIKPFKLEEVREALTAIGVRGMMVTEIKGFGSQSGHTEIYRGAEYAVNFVPKIKLEVVVGNDIAEQVVETIQTTAKTDKIGDGKIFVLDVEKTVRVRTG 273
323 1.000e-50gi|389578610|ref|ZP_10168637.1| nitrogen regulatory protein PII [Desulfobacter postgatei 2ac9]  clstr ali  66  4IEAIIKPFKLDDVKEALSEIGIYGMTVTEVNGYGRQKGHKEIYRGAEYVVDFVPKIKLEIVVTDDRLDETVETIRSATNSGKIGDGKIFVMPVEGAIRVRTG 105
324 1.000e-50gi|158520581|ref|YP_001528451.1| nitrogen regulatory protein P-II [Desulfococcus oleovorans Hxd3]  clstr ali  67  4IEAIIKPFKLDDVKNVLNELGIQGMTVTEVKGYGRQKGHTEIYRGAEYIVDFVPKIKLEVVVAASMADKVVDAIAKAALTGKVGDGKIFVMPVEQAVRVRTG 105
325 1.000e-50gi|119946647|ref|YP_944327.1| nitrogen regulatory protein P-II [Psychromonas ingrahamii 37]  clstr ali  69  5.TAIIKPFKLDEVREAIMNAGIAGVTVSEVKGFGRQKGHTELYRGAEYQVDFLPKVKLEIAIKTEDVERLVEAICAAANTGKVGDGKIFIHPLEQVVRIRTG 105
326 1.000e-50gi|15678691|ref|NP_275806.1| nitrogen regulatory protein P-II [Methanothermobacter thermautotrophicus str. Delta H]  clstr ali  51  7IVAIIRPEKLEEVKNALEAAGCHGMTVTEVRGRGRQLGITESYRGRDYRIDLLPKTKIEIVVNDEDVDTVVETIVKSAQTGDIGDGKIFISGVDEVVRIRTG 108
327 1.000e-50gi|406833388|ref|ZP_11092982.1| nitrogen regulatory protein P-II [Schlesneria paludicola DSM 18645]  clstr ali  62  4IEAVIRHFKLEEVKDALMEVGVQGMTVTEVRGFGRQKGQKEQYRGAEYSVDFLPKVKMEVVISDDQAKLVIETMIRTARTGQIGDGKIFVTDLEEMVRIRTG 105
328 1.000e-50gi|134300694|ref|YP_001114190.1| nitrogen regulatory protein P-II [Desulfotomaculum reducens MI-1]  clstr ali  48  4IEAIVRPGKLEDVKDALNKLGIHGMTVSQVIGCGHQKGRKEVYRGAEYSINLLPKVKVELIVKDNWVDKCVEVISEAAHSGEIGDGKIFLYPVTNVIRIRT. 104
329 1.000e-50gi|163794601|ref|ZP_02188572.1| nitrogen regulatory protein P-II 2 [alpha proteobacterium BAL199]  clstr ali  61  4VMAIIKPFRLDDVRAALSEAGVEGLTVSEIKGYGRQRGHTEIYRGAEYNIEFVPKVRLEIVVDDDMADKVVETIAHAAQTGRIGDGKIFVLDVLEAVRIRTG 105
330 1.000e-50gi|332982060|ref|YP_004463501.1| nitrogen regulatory protein P-II [Mahella australiensis 50-1 BON]  clstr ali  55  4IEAIIRPEKLDDVKEALNAYGIFGMTVTQVMGCGRQKGRKEVYRGVELNINLLPKIKIEVAANDQDVDKIIDVVSTAARTGQIGDGKIFVYDIENIIRIRTG 105
331 1.000e-50gi|404492628|ref|YP_006716734.1| nitrogen regulatory protein P-II [Pelobacter carbinolicus DSM 2380]  clstr ali  58  4IECIIKPFKLEDVKEALADMGISGMTVSEVRGFGRQKGHTELYRGAEYQIDFIPKIKVELVIAAERVNEVVNIVRNAAQTGTIGDGKIFVYDIEQTVRIRTG 105
332 1.000e-50gi|110833984|ref|YP_692843.1| nitrogen regulatory protein P-II [Alcanivorax borkumensis SK2]  clstr ali  73  5.TAVVKPFKADQVRDALAQVGVQGMTITEVKGFGRQKGHTELYRGAEYVVDFVPKVKLELAVSDEQLDQAIDVIMKAAGTGKIGDGKIFVTDLEQVIRIRTG 105
333 2.000e-50gi|90406824|ref|ZP_01215016.1| nitrogen regulatory protein GlnK [Psychromonas sp. CNPT3]  clstr ali  69  7...IIKPFKLDDVREAIMDAGIAGMTVSEVRGFGRQKGHTELYRGAEYQVDFLPKIKLEIAVKDEDVDLLIEAILGAANTGKVGDGKIFIQNLEKVVRIRTG 105
334 2.000e-50gi|291279856|ref|YP_003496691.1| nitrogen regulatory protein P-II [Deferribacter desulfuricans SSM1]  clstr ali  66  4IEAIIKPFKLDDVKEKLSELGVKGLTITEVKGFGRQKGHTELYRGAEYVIDFIPKIKIEVVVPDDIVQNVVEAIVGSAKTGRIGDGKVFILPVDEAVRIRTG 105
335 2.000e-50gi|303247033|ref|ZP_07333309.1| nitrogen regulatory protein P-II [Desulfovibrio fructosovorans JJ]  clstr ali  56  4IEAIIKPFKLDEVKDALDKIGIHGLTVTEVRGYGRQKGHIEAYRGVEYQVQFNAKVRLDIVVPDELAEKAVETIRTTANTGNIGDGKIFVYPVEGVVRIRTG 105
337 2.000e-50gi|323143863|ref|ZP_08078529.1| nitrogen regulatory protein P-II [Succinatimonas hippei YIT 12066]  clstr ali  62  4IEAIIKPFKLDSVREALTTIGINGLTVSDVRGYGRQKGHTELYRGAEYVLSFIPKIKVELAVKDEEVEKCIETIKKSAFTGKIGDGKIFVHTLDKVVRIRTG 105
338 2.000e-50gi|196232987|ref|ZP_03131836.1| nitrogen regulatory protein P-II [Chthoniobacter flavus Ellin428]  clstr ali  62  4IEAIIKPFKLEEVKSALQEVGVEGMTVTEGKGFGRQKGHTEIYRGSEYTIDFLPKLKLEVILPDDMIDTAVQAIIRSAQTGKIGDGKIFILPIEDAIRIRT. 104
339 2.000e-50gi|406893210|gb|EKD38334.1| hypothetical protein ACD_75C00772G0004 [uncultured bacterium]  clstr ali  61  4IEAIIKPFKLEAVKAALTEIGISGMTVSEVKGYGRQKGHKEMYRGAEYNVDFNPKIKIELVLAAGQVDKVVDAIRNAANTEKIGDGKIFVLPVEDVMRVRTG 105
340 2.000e-50gi|332290398|ref|YP_004421250.1| nitrogen regulatory protein P-II 2 [Gallibacterium anatis UMN179]  clstr ali  66  4VSAIIQPFRLDEVREALTDIGVHGITVSEVKGFGRQKGHTEIYRGSEYTIDFLPKIQIDIAVGDDLVENVIETIVEAAQTGRVGDGKIFILPLEQVVRIRT. 104
341 2.000e-50gi|406708294|ref|YP_006758646.1| Nitrogen regulatory protein P-II [alpha proteobacterium HIMB59]  clstr ali  69  4IEAIIKPFKLEDVKDALGEIGLSGLTVSEVKGFGRQKGHTELYRGAEYVVDFLPKVKIELVVDDKKYKEAIDVIIKQANTGKIGDGKIFVYEVTEAIRIRTG 105
342 2.000e-50gi|110635566|ref|YP_675774.1| nitrogen regulatory protein P-II [Chelativorans sp. BNC1]  clstr ali  68  4VMAIIKPFKLEAVREALTELGIQGLTVTEVKGYGRQKGHTEIYRGAEYAVSFLPKVKIEVAVDSDIADQAVQAIAGAAKTGQIGDGKIFVYSIEKAVRIRTG 105
343 2.000e-50gi|254282982|ref|ZP_04957950.1| nitrogen regulatory protein P-II [gamma proteobacterium NOR51-B]  clstr ali  82  4VTAVIKPFKLDDVRESLSQIGVQGITVSEVKGFGRQKGHTELYRGAEYVVDFLPKIKIEVAVKGDMVEQTIEAITKAAQTGKIGDGKIFISELEQAIRIRTG 105
344 2.000e-50gi|58424430|gb|AAW73467.1| nitrogen regulatory protein P-II [Xanthomonas oryzae pv. oryzae KACC 10331]  clstr ali  70  166IMAIVKPFKLDDVREALAGCGVAGITATEVKGFGRQKGHAELYRGAEYVVDFLPKVKIEVAVTDDQAERVVEAIVAAVGTGKIGDGKVFAYDLGTVVRIRTG 267
345 2.000e-50gi|414342437|ref|YP_006983958.1| nitrogen regulatory protein P-II, GlnK [Gluconobacter oxydans H24]  clstr ali  75  7VTAIIKPFKLDDVREALTPLGVQGLTVTEVKGFGRQKGQTEIYRGAEYHVSFLPKLKIEIAVADSVVEDVIEAIMTAARTGKIGDGKIMVSNLDQLIRIRTG 108
346 2.000e-50gi|406899539|gb|EKD42783.1| hypothetical protein ACD_73C00021G0002 [uncultured bacterium]  clstr ali  66  4IEAIIKPFKLDEVKEALSEMGIKGLTISEVKGFGRQKGHTELYRGAEYVVDFLPKVKMEIIVKDEDVTKIVEVIQKTASTGRIGDGKIFVIPVEAVIRIRTG 105
347 2.000e-50gi|253997655|ref|YP_003049719.1| nitrogen regulatory protein P-II [Methylotenera mobilis JLW8]  clstr ali  80  4VSAIIKPFKLDEVREALSIIGVQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKLEVAIKDELLDQVVDAIEKSAATGKIGDGKIFIFNLEEVYRIRTG 105
348 2.000e-50gi|410629866|ref|ZP_11340561.1| nitrogen regulatory protein P-II 1 [Glaciecola arctica BSs20135]  clstr ali  68  4IEAIIKPFKLEDVREALTEAGISGLTVTEVKGYGRQKGHTETYRGAEYKVDFLPKIKLEIVLTNDQVERCIEVITSKANTGKIGDGKIFVFEVERAIRIRT. 104
349 2.000e-50gi|294139785|ref|YP_003555763.1| nitrogen regulatory protein P-II [Shewanella violacea DSS12]  clstr ali  75  5VEAIIKPFKLDDVRESLAEIGITGMTVLEVKGFGRQKGHTELYRGAEYMVDFLPKVKIELVIQDELLDRAIEVIVDTARTGKIGDGKIFVTEIERVIRIRTG 106
350 2.000e-50gi|119899304|ref|YP_934517.1| PII-like signal transmitter protein GlnY [Azoarcus sp. BH72]  clstr ali  67  4ITAIIRPFKLDEVREALAHVGVTGLTVTEIKGFGRQKGHAELYRGAEYVVDFVPKVKLETVVADERLEATLEAIQAAAHTGKIGDGKMFVTTVDQTIRIRTG 105
351 3.000e-50gi|302877315|ref|YP_003845879.1| nitrogen regulatory protein P-II [Gallionella capsiferriformans ES-2]  clstr ali  82  4VTAIIKPFKLDEVREALSAIGVQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKLEAAIAADQLDSVLEVIEKAAQTGKIGDGKIFVQEIEQVIRIRTG 105
352 3.000e-50gi|312137330|ref|YP_004004667.1| nitrogen regulatory protein p-ii [Methanothermus fervidus DSM 2088]  clstr ali  58  4ITAIIRPEKLEVVKKSLEKIGYRGMTVTEVKGCGRQLGMTESYRGKEYRVDLLPKTKIEIVVEDDKVEEVIQTIRENAKTGNIGDGKIFISNIEDVIRVRTG 105
353 3.000e-50JCVI_PEP_1096700193223 /source_dna_id=JCVI_ORF_1096700193222 /offset=0 /translation_table=11 /length=161 /full_length=161  ali  60  52IIATIKPFKLEEVREALTELGVKGMMVTEIKGFGAQSGHTEIYRGAEYAVNFVPKVKLELVVDEGMADQVVETITNRAKTGKIGDGKIFVLDVGQAVRVRTG 153
354 3.000e-50gi|226329047|ref|ZP_03804565.1| hypothetical protein PROPEN_02950 [Proteus penneri ATCC 35198]  clstr ali  67  24IIAIIKPFKLEEVRELLSELGIKGMTISEVKGYGRQKGHAELYRGAEYEVNFLPKVKIELAICDEQLESVMQVIMQATDTGKVGDGKIFVFELLQAVRIRTG 125
355 3.000e-50gi|357635735|ref|ZP_09133613.1| nitrogen regulatory protein P-II [Desulfovibrio sp. FW1012B]  clstr ali  61  4IEAIVRPFKLDDVKEKLTEMGIRGMTVDAVKGFGRQRGHTEVYRGAEYTIDFVPKVKIELVVEDADVPRLVAAIREAAHTGEIGDGKIFVIPLGDAVRIRTG 105
356 3.000e-50gi|411118609|ref|ZP_11390990.1| nitrogen regulatory protein PII [Oscillatoriales cyanobacterium JSC-12]  clstr ali  58  19VEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFGRQKGQTERYRGSEYTVEFLQKLKIEIVVEDDQVDMVVDKIIVAARTGEIGDGKIFITPVDSIIRIRTG 120
357 3.000e-50gi|88800671|ref|ZP_01116231.1| regulatory protein, P-II 2, for nitrogen assimilation by glutamine synthetase, regulates GlnL (NRII) and GlnE (ATase)  clstr ali  82  4VTAIIKPFKLDDVREALSEVGVQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKIKLEIAIDDDKVDGVIDAVTGAAATGKIGDGKIFVSSLEQVIRIRTG 105
358 3.000e-50gi|221069563|ref|ZP_03545668.1| nitrogen regulatory protein P-II [Comamonas testosteroni KF-1]  clstr ali  80  4VIAIIKPFKLDEVREALSQIGVQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKLKIEAAIADDLVDAAIDAIEGAARTGKIGDGKIFVQALEQSIRIRTG 105
359 3.000e-50gi|254282707|ref|ZP_04957675.1| nitrogen regulatory protein P-II [gamma proteobacterium NOR51-B]  clstr ali  77  4VTTIIKPFKLDDVRGALADIGVNGVTVSEVKGFGRQRGHTELYRGAEYVVDFLPKLKLEVACADDQLDQIVEAIVAAANTGKIGDGKIFVTDLEQIIRIRTG 105
360 3.000e-50gi|218782920|ref|YP_002434238.1| nitrogen regulatory protein P-II [Desulfatibacillum alkenivorans AK-01]  clstr ali  65  4IEAIIKPFKVDDIKEALNEIGIKGMTLTEVKGYGRQKGHKEIYRGAEYVVDFIPKVRIEVVVEDEQAEQVVGTIREAANTGKIGDGKIFVIPVEDVVRVRTG 105
361 3.000e-50gi|333980687|ref|YP_004518632.1| nitrogen regulatory protein P-II [Desulfotomaculum kuznetsovii DSM 6115]  clstr ali  51  4IECIIRPGKLEDVKDALGRFGIHGMTVSQVIGCGLQKGRTEVYRGTEYSINLLPKIKVEIVIADKFVDEVVKLVTEAARTGEIGDGKIFTYPVENAIRIRTG 105
362 4.000e-50gi|317050253|ref|YP_004111369.1| nitrogen regulatory protein P-II [Desulfurispirillum indicum S5]  clstr ali  67  4IEAIIKPFKLDDVKEKLETIGIQGITVSEVKGLGRQKGHTELYRGAEYVIDFLPKVKIELIVADSAVEDAINVIMETARTGRIGDGKIFVLPVERVVRIRTG 105
363 4.000e-50JCVI_PEP_1096701303377 /source_dna_id=JCVI_ORF_1096701303376 /offset=0 /translation_table=11 /length=138 /full_length=138  ali  65  29VSAIIKPFKLQEVREALVEAGVEGLTITEVKGYGRQKGHTEMYRGAEYSVDTLPKIKLDILVDDEKTQNVIDVIVKTANTGKIGDGKIFISSVDDVIRIRTG 130
364 4.000e-50gi|392411909|ref|YP_006448516.1| nitrogen regulatory protein PII [Desulfomonile tiedjei DSM 6799]  clstr ali  67  4VEVIIKPFKLDDVKEALSAIGVQGMTVTEVKGFGRQKGHKEIYRGAEYLVDFLPKIKMEMVVATEMVDQVIEKVIAAARTGTIGDGKIFVMPVETVVRIRTG 105
365 4.000e-50gi|406891045|gb|EKD36774.1| PII-like protein signal transmitter protein GlnK [uncultured bacterium]  clstr ali  76  4VTAIIKPYKLSDVREALTTIGVNGVTVTEVKGFGRQKGHTEIYRGAEYVVEFLPKVKIEAAIPDELLNPVIEAIKKAAHTGQIGDGKVFVFDLEQVMRIRTG 105
366 5.000e-50gi|354559219|ref|ZP_08978470.1| nitrogen regulatory protein P-II [Desulfitobacterium metallireducens DSM 15288]  clstr ali  53  4IEAIIRPGKLDEVKNALSELGINGITISNVLGCGNQKGYTQIYRGQEVLTRLLPKVKLEVVTSDEKLEHVITTLIAAARTGQVGDGKIFISPIEEAIRIRTG 105
367 5.000e-50gi|392427641|ref|YP_006468635.1| nitrogen regulatory protein PII [Desulfosporosinus acidiphilus SJ4]  clstr ali  56  4IEAIIRPGKLDIVKDALSHHGVNGLTVTQVIGCGKQKGHTEVYRGVEYTIHLIPKVKIEIVVKDGDVDSVIQTIVKEARTGEIGDGKIFVTSVENAYTIRTG 105
368 5.000e-50gi|94264036|ref|ZP_01287836.1| Nitrogen regulatory protein P-II [delta proteobacterium MLMS-1]  clstr ali  61  4IEAIIKPFRLDEVKEALNQLGINGMTLTEVKGYGRQLGHTEIYRGAEYVVDFIPKVKLEIIVEAERCAAVVNCIREAANTGKIGDGKIFVTPVEEVIRVRT. 104
369 5.000e-50gi|83591894|ref|YP_425646.1| nitrogen regulatory protein P-II [Rhodospirillum rubrum ATCC 11170]  clstr ali  63  4IMAIIKPFKLDEVCEALTSLDVHGLTVSEVKGFGRQKGQTEIYRGAEYQVNFLPKVKIEVAVSDGLADLAVEAICNAARTDRIGDGKVFVYDLDKIVRIRTG 105
370 5.000e-50gi|51244780|ref|YP_064664.1| nitrogen regulatory protein P-II [Desulfotalea psychrophila LSv54]  clstr ali  57  6IEAIIKPFKLDDVKSALSEVGITGMTISEVRGYGRQKGHSEMYRGAEYVVEFVPKIKLEIVVSADRATEVVAKIREHAYTGKIGDGKIFVSPIEYAVRVRTG 107
371 6.000e-50gi|313673544|ref|YP_004051655.1| nitrogen regulatory protein p-ii [Calditerrivibrio nitroreducens DSM 19672]  clstr ali  67  4VEAIIKPFKLDEVKEKLTEIGIRGITITEVKGFGRQKGHTELYRGAEYVIDFIPKIKIEIVLPDEMVDDAIKVISEAAKTGRIGDGKIFVIPVESVVRIRTG 105
372 7.000e-50gi|149926022|ref|ZP_01914285.1| nitrogen regulatory protein P-II (GlnB, GlnK) [Limnobacter sp. MED105]  clstr ali  76  4ISAVIKPFKLDEVREALSAIGVQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIEAAVDDSLVDQACEAIEAAAKTGKIGDGKIFVFDLLSVTRIRTG 105
373 7.000e-50gi|308270948|emb|CBX27558.1| Nitrogen regulatory protein P-II [uncultured Desulfobacterium sp.]  clstr ali  66  4IEAIIKPFKLDDVKEALNEIGIHGMTVTEVKGYGRQKGHKEIYRGAEYVVDFIPKIKIEIVVEATMANNVVDTIIKAANTGKLGDGKIFVIPIEGAVRVRTG 105
374 7.000e-50gi|352080622|ref|ZP_08951561.1| nitrogen regulatory protein P-II [Rhodanobacter sp. 2APBS1]  clstr ali  66  4ITSVIRPYKLDEVRDALAHAGVSGITVTEVRGFGRQKGHTELYRGAEYVVDFLPKLKVEVVVPDELLDAVLEEIQRAARTGNVGDGKLFVTGVEQVIRIRTG 105
375 7.000e-50gi|303256501|ref|ZP_07342515.1| nitrogen regulatory protein P-II [Burkholderiales bacterium 1_1_47]  clstr ali  71  4IFAVFKPFKLDEVREALTEIGITGMTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVQIMAACPDGLIDIATETIRNAANTGKIGDGKIFVMPLEEVVRIRTG 105
376 7.000e-50gi|88858278|ref|ZP_01132920.1| Nitrogen regulatory protein P-II [Pseudoalteromonas tunicata D2]  clstr ali  71  4ISAIIKPFKLDDVREALSDLGVEGMTVVDVKGFGRQRGHTELYRGAEYQVDFIPKIKIEIATRSENLDRIVEAITKVASTGKIGDGKIFVYDLEQIVRIRTG 105
377 8.000e-50gi|357037932|ref|ZP_09099731.1| nitrogen regulatory protein P-II [Desulfotomaculum gibsoniae DSM 7213]  clstr ali  48  4IEAIIRPDKLEDVKEALSRYGIHGMTVSQVLGCGTQRGWVGVYRGHEYSINLLPKIKIEVVLDERCLEDVLQIICETARTGEVGDGKVFIYPVEKAVRIRTG 105
378 8.000e-50gi|402850754|ref|ZP_10898943.1| Nitrogen regulatory protein P-II [Rhodovulum sp. PH10]  clstr ali  66  4VIAVIKPFKLDEVHEALTRIGVSGMTVAEVKGYGRQKGHTEIYRGAEYAVSFLPKVRIDVVVPADRVEAVIEAITSTARTGQIGDGKIFVTPIDRAMRIRTG 105
380 8.000e-50gi|375087004|ref|ZP_09733395.1| hypothetical protein HMPREF9454_02006 [Megamonas funiformis YIT 11815]  clstr ali  50  7IEIITRASKLEELKEALNKIGVQGMTVSQVYGCGLQKGHTEVYRGKQYSVNLVPKVKIETIVCAVPVELVLETARKALQTGHIGDGKIFVYDVENAMRIRTG 108
381 8.000e-50gi|427420047|ref|ZP_18910230.1| nitrogen regulatory protein PII [Leptolyngbya sp. PCC 7375]  clstr ali  54  4IEAIIRPFKLDEVKIALVNAGVVGMTVSEVRGFGRQKGQTERYRGSEYTVEFLQKLKVEIVVDDDQVDAIVDQVISAARTGEIGDGKIFVTPVNEVVRIRTG 105
382 9.000e-50gi|89091841|ref|ZP_01164796.1| Nitrogen regulatory protein P-II [Neptuniibacter caesariensis]  clstr ali  78  4VSAVIKPFKLDDVREALSEIGVQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVRVDAAVASDIVDQVVEAISSAAQTGKIGDGKIFVSEIEQVVRIRTG 105
383 9.000e-50gi|294139534|ref|YP_003555512.1| nitrogen regulatory protein P-II [Shewanella violacea DSS12]  clstr ali  74  8VSAIIKPFKLDDVREAIAGVGIEGMTVTEVKGFGRQKGHTELYRGAEYQVDFLPKVKLDIATKAENLELLIESITNAARTGKIGDGKIFVTDLEQVIRIRTG 109
384 1.000e-49gi|410447684|ref|ZP_11301776.1| nitrogen regulatory protein P-II [SAR86 cluster bacterium SAR86E]  clstr ali  74  4VTAIIKPFKLEEVRQSLDLIGITGMTITEVKGFGRQKGHTELYRGAEYVIDFLPKIKVEIAVSIEQLEDVIEAITKSASTGKIGDGKIFVSTLDQVIRIRTG 105
385 1.000e-49gi|296122521|ref|YP_003630299.1| nitrogen regulatory protein P-II [Planctomyces limnophilus DSM 3776]  clstr ali  58  4IEAVLRHYKLEDVKNALTQIGIQGMTVTEVRGFGRQRGHKETYRGAEYTVDFLPKVKLEVVVSDTEVAKAIETITNVARTGQIGDGKIFVTSLAEVVRIRTG 105
386 1.000e-49gi|427430944|ref|ZP_18920640.1| Nitrogen regulatory protein P-II [Caenispirillum salinarum AK4]  clstr ali  70  4VTAIIKPFRLDDVREALLDLGLQGLTVTEVRGFGRQKGQTEVYRGAEYEVSFLPKVKVEVAVEDDLEDKVIEAVREAAHTGKIGDGKIFVTEVARTVRIRTG 105
387 1.000e-49gi|167038062|ref|YP_001665640.1| nitrogen regulatory protein P-II [Thermoanaerobacter pseudethanolicus ATCC 33223]  clstr ali  48  4IECIIRPEKLEEVKDTLNQLGIKGMTVSQVMGCGLQKGKTEYYRGVAININLLPKIKLELIVKDSEVDRIVDTIIKVARSGKIGDGKIFIYNVEDAVRIRTG 105
389 1.000e-49JCVI_PEP_1096698843785 /source_dna_id=JCVI_ORF_1096698843784 /offset=0 /translation_table=11 /length=423 /full_length=423  ali  71  314IEAIIKPFKLDEVKEALQDAGIQGLSVLEVKGFGRQKGHTELYRGAEYVVDFLPKIKIEVVLPDSQADAAVEAIIEAAKTDKIGDGKIFVSDVQQAIRIRTG 415
390 1.000e-49gi|34556838|ref|NP_906653.1| nitrogen regulatory protein P-II [Wolinella succinogenes DSM 1740]  clstr ali  62  4IEAIIKPFKLDDVKNALTELGVTGMTVTEVKGYGRQQGHTELYRGAEYVVDFIPKIKIEIVVGDGEADKIVDTIVATAKTGKIGDGKIFVTDVSKVVRVRTG 105
391 1.000e-49gi|296132226|ref|YP_003639473.1| nitrogen regulatory protein P-II [Thermincola potens JR]  clstr ali  53  4IEAIIRPSKLDEIKEALGKFGIHGMTVTEVIGCGLQKGKKEVYRGTEYTIDLLPKIKVEIVIRDKWVDEVIRILVNTARTGEIGDGKIFVYPIENAVRIRTG 105
392 1.000e-49gi|182414293|ref|YP_001819359.1| nitrogen regulatory protein P-II [Opitutus terrae PB90-1]  clstr ali  67  4IIAIIKPFKLEEVKAALAEINVEGMTVSEVKGFGRQKGHTEIYRGSEYTVDFLPKVKIEVATTDAQAPRAVEAIIKSAKTGKIGDGKVFVLPVEEVIRIRT. 104
393 1.000e-49gi|357386326|ref|YP_004901050.1| nitrogen regulatory protein P-II [Pelagibacterium halotolerans B2]  clstr ali  61  5.IAIIKPSRLEEVRQALNSLDVHGMTVTEVKGYGRQKGHSEIYRGTEYAVHFLPKLKVEIAVDAAQVDAVASAIKDSAQTGRIGDGKIFILDLEQAIRIRTG 105
394 1.000e-49gi|333909974|ref|YP_004483707.1| nitrogen regulatory protein P-II [Methanotorris igneus Kol 5]  clstr ali  51  4IEAIIRPSKLEDVKSALFKAGCKGLTVSEVKGRGVQGGIVERYRGREYVVDLLPKVKIEIVVDDANVEKIIDIICENAKTGEFGDGKIFVIPVEEVVRVRTG 105
395 1.000e-49gi|114778175|ref|ZP_01453062.1| nitrogen regulatory protein P-II (GlnB, GlnK) [Mariprofundus ferrooxydans PV-1]  clstr ali  67  4IEAVIKPFKIDDVKDALSEKGIDGMTITEVKGHGRQKGHTELYRGAEYVVDFVPKVKVEVIVDDSRLEEALAAICDAARTGKVGDGKIFVSSVEQVIRIRTG 105
396 1.000e-49gi|116626229|ref|YP_828385.1| nitrogen regulatory protein P-II [Candidatus Solibacter usitatus Ellin6076]  clstr ali  56  4IEAIIQPFKLDEVKEALKSIGIDGMTITDVRGHGRQKGHKEVYRGQEYNVDLLPKVKLELVVPSDRADEVIKTLIQSARTGKIGDGKVFVFDIAEAIRIR.. 103
397 1.000e-49gi|120602874|ref|YP_967274.1| nitrogen regulatory protein P-II [Desulfovibrio vulgaris DP4]  clstr ali  65  8.EIIIRPFKLDEVKEVLASMDVKGMTVTEVKGFGRQRGHKEVYRGAEYQVDFMPKVKIEVVLEDAQVKAVVDAVCKAARTGKVGDGKIFVLPVDDAIRIRTG 108
398 1.000e-49gi|78357353|ref|YP_388802.1| nitrogen regulatory protein P-II [Desulfovibrio alaskensis G20]  clstr ali  61  4VEIIIRPFKLDEVKESLTELDIKGMTVSEVKGFGRQRGHKEVYRGAEYQVDFMPKAKIEVVVEDDQVQSVVETVMKAARTGKVGDGKIFIIPVDDVVRIRTG 105
399 2.000e-49gi|253990879|ref|YP_003042235.1| Nitrogen regulatory protein P-II 2 [Photorhabdus asymbiotica]  clstr ali  70  9ITTIVKPFKLEDIREALSLLGVQGLTITEVKGFGRQKGHAELYRGAEYNVNFLPKVKIDIAVADELVEEVIHAIQQSAFTGKVGDGKIFVTELQQAIRIRTG 110
400 2.000e-49gi|330991761|ref|ZP_08315711.1| Nitrogen regulatory protein P-II 2 [Gluconacetobacter sp. SXCC-1]  clstr ali  67  26VIAIIKPFKLDEVREGLHSIGVDALTATEVKGYGRQKGQTEIYRGAEYNIQFLPKIKLEIAVPATQCDKVVEVIQSAACTGKIGDGKIFVLDLQQAIRIRT. 126
401 2.000e-49gi|424865713|ref|ZP_18289569.1| nitrogen regulatory protein P-II [SAR86 cluster bacterium SAR86B]  clstr ali  63  4VTAIIKPFKLQEVREALVSAGIEGLTITEVKGYGRQKGHTEMYRGAEYSVDTLPKIKLEILVSEEQLETATDTITKTAQTGKIGDGKIFVTSVDQVTRIRTG 105
402 2.000e-49JCVI_PEP_1096677162715 /source_dna_id=JCVI_ORF_1096677162714 /offset=0 /translation_table=11 /length=140 /full_length=140  ali  65  31IVAIIKPHKLDDVRDALAGVGIEGMTASEVKGYGRQKGQTEIYRGAEYQVSFVPKVKIEVAVDDSVADSVVEAIRGAANTDKIGDGKIFVLELANAVRVRTG 132
403 2.000e-49gi|149178336|ref|ZP_01856928.1| nitrogen regulatory protein P-II (GlnB, GlnK) [Planctomyces maris DSM 8797]  clstr ali  56  4IQAIIRHYKLEEVKNAISEIGISGMTVSEVRGFGRQRGHKETYRGNEYIVDFLPKVKLEIVVQDDMVPKTIETITQVARTGQIGDGKIFITSLDEVIRIRTG 105
404 2.000e-49JCVI_PEP_1096699126995 /source_dna_id=JCVI_ORF_1096699126994 /offset=0 /translation_table=11 /length=140 /full_length=140  ali  65  31IEAIIKPFKLDEVKEGLQSIGVSGITVLEAKGVGRQKGHTELYRGAEYVIDFLPKIKIEVVVSDTLAPEVIEFIRESAHTGKIGDGKIFITDIQDVVRIRTG 132
405 2.000e-49gi|94496010|ref|ZP_01302589.1| nitrogen regulatory protein P-II [Sphingomonas sp. SKA58]  clstr ali  64  4VMAIIKPFKLDDVREALSSLGIAGMTVSEVKGFGRQKGQTEIYRGAEYSTNMVPKIKIEVVCDDDLAPRVVEATQAAANSGAIGDGKIFVLDVGQAVRIRTG 105
406 2.000e-49gi|148554834|ref|YP_001262416.1| nitrogen regulatory protein P-II [Sphingomonas wittichii RW1]  clstr ali  68  4VIAIIKPFKLDEVRESLSSLGVQGMTVTEVKGFGRQKGQTEIYRGAEYSTNMVPKIKIEVVTTDDLANRVVEAIQQSANTGAIGDGKIFVLDVAQAVRIRTG 105
407 2.000e-49gi|158520569|ref|YP_001528439.1| nitrogen regulatory protein P-II [Desulfococcus oleovorans Hxd3]  clstr ali  60  4IEAIIKPFRLDDVKTALNEAGVTGMTITEVKGFGRQRGHTEIYRGAEYQVDFIPKIKLEVITDDEMSEKVVSIILEKASSGKIGDGKIFVLPVEGVVRIRTG 105
408 2.000e-49gi|196234240|ref|ZP_03133071.1| nitrogen regulatory protein P-II [Chthoniobacter flavus Ellin428]  clstr ali  64  4IEAIIKPFKLEEVKDALADIGVEGMTVTEVKGFGRQKGHTEIYRGSEYTVDFLPKIKVDVVVPDSLAENATDVIVKAAKTGKIGDGKVFISAVEEAVRIRT. 104
409 2.000e-49gi|159904123|ref|YP_001551467.1| nitrogen regulatory protein P-II [Prochlorococcus marinus str. MIT 9211]  clstr ali  53  4IEAIIRPFKLEDVKVALVNSGIVGMTVSEVRGFGRQKGQVERYRGSEFTVEFLQKLKIEIVVADESVPTVLTAIAEAAKTGEIGDGKIFISPVESVVRIRTG 105
410 2.000e-49gi|392423988|ref|YP_006464982.1| nitrogen regulatory protein PII [Desulfosporosinus acidiphilus SJ4]  clstr ali  51  4IEAIIRPEKLNDVKTALSDLGINGMTVSNVSGFGNQKGYTQFYRGQEIVSKLLPKIKLEVVVTSVKVDEVITALVESSKTGKFGDGKIFVYDVADAIRIRTG 105
412 3.000e-49gi|374299914|ref|YP_005051553.1| nitrogen regulatory protein P-II [Desulfovibrio africanus str. Walvis Bay]  clstr ali  57  4IEIIIRPFKLDEVKTALAGIGIQGMTVTEVKGFGRQRGHKEVYRGAEYQVDFVAKAKIEVVVEDALVPSVVDTACMAARTGQVGDGKIFVSPVDETVRIRTG 105
413 3.000e-49gi|217978021|ref|YP_002362168.1| nitrogen regulatory protein P-II [Methylocella silvestris BL2]  clstr ali  66  4VVAIIKPFKLDEVRDALTTLGVHGMTVTEVKGYGRQKGHTEIYRGAEYAVSFLPKLKVEVAIAPELVAATVDAIATAARTGQIGDGKIFVSGLDQAVRIRTG 105
414 3.000e-49gi|254466697|ref|ZP_05080108.1| nitrogen regulatory protein P-II [Rhodobacterales bacterium Y4I]  clstr ali  59  4IIAAIKPFKLDEVREALTSLGVSGLMVTEIKGFGAQAGHTEIYRGAEYEVNFVPKLKLELVVPADQAEAAVSAITETARTGKIGDGKIFVLDVEQAVRVRTG 105
415 3.000e-49gi|328952213|ref|YP_004369547.1| nitrogen regulatory protein P-II [Desulfobacca acetoxidans DSM 11109]  clstr ali  57  4IEAIIQPFKLESVKEALHQINIQGMTVTEVKGFGQQKGMREVYRGMEYQVDFIPKVKIEIVAPDDKVVAIVQAIQEQARTGRIGDGKIFVYPVSEAIRLRTG 105
417 3.000e-49gi|119503717|ref|ZP_01625799.1| Nitrogen regulatory protein PII [marine gamma proteobacterium HTCC2080]  clstr ali  77  4VTAIIKPFKMDDVRAALSDVGVQGVTVTEVKGFGRQRGHTELYRGAEYVVDFLPKLKLEVACAGDQVDGVVEAIISAAGTGKIGDGKIFVSELEQVIRIRTG 105
418 3.000e-49gi|328947136|ref|YP_004364473.1| ammonium transporter [Treponema succinifaciens DSM 2489]  clstr ali  41  471VVIITRQNKFNALKAAMNSIGVTGMTVINVMGCGMQKGASEYYRGVPVEINLLPKIKVEIVVSKVPVATVVESAKKALYTGHIGDGKIFVYPVENVIKVRTG 572
419 3.000e-49gi|154251757|ref|YP_001412581.1| nitrogen regulatory protein P-II [Parvibaculum lavamentivorans DS-1]  clstr ali  69  4VMAIIKPFKLDEVREALTAIGVQGLTVTEVKGYGRQKGQTEIYRGAEYAVNFLPKLKIEVVVATDQTDAVVSAISGAAKTGQIGDGKIFVISVEQVLRIRTG 105
420 3.000e-49gi|402570902|ref|YP_006620245.1| nitrogen regulatory protein PII [Desulfosporosinus meridiei DSM 13257]  clstr ali  51  4IEAIIRPEKLNDVKVVLSDLGVNGMTVSNVSGFGNQKGYTQIYRGQEIVTRLLPKIKLEAVVSSNKVDEVIAAIIKTSKTGEFGDGKIFVYDVADAVRIRTG 105
421 3.000e-49gi|332530578|ref|ZP_08406515.1| nitrogen regulatory protein P-II [Hylemonella gracilis ATCC 19624]  clstr ali  66  4ITAIIKPFRVEEVREALAACGVTGLTVTEVKGFGRQKGHTEVYRGAEYAVDFLPKVKIEAVVPTVIVDQCIDAIVKVARTGKIGDGKIFVTSVERVVRIRTG 105
422 3.000e-49gi|212711951|ref|ZP_03320079.1| hypothetical protein PROVALCAL_03026 [Providencia alcalifaciens DSM 30120]  clstr ali  64  4IIAIIKPFKLEDVREALTELGIQGMTICEVKGYGRQKGHSELYRGAEYEVSFLPKTKMEIAISDDLLEPALDAIMRTADTGKVGDGKLFVFELLQAVRIRT. 104
423 4.000e-49JCVI_PEP_1096675146519 /source_dna_id=JCVI_ORF_1096675146518 /offset=0 /translation_table=11 /length=135 /full_length=135  ali  67  26IQAIIKPFKLDEVRDALQEIDIAGVTVTEAKGFGRQKGHTELYRGAEYSVDFLPKILLDIIVEDGKLQEACDAIKKAAYTGKIGDGKIFITSIDEAIRIRTG 127
424 4.000e-49gi|254481277|ref|ZP_05094522.1| nitrogen regulatory protein P-II [marine gamma proteobacterium HTCC2148]  clstr ali  74  5.TAIIKPFKLDDVREALQQVGIAGMTVEEVKGYGRQKGHTELYRGAEYLVEFQPKVKIQIAVSDGQLDAAIDAVCKAAATGKIGDGKIFVAPLEQGIRIRTG 105
425 4.000e-49gi|42521892|ref|NP_967272.1| regulatory protein P-II for glutamine synthetase [Bdellovibrio bacteriovorus HD100]  clstr ali  67  4IEAIIKPFKLDDVVDALSEVGVEGITVSEVRGFGRQKGRTEVYKGAEYVVDFLPKIKIEVVLPTALVDSAVEAIRKTAHTGKIGDGKIFVLPVDSALRIRTG 105
426 4.000e-49gi|391231473|ref|ZP_10267679.1| nitrogen regulatory protein PII [Opitutaceae bacterium TAV1]  clstr ali  66  4IIAIIKPFKLEEVKEALSAVGIEGMTVTEVKGFGRQKGHTEIYRGSEYTVDFLPKVKIEIVVGDDVVAKTVEAVVKAAKTGKIGDGKVFVVPVEDTIRIRT. 104
427 4.000e-49gi|196234241|ref|ZP_03133072.1| nitrogen regulatory protein P-II [Chthoniobacter flavus Ellin428]  clstr ali  62  4IEAIIKPFKLEDVKGALTDIGAEGMTVSEVKGFGRQKGHTEIYRGSEYTVDFLPKVKLEIVTTDALAEKVVEAIIAAAKTGKIGDGKVFVYTIDKSYRIRT. 104
428 4.000e-49gi|374381327|ref|ZP_09638916.1| nitrogen regulatory protein P-II [Desulfitobacterium dichloroeliminans LMG P-21439]  clstr ali  55  4IEAIIRPGSLDDVQAALDRFGVSGLTVTQVIGCGNQKGHTQVYRGVEYKVYLLPKVKIEVVVKDELVEQLLAIITQAARSGEVGDGKIFVYPVEQAVRIRTG 105
429 4.000e-49gi|402851805|ref|ZP_10899934.1| Nitrogen regulatory protein P-II [Rhodovulum sp. PH10]  clstr ali  68  4VIAVIKPFKLDEVRDALTAIGVQGMTVTECKGYGRQKGQTEIYRGAEYAVSFLPKVKLEIAIDDAIADKVVEAIGKSARTGQIGDGKIFIFDLEAAGRIRTG 105
430 5.000e-49gi|258542844|ref|YP_003188277.1| nitrogen regulatory protein PII [Acetobacter pasteurianus IFO 3283-01]  clstr ali  67  4VTAIIKPFKLDDVREALAPLGIQGLTVSEVKGFGRQRGQTEIYRGAEYRISFLPKIKVEIVIKDDMEDMVVEAIATAAHTGKIGDGKIFVSDISRAVRIRT. 104
431 5.000e-49gi|291287592|ref|YP_003504408.1| nitrogen regulatory protein P-II [Denitrovibrio acetiphilus DSM 12809]  clstr ali  65  4IEAVIKPFKLDDVKEKLTEIGIRGITISEVKGFGRQKGHTELYRGAEYVIDFIPKIKIEVVVSDEMVAQAVEVITEAAKTGRIGDGKIFIIPIDEVIRIRTG 105
432 5.000e-49gi|384171147|ref|YP_005552524.1| nitrogen regulatory protein [Arcobacter sp. L]  clstr ali  62  4IEVIIKPFKLEDVKDALVEAGITGMSVYDVKGYGRQQGHSELYRGAEYVVDFLPKIKIDVVVKDEMVETVINAIVNSAKTGKIGDGKIFVSSLDEVVRIRT. 104
433 5.000e-49gi|147677000|ref|YP_001211215.1| nitrogen regulatory protein PII [Pelotomaculum thermopropionicum SI]  clstr ali  50  4IECILRPGKLEDVKEAINRYGIHGMTVTQVMGCGLQKGRTEVYRGTEYSINLLPKVKIEMVVPDKDVDSIVALIIEAARTGEIGDGKIFTCRIDNAIRIRTG 105
434 5.000e-49JCVI_PEP_1096679126605 /source_dna_id=JCVI_ORF_1096679126604 /offset=0 /translation_table=11 /length=148 /full_length=148  ali  59  39IEAVIKPFKLDEVKEALHELGLNGITVTEVRGFGRQRGDSGRYLGEEYIVDLLPKVKIELVVDDSNVEASIATIIHAAQSGKPGDGKIFVLPVEDAIRIRTG 140
435 5.000e-49gi|407791074|ref|ZP_11138162.1| nitrogen regulatory protein P-II [Gallaecimonas xiamenensis 3-C-1]  clstr ali  71  4VTAIIKPFKLDDVREALTETGVHGLTVSEVRGFGRQRGHTELYRGAEYRIDFLPKVQLDILVTASQVDLVIDAILKAAQTGKVGDGKIWVQDLETVVRIRT. 104
436 5.000e-49gi|366164425|ref|ZP_09464180.1| ammonium transporter [Acetivibrio cellulolyticus CD2]  clstr ali  48  560VTIITRQNKFEALKAALNEIGIAGITVTQVLGCGIQKGKTEFYRGVEVEMNLLPKVQIDIIVSKVPVRQVIETAKKVLYTGNIGDGKIFIYDVENVVRVRTG 661
437 6.000e-49gi|144899275|emb|CAM76139.1| Nitrogen regulatory protein PII [Magnetospirillum gryphiswaldense MSR-1]  clstr ali  63  4IIAIIKPFKLDEVREALTQLGIQGLTATEVKGFGRQKGQTEIYRAAEYVVSFVPKIKIELVVNDDVVDRAVEAIQAAARTDKIGDGKIFVMDVAHALRIRTG 105
438 6.000e-49gi|389580175|ref|ZP_10170202.1| nitrogen regulatory protein PII [Desulfobacter postgatei 2ac9]  clstr ali  58  4VVAVIKPFKVDEVKDALSKISINGMTISEVKGFGRQKGHKEVYRGAEYQTDFVPKVELKICVADDQAQAVVDTIVKTAKTGKIGDGKIFVLPVENVVRIRTG 105
439 6.000e-49gi|195953310|ref|YP_002121600.1| nitrogen regulatory protein P-II [Hydrogenobaculum sp. Y04AAS1]  clstr ali  61  4VEAIIKPFKLDEVKDALVEIGIGGMTITEVKGFGQQKGKTEIYRATEYVIDFLPKIKIETVVKDSEVEKVVQTILKSAQTGKVGDGKIFIYNVEETVRIRTG 105
440 6.000e-49gi|402574693|ref|YP_006624036.1| nitrogen regulatory protein PII [Desulfosporosinus meridiei DSM 13257]  clstr ali  55  4IEAIIRPGKLDNVKDALGSNGVNGLTVTQVIGCGKQKGNTQVYRGVEYTIHLIPKVKIEVVVRDTDVDKVIEIITKIARTGEIGDGKIFVSSVENVYTIRTG 105
441 7.000e-49gi|336176219|ref|YP_004581594.1| nitrogen regulatory protein P-II [Frankia symbiont of Datisca glomerata]  clstr ali  59  6VTAVIKPFRLEDVKTALENLGIHGLTISEVQGFGRQKGHTEVYRGAEYKVDFVPKIKIEILVEDDAVEELVTAITTSAQTGKIGDGKIWVVPVETVLRVRTG 107
442 7.000e-49gi|397689433|ref|YP_006526687.1| nitrogen regulatory protein P-II [Melioribacter roseus P3M]  clstr ali  55  4IEAIIRPFKLDEVKEALLEVGVRGMTITEVRGYGRQKGHKETYRGSEYQIEFVPKIKLEVVVDESIFEKAIDAILTTAKTGQVGDGKIFISDISDAIRIRT. 104
443 7.000e-49gi|258406388|ref|YP_003199130.1| nitrogen regulatory protein P-II [Desulfohalobium retbaense DSM 5692]  clstr ali  53  4IEIITRPFKLDEVKQRLTKLGIQGMTVTEVKGFGRQRGHKEIYRGAEYQVDFVAKVKIEIVVDDGLVEEIVSTVQEGARTGKVGDGKIFISPVDNAVRIRTG 105
444 7.000e-49gi|225872574|ref|YP_002754029.1| Nitrogen regulatory protein P-II [Acidobacterium capsulatum ATCC 51196]  clstr ali  57  4IEAVIQPSKLDAVKDALLEAGIEGMTILEARGHGRQKGHTEFYRGREYTVDLLPKIKIEAVVVDELLDKAIDAILSAARTGKIGDGKIFVTKIDEAIRIR.. 103
445 7.000e-49gi|256830810|ref|YP_003159538.1| nitrogen regulatory protein P-II [Desulfomicrobium baculatum DSM 4028]  clstr ali  60  4VEIITRPYKLDEIKEALTSMGIQGMTVTDVRGFGRQRGHKEVYRGAEYQVDFVSKVKIEIVIDDDLLDQTLEVIQQAAKTGKIGDGKIFVSTIDNAIRIRTG 105
446 7.000e-49gi|390449720|ref|ZP_10235323.1| nitrogen regulatory protein P-II [Nitratireductor aquibiodomus RA22]  clstr ali  67  4VMAIVKPFKLEAVREALTGLGIQGLTVTEVKGYGRQKGHTEIYRGAEYAVTFLPKVKIEVAVDSDMVDQVVEAIVEAARTGQIGDGKVFVHALDRAVRIRTG 105
447 7.000e-49gi|37519825|ref|NP_923202.1| nitrogen regulatory protein P-II [Gloeobacter violaceus PCC 7421]  clstr ali  56  4IEAIIRPFKLDEVKIALVNAGIIGMTVSEVRGFGRQKGQTERYRGSEYTVEFLQKLKIEVVVDDGLVDLVMDKIMVAARTGEIGDGKIFVSDVDRVVRIRTG 105
448 8.000e-49gi|167629325|ref|YP_001679824.1| nitrogen regulatory protein p-ii [Heliobacterium modesticaldum Ice1]  clstr ali  54  4IEAIIRPTKLDEVKEALNRIGVRGMTVTQVAGCGLQKGKKGFYRGSEYTIDLLPKVKIEVVVADSLVDDLLKVITDQVRSGEIGDGKIFVSPIENVVRIRTG 105
449 9.000e-49gi|134300696|ref|YP_001114192.1| nitrogen regulatory protein P-II [Desulfotomaculum reducens MI-1]  clstr ali  45  4IEAIIRPSKLEEIKKVLDKYGIKGMTVSQVMGCGNQKGRVNVYRGQEYTINLLPKIKVEIILTDLRVEEVVDQIVRTARTGEVGDGKIFIYPVENAIRIRTG 105
450 9.000e-49gi|428316052|ref|YP_007113934.1| nitrogen regulatory protein P-II family [Oscillatoria nigro-viridis PCC 7112]  clstr ali  57  22VEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFGRQKGMTERYRGSEYTVEFLQKLKVEIVVENDQVDMVVDKIIAASRTGEIGDGKIFISPVEQIIRIRTG 123
451 9.000e-49gi|291288149|ref|YP_003504965.1| nitrogen regulatory protein P-II [Denitrovibrio acetiphilus DSM 12809]  clstr ali  54  4IKAIVKPHMLDEVKDALNTLGVTGMTVFEVKGYGRQKGHHELYRGAEYQIDFVPKVMLETVVSDEIAGECVKVISEAAKTGKIGDGKVFVLDVADALRIRTG 105
452 9.000e-49gi|298529267|ref|ZP_07016670.1| nitrogen regulatory protein P-II [Desulfonatronospira thiodismutans ASO3-1]  clstr ali  60  5.EIITRPFKVEAVKEALAGMGIKGMTLTDVKGFGRQMGHKEIYRGAEYDVDFLPKVKIEVILDDANVDQAVEAAIKAARTDKVGDGKIFVYSVENAIRIRTG 105
453 9.000e-49gi|99082469|ref|YP_614623.1| nitrogen regulatory protein P-II [Ruegeria sp. TM1040]  clstr ali  59  4IIAAIKPFKLEEVREALTKLGVSGLMVTEIKGFGAQAGHTEIYRGAEYEVNFVPKVKLEIVVPSDLADQVVETITQASRTGKIGDGKIFVLDVAQAVRVRTG 105
454 9.000e-49gi|325289947|ref|YP_004266128.1| nitrogen regulatory protein P-II [Syntrophobotulus glycolicus DSM 8271]  clstr ali  51  4IEAIVRPAKLEEVKEALGKFGVKGMTVTSVIGCGLQQGKTEVYRGSTYTINLLPKVKLEIIVPDDLVDKVIDIIVKNAKTGEIGDGKIFVYDVLNAVRIRT. 104
455 9.000e-49gi|347736258|ref|ZP_08868944.1| nitrogen regulatory protein P-II, GlnK [Azospirillum amazonense Y2]  clstr ali  62  4VVAVLKPFKLDEVREALADMGHLGVTVSEVRGCGRQQGRTEIYRGAEYAMNFLPKVKIEVAVPDDQMESVVEAIQATANTGRIGDGKIFVMTIADAVRIRTG 105
456 9.000e-49gi|410446527|ref|ZP_11300630.1| nitrogen regulatory protein P-II [SAR86 cluster bacterium SAR86E]  clstr ali  65  4VVAIIKPFKLQEVREALVDAGIEGLTLSEVKGYGRQKGHTELYRGAEYTVDTLPKIKLEILVEDEKLSTVTDTITSTAGTGKIGDGKIFVTNVEDVIRIRTG 105
457 1.000e-48gi|405982700|ref|ZP_11041011.1| hypothetical protein HMPREF9451_00086 [Slackia piriformis YIT 12062]  clstr ali  45  4IEAIVRPTKLEALKEELLSAGLKGMTISQVQGCGKQHGWKEYYRGSEVLVNMLPKVMVSVVVDDAQVKEMVEAICRIARTGDVGDGKIFILPVEDVVRIRTG 105
458 1.000e-48gi|260753000|ref|YP_003225893.1| nitrogen regulatory protein P-II [Zymomonas mobilis subsp. mobilis NCIMB 11163]  clstr ali  62  4IEVVIKPFKLEDVKAALTDAGISGITVTETRGYGRQKGHTELYRGAEYVVDFLPKVKLETVVPDELVENVVEAVTVAARTGRIGDGKIFISDVLDAIRIRTG 105
459 1.000e-48gi|328951751|ref|YP_004369085.1| nitrogen regulatory protein P-II [Desulfobacca acetoxidans DSM 11109]  clstr ali  58  4IEAVIQPFKLEPVKEALHKLSIQGMTVTEVKGFGRQKGIREVYRGMEYQVDFLPKVKIEVVLPDDKVEIITKAIIEQARTGRIGDGKIFVYPVSEVIRIRTG 105
460 1.000e-48gi|85709651|ref|ZP_01040716.1| nitrogen regulatory protein P-II [Erythrobacter sp. NAP1]  clstr ali  63  4IIAIIKPFKLDEVREALGSIGVAGMTVSEVKGFGRQKGQTEIYRGAEYSTNMLPKVKLEIAASDDIAPQVVETIQQTANTEAIGDGKIFVLDLASATRIRTG 105
461 1.000e-48gi|239905900|ref|YP_002952639.1| nitrogen regulatory protein P-II [Desulfovibrio magneticus RS-1]  clstr ali  57  4IEAIIKPFKLDEVKDALDNLGIHGLTVTEVRGYGRQKGHVEAYRGIEYQVQFNAKVKIEIVTADELAEQVVAAIRAAANTGAIGDGKIFIYPVEGVMRIRTG 105
462 1.000e-48gi|118594252|ref|ZP_01551599.1| Nitrogen regulatory protein P-II [Methylophilales bacterium HTCC2181]  clstr ali  78  4VTAIIKPFKLDEVREALSEIGVQGITVTEVKGFGRQKGHTELYRGAEYVIDFLPKVKLEVAVSDKILKKVVGAIEKSAATGKIGDGKIFVMSLDEVKRIRTG 105
463 1.000e-48gi|307943835|ref|ZP_07659179.1| nitrogen regulatory protein P-II [Roseibium sp. TrichSKD4]  clstr ali  65  8VMAIIKPFKLDEVRDALTGIGVQGLTVTEVKGYGRQKGHTEIYRGTEYAVSFLPKLKIEVVVSSDIADQVVETIAGAAQTGQIGDGKIFVHSVDRVMRIRTG 109
464 1.000e-48JCVI_PEP_1096694056809 /source_dna_id=JCVI_ORF_1096694056808 /offset=0 /translation_table=11 /length=143 /full_length=143  ali  73  34VTAIIKPFKLDDIRETLAEIGVNGLTVTEVKGFGRQKGHTELYRGSEYQIDFLPKSKVEVAIEDSMLEKVIEVVKAATSTGEIGDGKIFVSELQEVVRIRTG 135
465 1.000e-48gi|392963235|ref|ZP_10328661.1| nitrogen regulatory protein P-II [Pelosinus fermentans DSM 17108]  clstr ali  48  7IDIITRPGKLEELKEALNAIGVTGMTVSQVFGCGLQKGHTEIYRGREYNINLLAGIKIEIVVCEVPVEKVVAAAKKVCSTGKIGDGKIFIYPIENAVRIRTG 108
466 1.000e-48gi|103487807|ref|YP_617368.1| nitrogen regulatory protein P-II [Sphingopyxis alaskensis RB2256]  clstr ali  60  4ILAIIKPFKLDEVREALTGLGIAGMTVTEVKGFGRQKGQTEIYRGAEYATNMVPKVKIELVCDDALAPRVVETLQQSAGTGSIGDGKIFVLDVGQAVRIRTG 105
467 1.000e-48gi|118602314|ref|YP_903529.1| nitrogen regulatory protein P-II [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)]  clstr ali  74  4VTAILRPHKLDDVREALSEVGVSGVTVTEVKGFGRQKGHTELYRGAEYQIDFLPKIKLEVAIEASRLDEVIEVISNVANSGKVGDGKIFVTNLDKVVRIRTG 105
469 1.000e-48gi|188995999|ref|YP_001930250.1| nitrogen regulatory protein P-II [Sulfurihydrogenibium sp. YO3AOP1]  clstr ali  66  4VEAIIKPFKLDEVKDALSTLGNFGITITEVKGFGRQKGHTEVYRGAEYVIDFVPKIKIEVVVDDAIVEKVIEAIITAARTGRVGDGKIFISTIEDAVRIRTG 105
471 1.000e-48gi|254469041|ref|ZP_05082447.1| nitrogen regulatory protein P-II [beta proteobacterium KB13]  clstr ali  77  4ITAIIKPFKLDEVREALSDIGVQGVTVTEVKGFGRQKGHTELYRGAEYVIDFLPKVKLEVAIAAKLEKKVIDAIEKSAVTGKIGDGKIFVSDLEKVIRIRTG 105
472 1.000e-48gi|345858367|ref|ZP_08810761.1| nitrogen regulatory protein P-II [Desulfosporosinus sp. OT]  clstr ali  52  4IEAIIRPGKLDSLKDALGAHGVNGLTVTQVIGCGKQKGQTQVYRGVEYNVHLIPKVKVEIVVMDQYVEEVIQVITKVARTGEIGDGKIFVSAVENAYTIRTG 105
473 2.000e-48gi|336323034|ref|YP_004603001.1| nitrogen regulatory protein P-II [Flexistipes sinusarabici DSM 4947]  clstr ali  66  4IEAIIKPFKLDDVKEKLTEYGIKGITVSEVKGFGRQKGHTELYRGAEYVIDFIPKIKVEVIVPEEMTKDVVEIIMEAAKTGRIGDGKIFVVPVEEVVRIRTG 105
474 2.000e-48gi|114771105|ref|ZP_01448545.1| nitrogen regulatory protein P-II [Rhodobacterales bacterium HTCC2255]  clstr ali  75  4IEAIIKPFKLDEVKESLQEVGVQGLSVIEAKGFGRQKGHTELYRGAEYVVDFLPKIKIEVVIPDDQIEIVIDAIIGAARTDKIGDGKIFVSNIEQAIRIRTG 105
475 2.000e-48gi|152993227|ref|YP_001358948.1| nitrogen regulatory protein P-II [Sulfurovum sp. NBC37-1]  clstr ali  62  4IEAIIKPFKLDDVKEALVEAGIEGMTISEVKGYGRQQGHSELYRGAEYVVEFIPKVKIEIVVSSEFADKAVEAIMHSAKTGKIGDGKIFVSDISKTIRIRT. 105
476 2.000e-48gi|327399643|ref|YP_004340512.1| nitrogen regulatory protein P-II [Hippea maritima DSM 10411]  clstr ali  69  4IEAIIKPFKLDAVKEGLMELGIKGLTVSEVKGYGRQKGHTEIYRGAEYVVDFLPKVKIEVVVEESMVDGVVEKIIETAKTGKIGDGKIFIIPIEDAIRIRT. 104
477 2.000e-48gi|408382466|ref|ZP_11180010.1| nitrogen regulatory protein P-II [Methanobacterium formicicum DSM 3637]  clstr ali  52  4IVAIIRPNKLDEVKDALETIGCNGITVTEVKGRGRQLGITESYRGSDYRIDMLPKTRLEIIVADEDADSVVNTIVETAQTGDIGDGKIFISSVEDVVRIRTG 105
478 2.000e-48gi|83589062|ref|YP_429071.1| nitrogen regulatory protein P-II [Moorella thermoacetica ATCC 39073]  clstr ali  50  4IEAIIRPEKFEAVKEALGRYGVHGMTVTHTLGCGQQKGKTEVYRGTAYTIALLPKVKVEIVLEDRYVDDVVAIIAREARTGNIGDGKIFICPVQDAIRIRTG 105
479 2.000e-48gi|377555643|ref|ZP_09785371.1| nitrogen regulatory protein PII [endosymbiont of Bathymodiolus sp.]  clstr ali  76  4VTAIIKPFKLDEVREALHEIGVSGITATEVKGFGRQKGHTELYRGAEYTVDFLPKVKLEIAISADQVDNVIEVISAAAKSGKIGDGKIFVNNLEKVVRVRTG 108
480 2.000e-48gi|51244179|ref|YP_064063.1| nitrogen regulatory protein P-II [Desulfotalea psychrophila LSv54]  clstr ali  56  4IEAIIKPFKLEEIKEALTELAITGMTISEVKGYGRQKGHKEMYRGAEYSIDFNPKLKIELVVRAEIADKVVEKIRLAARTGKIGDGKIFVLPIEEVVRVRTG 105
481 2.000e-48gi|294056094|ref|YP_003549752.1| nitrogen regulatory protein P-II [Coraliomargarita akajimensis DSM 45221]  clstr ali  64  4IKAIIKPFKLDDVKEALEAVGVTGLTAIEAKGFGRQKGHTEIYRGSEYTVDFLPKTVVEAVVEDDICEQAVEAIVKAAKTGKIGDGKVFVMPVESAIRIRT. 104
482 2.000e-48gi|304394434|ref|ZP_07376357.1| nitrogen regulatory protein P-II [Ahrensia sp. R2A130]  clstr ali  64  4VVAVIKPFKLDEVRDALSAIGVQGLTVTEVKGYGRQKGQSEIYRGAEYAVHFVPKLKLEIAVDDALAAQVVEAIQTNASTGQIGDGKVFVLDLESALRIRTG 105
483 3.000e-48gi|326792762|ref|YP_004310583.1| nitrogen regulatory protein P-II [Clostridium lentocellum DSM 5427]  clstr ali  46  7IDIITRQSKFEELKDALNEIGITGMTVYQVLGCGNQKGKTELYRGSSRTMDLLPKVKVEICVSEVPVDLVVETATKILRTGKIGDGKIFVYPVQNVVKIRTG 108
485 3.000e-48gi|389887693|ref|ZP_10211226.1| nitrogen regulatory protein P-II [Coriobacteriaceae bacterium JC110]  clstr ali  43  4ITAIVRPEKLEPLKDALFEAKVSGMTISQVQGCGSQHGWKEYYRGTEVLLNMVPKVKFEIICDDAEVDALIDVISATARTGNVGDGKIFVFPVDEVVRIRTG 105
486 3.000e-48gi|171849064|pdb|3BZQ|A Chain A, High Resolution Crystal Structure Of Nitrogen Regulatory Protein (Rv2919c) Of Mycobacterium Tuberculosis  clstr ali model  59  6ITAIVKPFTLDDVKTSLEDAGVLGMTVSEIQGYGRQKGHTEVYRGAEYSVDFVPKVRIEVVVDDSIVDKVVDSIVRAARTGKIGDGKVWVSPVDTIVRVRTG 107
488 3.000e-48gi|171914742|ref|ZP_02930212.1| putative nitrogen regulatory protein P-II [Verrucomicrobium spinosum DSM 4136]  clstr ali  59  4IEAIIKPHKFEEVQEALREAGVFGMTVTEVKGFGRQRGHTEIYRGSEYTVDFVPKTKIEILTTDEQLPGIIQTIIESAKTGKVGDGKIFIYEIEDVLRIRT. 104
489 3.000e-48gi|317125422|ref|YP_004099534.1| nitrogen regulatory protein P-II [Intrasporangium calvum DSM 43043]  clstr ali  54  4VTAIIKPHQLDEVKEALEAFGVTGMTISEASGYGRQRGHSEVYRGAEYTVDFVPKVRLEVLVDDIDAPDVIDVILKSAQTGRIGDGKIWSVPVDEVVRVRTG 105
490 3.000e-48gi|257792263|ref|YP_003182869.1| nitrogen regulatory protein P-II [Eggerthella lenta DSM 2243]  clstr ali  43  4ITAIVRPEKLEPLKEALFAAQVSGMTVSQVQGCGKQHGWKEHYRGTEIMLNMIPKVKFELVVDDAETGPLVDLIRATARTGEVGDGKIFVFPVEDVVRIRTG 105
491 3.000e-48gi|119503719|ref|ZP_01625801.1| regulatory protein, P-II 2, for nitrogen assimilation by glutamine synthetase, regulates GlnL (NRII) and GlnE (ATase)  clstr ali  81  4VTAIIKPFKLDDVREALSHIGIQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIEAAVTTEQADAVIEAITTASHTGKIGDGKIFVTAIDQIIRIRTG 105
492 3.000e-48gi|330506842|ref|YP_004383270.1| nitrogen regulatory protein P-II [Methanosaeta concilii GP6]  clstr ali  53  4IQAIIRPSKVEEVKNALDEAGYTSLTSIEIKGRGRQKGITQIWRGEEYQVDMLPKVKVELVVPDDKEDEVVEIIRKAAYTGNIGDGKIFVLPVEKTIRIRTG 105
493 4.000e-48gi|320354165|ref|YP_004195504.1| nitrogen regulatory protein P-II [Desulfobulbus propionicus DSM 2032]  clstr ali  72  4VSAIIKPFKLNEVRECLTALGVKGVTVTEVKGFGRQKGHTEMYRGAEYVIEFLPKLKVEVAIDDSQLEQVVEGIKQAATTGKIGDGKIFVFDLEHVMRIRTG 105
494 4.000e-48gi|157737398|ref|YP_001490081.1| nitrogen regulatory protein PII [Arcobacter butzleri RM4018]  clstr ali  62  4IEVIIKPFKLEDVKEALVSIDVSGMTISDVKGYGRQQGHSELYRGAEYVVDFLPKIKIEVTVKDDMVDKVIKVISEAAKTGKIGDGKIFVHDISKVVRIRTG 105
495 4.000e-48JCVI_PEP_1096694646161 /source_dna_id=JCVI_ORF_1096694646160 /offset=0 /translation_table=11 /length=173 /full_length=173  ali  56  64IVAIIQPGRLAAVHEALGAIGIEGLTTSEVQGYGRQKGKTEVYRGTEYTVNFLPKIKIEVAVPGDAVEKACDAIRTAAESGKIGDGKIFVFDLETAMRIRTG 165
496 4.000e-48gi|94263861|ref|ZP_01287666.1| Nitrogen regulatory protein P-II [delta proteobacterium MLMS-1]  clstr ali  60  4VEAIIKPFKLDAVKEAVTALGIHGMTVSEVKGFGRQKGHTEVYRGAEYVVDFVAKIKVEIVVESEKASLLVETITQAARNGNIGDGKIFVTPVESVCRIRTG 105
497 4.000e-48gi|90421057|ref|ZP_01228960.1| nitrogen regulatory protein P-II [Aurantimonas manganoxydans SI85-9A1]  clstr ali  69  6VMAIIKPFKLDEVREALTGIGVQGLTVTEVKGYGRQKGHTEIYRGTEYAVSFLPKLKIEVAVAVDLVDRTVEAIQTAAKTGQIGDGKIFVFGIDQAVRIRTG 107
498 5.000e-48gi|218780874|ref|YP_002432192.1| nitrogen regulatory protein P-II [Desulfatibacillum alkenivorans AK-01]  clstr ali  59  4IEAIIKPFRLDELKKGLSDMGVKGMTITEVKGFGRQKGHSEIYRGAEYAVDFVPKVKVEVVIQAEMVEQCIQTILETTKTGEIGDGKIFVMPVEQVLRIRTG 105
499 5.000e-48gi|218133623|ref|ZP_03462427.1| hypothetical protein BACPEC_01492 [[Bacteroides] pectinophilus ATCC 43243]  clstr ali  43  452VEIIMKQAKFEALKKAMNDLGVTGMTVTQVLGCGVQKGATEYYRGVEVEMNLLPKIKVEMVVAKVPVLDVINTARKVLYTGHIGDGKIFVHDIEDVVKIRTG 553
500 5.000e-48gi|85705064|ref|ZP_01036164.1| Nitrogen regulatory protein P-II [Roseovarius sp. 217]  clstr ali  61  4IIATIKPFKLEEVREALTDIGVRGMMVTEIKGFGSQSGHTEIYRGAEYAVNFVPKIKLEIAVSAGMADQVVETITKTARTGKIGDGKIFVLDIQQAVRVRTG 105
501 5.000e-48gi|83951221|ref|ZP_00959954.1| Nitrogen regulatory protein P-II [Roseovarius nubinhibens ISM]  clstr ali  59  4IIATIKPFKLDEVREALTGVGVTGMSVTEIKGFGNQSGHTEIYRGAEYSVNYVPKIRLEIAVSDALADEVIQTIAKTARTGKIGDGKIFALDLQQAMRVRTG 105
502 5.000e-48gi|163868584|ref|YP_001609793.1| nitrogen regulatory protein P-II [Bartonella tribocorum CIP 105476]  clstr ali  64  4IEAIIKPFKLDEVKEALQKIGLHGITVTEAKGFGRQREHTELYRGTKYVVDFLPKVKIEIVVSDEKLEQTVDAIRKAAQTKHIGDGKIFVFSIDDAIRIGT. 104
503 5.000e-48gi|227504768|ref|ZP_03934817.1| nitrogen regulatory protein P-II [Corynebacterium striatum ATCC 6940]  clstr ali  55  4ITAVVKPFTLPDIREALEQLEVHGLTVTETQGFGQQRGHSEVYRGAEYATDFVPKVKLEIVVSDESVDEIINAVVEAAYTGKIGDGKIWVTPVEDVIRVRTG 105
504 5.000e-48gi|297617740|ref|YP_003702899.1| nitrogen regulatory protein P-II [Syntrophothermus lipocalidus DSM 12680]  clstr ali  46  4IEAIIRPSKLEELKEALAKLEVRGMTIYEVSGRGLQRGEKQYYRGRELSVDLFPKVKVELVCRDHWVERIIETIVNVCATGNIGDGKIFVYPVEEIVRIRTG 105
505 5.000e-48gi|383640154|ref|ZP_09952560.1| nitrogen regulatory protein P-II [Sphingomonas elodea ATCC 31461]  clstr ali  64  4IIAIIKPFKLDEVREALTTVGVTGMTVTEVKGFGRQKGQTEIYRGAEYSTNMVPKIKIEVAVGSDLADRAVEAIQAAASTGAIGDGKIFVLDMGQAVRIRTG 105
506 5.000e-48gi|333988001|ref|YP_004520608.1| nitrogen regulatory protein P-II [Methanobacterium sp. SWAN-1]  clstr ali  50  4IIAIIRPEKLEDVKKALEEVHCHGVTVTEVKGRGRQLGITESYRGSDYRIDLLPKTKLEIITNDEDVDKVVDTIVATAKTGDIGDGKIFISSVDDVVRIRTG 105
508 5.000e-48gi|126031033|pdb|2J9C|A Chain A, Structure Of Glnk1 With Bound Effectors Indicates Regulatory Mechanism For Ammonia Uptake  clstr ali model  51  6VEAIIRPEKLEIVKKALSDAGYVGMTVSEVKGRGVQGGIVERYRGREYIVDLIPKVKIELVVKEEDVDNVIDIICENARTGNPGDGKIFVIPVERVVRVRT. 106
509 5.000e-48JCVI_PEP_1096696097197 /source_dna_id=JCVI_ORF_1096696097196 /offset=0 /translation_table=11 /length=162 /full_length=162  ali  77  67VTAIVKPFKSEDVREALSEIGIQGMTVTEVKGFGRQKGHSELYRGSEYVVDFLPKIRIEVAIDDAQLDAVVEAITKTANTGKVGDGKIFVSTLDEV...... 162
510 6.000e-48gi|71898524|ref|ZP_00680695.1| Nitrogen regulatory protein P-II [Xylella fastidiosa Ann-1]  clstr ali  72  4ITAIIRPFKLDEVREALSKVGVSGITVTEVKGFGQQKGHTELYRGTEYVIDFLPKIKIEMVVTDERLDAVIEVIRIAAVTGKIGDGKIFVTKIEQVVRIRTG 105
511 6.000e-48gi|407886702|emb|CCH34345.1| Nitrogen regulatory protein P-II [Saccharothrix espanaensis DSM 44229]  clstr ali  63  4VTAIIKPFTLDDVKTALEQLGVLGMTVSEVQGFGRQKGHTEVYRGAEYAVDFVPKLRIEVLIEDTAVDKVLDAVVDAARTGKIGDGKVWVTPVDTVIRVRTG 105
512 6.000e-48gi|78042932|ref|YP_358944.1| nitrogen regulatory protein P-II [Carboxydothermus hydrogenoformans Z-2901]  clstr ali  50  4IEALIRPQKLGEVKEALNKLGISGMTVTEVVGCGRQKGQKEIYRGIEYEINLLPKVKIEIVTVDEKVEEIIKIISESARTGAIGDGKIFISEVLDAVRIRTG 105
513 6.000e-48gi|126740830|ref|ZP_01756515.1| nitrogen regulatory protein P-II (GlnB, GlnK) [Roseobacter sp. SK209-2-6]  clstr ali  60  4IIAAIKPFKLEEVRQALTGLGVSGLMVTEVKGFGAQSGHTEIYRGAEYEVNFVPKVKLEIAVPASLADRVVDCIATTARTGKIGDGKIFVLDVEQALRVRTG 105
515 6.000e-48gi|206889581|ref|YP_002249497.1| nitrogen regulatory protein P-II [Thermodesulfovibrio yellowstonii DSM 11347]  clstr ali  56  4IEAIIKPFKFEEVKEALVLAGIQGMTVTDVKGFGRQKGHVEIYRGSELEVLFIPKIKIEVVVPDSLVEKVVKVIQEKAYTGNVGDGKIFIIPVEDAVRIRT. 104
516 7.000e-48gi|29832136|ref|NP_826770.1| nitrogen regulatory protein P-II [Streptomyces avermitilis MA-4680]  clstr ali  60  4ITAIVKPYRLDEVKTALQELGVHGLTVTEASGYGRQRGHTEVYRGAEYRVDLVPKVRIEVVVEDADSDAVIDAIVKAAQTGKIGDGKVWSVPVETVVRVRTG 105
517 7.000e-48gi|429147285|gb|EKX90315.1| nitrogen regulatory protein P-II [Corynebacterium durum F0235]  clstr ali  59  4ITAVIKPFTLEDVKQSLEQVGVYGMTVTEIQGFGQQKGHTEVYRGAEYAVDFVPKVKVEIVVSNEQLDEVVAAIVDTARTGKIGDGKVWVMDVEELVRVRTG 105
518 7.000e-48gi|251772128|gb|EES52698.1| nitrogen regulatory protein P-II [Leptospirillum ferrodiazotrophum]  clstr ali  59  4VEAIIKPYRLERVKEAVTALGVFGMTVTEVKGYGRQKGHTEQYRGAEFQVDFIPKVKVEIVVADADANRVVDAIQKSAGSGAIGDGKIFVFAIENAVRIRTG 105
519 8.000e-48gi|319898821|ref|YP_004158914.1| nitrogen regulatory protein P-II [Bartonella clarridgeiae 73]  clstr ali  65  6IEAIIKPFKLDEVKEALQGIGLQGITITEAKGFGCQKEQTELYRGAKYVIDFLPKVKVEVVVTDEILEKAIEAIRKAAQTKHIGDGKIFVLPIDDVIRIRTG 107
520 8.000e-48gi|332706769|ref|ZP_08426830.1| nitrogen regulatory protein P-II [Moorea producens 3L]  clstr ali  56  4IEAIIRAYKLEEVKIALVNAGIVGMTVSEVRGFGRQKGQTEQYRGTKYRVDFLPKVKLEVVVENGLVDMAVEKILAAAHTGKIGDGKIFISPIEQIVRIRTG 105
521 8.000e-48gi|325109121|ref|YP_004270189.1| nitrogen regulatory protein P-II [Planctomyces brasiliensis DSM 5305]  clstr ali  61  4IEAIIRHFKLEDVKTALVAAKIEGMTVAEVRGFGRQKGHKETYRGAEYVVDFMPKVKIELVLADDVADKAIEVISEAARTGNIGDGKIFVSHVEQVIRIRTG 105
522 8.000e-48gi|94968517|ref|YP_590565.1| nitrogen regulatory protein P-II [Candidatus Koribacter versatilis Ellin345]  clstr ali  56  5VEAVIQPSKLDAVKDALLAIGIDGMTVLEARGHGRQKGHTEFYRGREYTVDLLPKIKIELVVPDERTEEVVKAIADASRTGKIGDGKIFLSRIDDAIRIR.. 104
523 9.000e-48gi|56698542|ref|YP_168918.1| nitrogen regulatory protein P-II [Ruegeria pomeroyi DSS-3]  clstr ali  57  4IIATIKPFKLDEVREALTEAGIRGMMVTEIKGFGTQSGHTEIYRGAEYTVNFVPKIKLELVVADQIAEQIADTIARTARTGKIGDGKIFVLDVEQALRVRTG 105
524 1.000e-47gi|117928772|ref|YP_873323.1| nitrogen regulatory protein P-II [Acidothermus cellulolyticus 11B]  clstr ali  56  4ITAVVKPFKLDDVKTALEAFGVTGMTVSEASGYGRQRGHTEVYRGAEYEVDLVPKVRIEVLVDDADAEDVIDVIVKAAQTGKIGDGKVWSIPVETVVRVRTG 105
525 1.000e-47gi|399066412|ref|ZP_10748430.1| nitrogen regulatory protein PII [Novosphingobium sp. AP12]  clstr ali  61  4ITAIIKPFKFTEVKDALSAAGVSGLTVSEVSGYGRQKGQTEIYRGAEYAKSMLPKVRIEVAVPDSLEDKVVEIIRQHANNDEIGDGKIFVFPLELAMRIRTG 105
526 1.000e-47gi|86137159|ref|ZP_01055737.1| nitrogen regulatory protein P-II [Roseobacter sp. MED193]  clstr ali  60  4IIAAIKPFKLEDVREALTGIGVSGLMVSEVKGFGAQAGHTEIYRGAEYEVNFVPKLKLEIVVAASLADQVVETIANTARTGKIGDGKIFVIDVEHALRVRTG 105
527 1.000e-47gi|373854588|ref|ZP_09597386.1| nitrogen regulatory protein P-II [Opitutaceae bacterium TAV5]  clstr ali  64  4IIAIIKPFKLEEVKEALAAVGVEGMTVTEVKGFGRQKGHTEIYRGSEYTVDFLPKIKIEIVTGDDIAGKTIDAIVKAARSGKIGDGKVFVVPVGDAVRIRT. 104
528 1.000e-47gi|374312224|ref|YP_005058654.1| nitrogen regulatory protein P-II [Granulicella mallensis MP5ACTX8]  clstr ali  56  4IEAVIQPSKLDAVKDALVELGIAGITIFEARGHGRQKGHTEFYRGREYAVDLLPKVKLELVVMDDMAEKAIQAIITAARTGRIGDGKIFVSKVDEAIRIR.. 103
529 1.000e-47gi|345017096|ref|YP_004819449.1| nitrogen regulatory protein P-II [Thermoanaerobacter wiegelii Rt8.B1]  clstr ali  50  4IEAIIRPEKLEIIKDQLGKFDIHGMTVYPVMGCGNQKGWTEVYRGNEYFINLLPKVKVEIAVADHQTEKLVKLISEVARTGEIGDGKIFVVNLEDVIRVRTG 105
530 1.000e-47gi|296132229|ref|YP_003639476.1| nitrogen regulatory protein P-II [Thermincola potens JR]  clstr ali  52  4VEAIIRPSKLDDLKDALGKYDIHGLTVTEVVGCGLQKGKKEIYRGTEYTIDLLPKIKIEIVVKDSVVDELVKLISDTAKTGEIGDGKIFIYTVEKAVRIRTG 105
531 1.000e-47gi|347731601|ref|ZP_08864694.1| nitrogen regulatory P-II protein [Desulfovibrio sp. A2]  clstr ali  62  5.EIIIRPFKLDEVKETLAGLDVKGMTVTEVKGFGRQRGHKEVYRGAEYQVDFMPKVKIEVVVDDGQVKSVTDAVVKAARTGKVGDGKIFISPVEDVLRIRTG 105