current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: PF00543.20; C1DJ64_AZOVD/4-105; Nitrogen regulatory protein P-II, from PfamA30U

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
1 8.000e-73JGI.Meta 7022121377 SRS015158_WUGC_scaffold_42014__gene_51334 nitrogen regulatory protein P-II [Human Supragingival plaque microbiome from v  ali  69  94IEAIIKPFKLDDVREALTEIGITGMTVSEVKGFGRQKGHTEIYRGAEYAVDFLPKVKVELIIADEDVERVIDVIIETARSGKIGDGKIFVLPVEEAIRIRTG 195
2 5.000e-71JGI.Meta 7044323753 SRS042984_LANL_scaffold_77264__gene_102191 nitrogen regulatory protein P-II [Human Supragingival plaque microbiome from  ali  68  43IEAIIKPFKLDDVREALTEIGITGMTVTEVKGFGRQKGHTEIYRGAEYAVDFLPKVKLELILPEEMVERAIETIVETARSGKIGDGKIFVYPVEQVIRIRTG 144
3 6.000e-71JCVI_PEP_1096666075017 /source_dna_id=JCVI_ORF_1096666075016 /offset=0 /translation_table=11 /length=202 /full_length=202  ali  87  29VTAVVKPFKLDDVREALSDIGMQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIEVATSDDQADQVIEAISKAANTGKIGDGKIFVVNLEQAVRIRTG 130
4 2.000e-70JCVI_PEP_1096696408303 /source_dna_id=JCVI_ORF_1096696408302 /offset=0 /translation_table=11 /length=180 /full_length=180  ali  70  71IEAIIKPFKLDDVKEALQEIGLQGLTVIEAKGFGRQKGHTELYRGAEYVVDFLPKMKIELVVPDARVDAAVEAIQNAARTGRIGDGKIFITPVESAIRIRTG 172
5 4.000e-70JCVI_PEP_1096682266495 /source_dna_id=JCVI_ORF_1096682266494 /offset=0 /translation_table=11 /length=211 /full_length=211  ali  77  102ITAIIKPFKLDEAREALSAIGVSGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIEAAVSDDIVDQAIEALERAARTGKIGDGKIFVTPIEQVIRIRTG 203
6 4.000e-70gi|114315797|gb|ABI61857.1| nitrogen regulatory protein P-II [Granulibacter bethesdensis CGDNIH1]  clstr ali  71  77IEAVIKPFKLDEVKEALHEVGLQGITVMEAKGFGRQKGHTELYRGAEYVVDFLPKVKIEVVCEDDQVERAVEAIVNAARTGRIGDGKIFVTPVEDVIRIRTG 178
8 6.000e-70JGI.Meta 7009402583 C4064727__gene_114557 nitrogen regulatory protein P-II [Human Tongue dorsum microbiome from visit number 2 of subject 15  ali  67  40IEAIIKPFKLDDVREALTEIGITGMTVSEVKGFGRQKGHTEIYRGAEYAVDFLPKVKIELVLADDAVERAIDVIVEVARSGKIGDGKIFVLPVEEAVRIRTG 141
9 1.000e-69gi|343393314|gb|EGV05872.1| nitrogen regulatory protein P-II [Haemophilus pittmaniae HK 85]  clstr ali  70  17IEAIIKPFKLDDVRENLSDIGISGMTVTEVRGFGRQKGHTELYRGAEYMVDFLPKVKIEIVVPDELLEQCLETIVETAQTGKIGDGKIFVYDVERVIRIRTG 118
10 1.000e-69JCVI_PEP_1096699795925 /source_dna_id=JCVI_ORF_1096699795924 /offset=0 /translation_table=11 /length=160 /full_length=160  ali  76  51IMAIIKPFKLDEVREALSEVGVSGITVTEVKGFGRQKGHTELYRGAEYIVDFLPKVKIEVAVPDDVVERAVEAIEKSARTGKIGDGKIFVADVEQVIRIRTG 152
11 2.000e-69JGI.Meta 7012432709 SRS024289_LANL_scaffold_52722__gene_71550 nitrogen regulatory protein P-II [Human Supragingival plaque microbiome from v  ali  69  31IEAIIKPFKLDDVREALSDIGITGMTVTEVRGFGRQKGHTELYRGAEYMVDFLPKVKMEIVVPDELLEQCLDAIIDTAQTGKIGDGKIFVYEVERVIRIRTG 132
12 3.000e-69gi|124871885|gb|EAY63601.1| Nitrogen regulatory protein P-II [Burkholderia cenocepacia PC184]  clstr ali  75  34ITAIIKPFKLDETREALSALGVSGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKMKIEAAVSDDLVDQAVEAIERAARTGKIGDGKIFVTPIEQVIRIRTG 135
13 4.000e-69gi|740714686|ref|WP_038499973.1| nitrogen regulatory protein P-II 1 [Basilea psittacipulmonis]  clstr ali  74  4IMAIIKPFKLDEVREALSGLGVSGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKIKIELVVDDSMVDSALEAISNAARTGKIGDGKIFVMPVENAIRIRT. 104
16 8.000e-69gi|503507685|ref|WP_013742346.1| nitrogen regulatory protein P-II 1 [Pusillimonas sp. T7-7]  clstr ali  72  4ITAIIKPFKLDEVREALSELGIQGMTVTEVKGFGRQKGHTELYRGAEYTVDFLPKLRLEMAVSDHLVEQAIENLCAAAHTGKIGDGKIFVTSIEQAIRIRT. 104
17 9.000e-69gi|378401606|emb|CCG06722.1| Nitrogen regulatory protein P-II [Pararhodospirillum photometricum DSM 122]  clstr ali  73  74IMAIIKPFKLDEVREALAALDVQGLTVSEVKGFGRQKGQTEIYRGAEYQVNFLPKVKIEVAVRDEVVDRAIEAITTAAGTGKIGDGKIFVSSLEQAVRIRTG 175
18 9.000e-69gi|504515964|ref|WP_014703066.1| nitrogen regulatory protein P-II [Methylophaga frappieri]  clstr ali  81  4IEAIIKPFKLDDVREALSEIGVTGMTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKMEIVLADDQVDGCIEAITKAAHTGRIGDGKIFVSPLEQAIRIRTG 105
19 1.000e-68JCVI_PEP_1096676294985 /source_dna_id=JCVI_ORF_1096676294984 /offset=0 /translation_table=11 /length=207 /full_length=207  ali  76  98ITAVIKPFKLDDAREALSGIGVQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKIRLEIAVDDSMVEQIIEVLMKAASTGKIGDGKIFVHDLEQVIRIRTG 199
20 1.000e-68gi|921111573|gb|KON63008.1| nitrogen regulatory protein P-II [Komagataeibacter europaeus]  clstr ali  67  42IEAIIKPFKLDEVKEALHEIGLMGITVTEAKGFGRQKGHTELYRGAEYIIDFLPKVKLEIVCPDDMTERAIEAIMAAARTGRIGDGKIFVTPVTDVIRIRTG 143
21 1.000e-68gi|751363836|gb|KIL97216.1| Nitrogen regulatory protein P-II [Magnetospirillum magnetotacticum MS-1]  clstr ali  71  48IEAIIKPFKLDEVKEALHEVGLQGLTVTEAKGFGRQKGHTELYRGAEYVVDFLPKVKIELVIEDNLVERAVEAIQQAAHTGRIGDGKIFISTVEEAIRIRTG 149
22 1.000e-68gi|620709596|gb|KAK68814.1| nitrogen regulatory protein P-II [Bordetella bronchiseptica MO211]  clstr ali  77  20VTAIIKPFKLDEVREALAEVGVSGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKIRVEVVLADDMVDPAIEAIVKAARTGKIGDGKIFVTPVEQAIRIRTG 121
23 2.000e-68JGI.Meta 7080392870 C485553__gene_20797 nitrogen regulatory protein P-II [Human Buccal mucosa microbiome from visit number 1 of subject 7646  ali  73  24IEAMIKPFKLDDVRESLSDIGISGMTITEVRGFGRQKGHTELYRGAEYMVDFLPKVKLEVVVPDELVDQCIEAIIETAQTGKIGDGKIFVYNVERAIRIRTG 125
24 3.000e-68gi|347580611|dbj|BAK84832.1| nitrogen regulatory protein PII [Komagataeibacter medellinensis NBRC 3288]  clstr ali  68  37VTAIIKPFKLDDVREALTPLGIQGLTVSEVKGFGRQKGQTEIYRGAEYHVSFLPKIKIEVAVADEMVEQAVETILEAAHTGKIGDGKIFISPLDSVIRIRT. 137
25 3.000e-68gi|491006994|ref|WP_004868712.1| nitrogen regulatory protein P-II [Acidithiobacillus caldus]  clstr ali  72  4IEAIIKPFKLDDVREALQELGIAGMTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIEVVLPDDLAERAVDAIQEAARTGKIGDGKIFVYPVERVIRIRTG 105
26 3.000e-68gi|516091987|ref|WP_017522567.1| nitrogen regulatory protein P-II 1 [Pusillimonas noertemannii]  clstr ali  71  4ITAIIKPFKLDEVREALGAIGIQGMTVSEVKGFGRQKGHTELYRGAEYTVDFLPKLRIDMAVSEAMLEQAIETLCSAAHTGKIGDGKIFITPLEQAVRIRTG 105
27 4.000e-68gi|224953474|gb|EEG34683.1| nitrogen regulatory protein P-II [Neisseria flavescens NRL30031/H210]  clstr ali  68  17IEAIIKPFKLDDVREILTEIGITGMTVSEVKGFGRQKGHTEIYRGAEYAVDFLPKVKIELVLADDKVDQAVDAILETAHSGKIGDGKIFIYPVEEAIRIRTG 118
29 4.000e-68gi|37199682|dbj|BAC95512.1| nitrogen regulatory protein PII [Vibrio vulnificus YJ016]  clstr ali  73  24INAIIKPFKLDDVREALADVGIEGMTVSEVKGFGRQKGHTELYRGAEYQVDFLPKVKLEIATQAENVDRVIEAITKAAHTGKIGDGKIFVYDLSHAVRIRTG 125
30 4.000e-68JCVI_PEP_1096698264283 /source_dna_id=JCVI_ORF_1096698264282 /offset=0 /translation_table=11 /length=169 /full_length=169  ali  96  60VTAIIKPFKLDDVRESLSEIGVQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIDVAIDDKDLDRVIEAITKAANTGKIGDGKIFVVNLEQAIRIRTG 161
32 5.000e-68gi|196222762|gb|EDY17285.1| nitrogen regulatory protein P-II [Chthoniobacter flavus Ellin428]  clstr ali  60  56IEAIIKPFKLEEVKDALADLGVEGMTVTEVKGFGRQKGHTEIYRGSEYTVDFLPKVKLEIVLGDEIAEKAVATIVAAAKTGKIGDGKVFTFSVESATRIRT. 156
33 5.000e-68gi|543219492|ref|WP_021024177.1| nitrogen regulatory protein P-II 1 [Salinivibrio costicola]  clstr ali  70  4ISAIIKPFKLDDVREALADAGIDGMTVSEVKGFGRQKGHTELYRGAEYQVDFLPKVKLEIAVQSENVDSVVDAISNAAQTGKIGDGKIFVFDLQQAVRIRTG 105
34 5.000e-68JCVI_PEP_1096701563465 /source_dna_id=JCVI_ORF_1096701563464 /offset=0 /translation_table=11 /length=445 /full_length=445  ali  73  336ITAIIKPFKLDEVREALAEVGLTGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKMKIEVVVAEAQVDQVIDAVIGAARTGKIGDGKIFVSDVERVIRIRTG 437
35 5.000e-68gi|931402479|gb|KPJ90890.1| transcriptional regulator [Gammaproteobacteria bacterium SG8_15]  clstr ali  73  4IEAIIKPFKLDDVREALSELGIMGMTATEVKGFGRQKGHTELYRGAEYVVDFLPKVKIETVVADDQVERCVEVITEAARTGKIGDGKIFISPVERAIRIRTG 105
36 6.000e-68JCVI_PEP_1096699561719 /source_dna_id=JCVI_ORF_1096699561718 /offset=0 /translation_table=11 /length=398 /full_length=398  ali  69  289IEAVIKPFKLDEVKEALQEIGIQGLSVIEAKGFGRQKGHTELYRGAEYVVDFLPKVKIEVVVSDDQSEQAVDAIVQAARTGKIGDGKIFIYPVEQAVRIRTG 390
37 7.000e-68JCVI_PEP_1096677668385 /source_dna_id=JCVI_ORF_1096677668384 /offset=0 /translation_table=11 /length=176 /full_length=176  ali  86  67VTAIIKPFKLDDVRESLSEIGVQGMTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIEVAIDDGQLDSVVEAISKAANTGKVGDGKIFVAGLDEVVRIRTG 168
38 8.000e-68gi|654374240|ref|WP_027853405.1| nitrogen regulatory protein P-II 1 [Marinobacterium litorale]  clstr ali  82  4VSAVIKPFKLDDVREALSDIGIQGVTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKLEVAIDDNMVDQVIEAISKTANTGKIGDGKIFVSPLEQVIRIRTG 105
40 1.000e-67JGI.Meta 7019846142 C2414424__gene_159480 nitrogen regulatory protein P-II [Human Stool microbiome from visit number 1 of subject 160603188]  ali  75  46IVAIIKPFKLDEVREALADVGVNGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKLKIEAVVADDILEQAIEAIRKAAYTGKIGDGKIFVYEVEQAIRIRTG 147
41 1.000e-67gi|550949333|ref|WP_022697728.1| nitrogen regulatory protein P-II 1 [Euryhalocaulis caribicus]  clstr ali  67  4IEAVIKPFKLDEVKEALQEIGVQGMTVTEAKGYGRQKGHTELYRGAEYVIDFLPKIKLEVVVDDDMAERVVDAIAAAARSGKIGDGKIFVSPVEDALRIRTG 105
42 1.000e-67JCVI_PEP_1096698268521 /source_dna_id=JCVI_ORF_1096698268520 /offset=0 /translation_table=11 /length=144 /full_length=144  ali  69  35VVAIIKPFKLEEVKDALAEIGIEGMTVTEVKGFGRQKGHTEIYRGSEYTVDFLPKVKIEAAVADEQVDKAISTISKAAHTGKIGDGKIFVYSLSEVVRIRTG 136
44 2.000e-67gi|636671159|gb|AIA13056.1| Nitrogen regulatory protein P-II [uncultured bacterium]  clstr ali  73  69IEAIIKPFKLDEVKEALQEAGLQGITVTEAKGFGRQKGHTELYRGAEYVVDFLPKVKIEVVLGDDTVEGAIEAIRKAAQTGRIGDGKIFVSNIEEVVRIRTG 170
45 2.000e-67JGI.Meta 7070297095 C4503525__gene_338419 nitrogen regulatory protein P-II [Human Supragingival plaque microbiome from visit number 2 of sub  ali  72  31IEAIIKPFKLDDVREALTDAGITGMTVTEVKGFGRQKGHTELYRGAEYAIDFLPKVKVEVIVLDEQVDECIEAIMDVAQTGKIGDGKIFVYDVERAIRIRTG 132
46 2.000e-67gi|830071543|gb|KLR95338.1| nitrogen regulatory protein P-II [Neisseria gonorrhoeae SK7461]  clstr ali  67  15IEAIVKPFKLDDVREALTEIGITGMTVSEVKGFGRQKGHTEIYRGAEYAVDFLPKVKIELVLADDAVERAIDVIVEVARSGKIGDGKIFVLPVEEAIRIRTG 116
47 2.000e-67gi|651616090|ref|WP_026610211.1| nitrogen regulatory protein P-II 1 [Methylocaldum szegediense]  clstr ali  84  4ITAIIKPFKLDDVREALSEIGISGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIEVAVTDSMVDQAVDSIIKAANTGKIGDGKIFVTNLEQAIRIRTG 105
48 2.000e-67JGI.Meta 7077006807 SRS024355_LANL_scaffold_64828__gene_77733 nitrogen regulatory protein P-II [Human Supragingival plaque microbiome from v  ali  68  94IEAIIKPFKLDDVREILTEIGITGMTVSEVKGFGRQKGHTEIYRGAEYAVDFLPKVKIELVLADDKVDQAVDAILETAHSGKIGDGKIFIYPVEEAIRIRTG 195
49 2.000e-67gi|1003371471|gb|AMO50261.1| Glutamine synthetase activity regulation protein [Enterobacter sp. FY-07]  clstr ali  78  69VTVVIKPFKLEDVREALSSIGIQGLTVTEVKGFGRQKGHAELYRGAEYSVNFLPKVKIDVAIADDQLDEVIDVISKAAYTGKIGDGKIFVAELQRVIRIRTG 170
50 2.000e-67gi|736842192|ref|WP_034843245.1| nitrogen regulatory protein P-II 1 [Endozoicomonas numazuensis]  clstr ali  75  4ISAIIKPFKLDDVRNALSEVGIDGMTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKLELAVSDDLVERAIEAIINAANTGKIGDGKVFVSPLEQVIRIRTG 105
51 2.000e-67JGI.Meta 7036741834 C676465__gene_53607 nitrogen regulatory protein P-II [Human Stool microbiome from visit number 1 of subject 764042746] :  ali  73  17IVAVIKPFKLDDVREALSETGVHGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKLKVETVVADDLVEQAIDAIRKAAHTGKIGDGKIFVYDVEQVIRIRTG 118
52 3.000e-67gi|908365970|gb|KND55974.1| Nitrogen regulatory protein P-II [Candidatus Paraburkholderia kirkii]  clstr ali  75  36ITAIIKPFKLDEVREALAEVGLTGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIEVVVANDQTDQVIDAIIGAARTGKIGDGKIFVADVERVIRIRTG 137
53 3.000e-67gi|1012314502|gb|AMS32532.1| nitrogen regulatory protein P-II 1 [Betaproteobacteria bacterium UKL13-2]  clstr ali  71  4IEAVIKPFKLDEVREALTGLGCSGLTVTEVKGFGRQKGHTELYRGAEYTVDFLPKVKVEVVVADELVDKVIDALIKAARTGKIGDGKIFVLPVEQAVRIRTG 105
54 3.000e-67JCVI_PEP_1096674698807 /source_dna_id=JCVI_ORF_1096674698806 /offset=0 /translation_table=11 /length=537 /full_length=537  ali  76  428VTAIIKPFKLDDVRSALSEIGVQGVTVTEVKGFGRQRGHTELYRGAEYVVDFLPKLKLEIATSAEQLDQIVDTIIAAASTGKIGDGKIFVSELEQVVRIRTG 529
55 3.000e-67gi|502022771|ref|WP_012696714.1| nitrogen regulatory protein P-II 1 [Laribacter hongkongensis]  clstr ali  72  4IEAIIKPFKLDEVREALSELGVNGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKVELVLADDLVDRAIDVIAQAARTGKIGDGKIFVFPVEQVVRIRTG 105
56 4.000e-67gi|494246464|ref|WP_007145713.1| nitrogen regulatory protein P-II [Methylophaga aminisulfidivorans]  clstr ali  79  4IEAIIKPFKLDDVRQSLSDIGVTGMTVTEVKGFGRQKGHTEFYRGAEYVVDFLPKVKLEIAVADDKVDSVIEAVIKAANTGRIGDGKIFVTPLEQAIRIRTG 105
57 4.000e-67JCVI_PEP_1096696580405 /source_dna_id=JCVI_ORF_1096696580404 /offset=0 /translation_table=11 /length=159 /full_length=159  ali  82  50VTAVIKPFKLDDVREALSTIGVQGITVSEVKGFGRQKGHTELYRGAEYVVDFLPKVKIDIAIADGMVDQTIEAISKAAQTGKIGDGKIFVSSLEHVTRIRTG 151
58 4.000e-67gi|219675229|gb|EED31595.1| nitrogen regulatory protein P-II [gamma proteobacterium NOR5-3]  clstr ali  81  25ITAIIKPFKLDDVRSALAEVGVQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKVEVAVGDDQLDTSVEAIVSAADTGKIGDGKIFVSSLEQVIRIRT. 125
60 4.000e-67gi|551328899|ref|WP_022948342.1| nitrogen regulatory protein P-II 1 [Methylohalobius crimeensis]  clstr ali  75  4ITAIIKPFKLDDVREAFSELGIAGMTVTEVKGYGRQKGHTELYRGAEYVVDFLPKVRIEVAVTDDLLERTVEAIASAARTGKIGDGKIFVSPLEEVIRIRTG 105
61 4.000e-67JCVI_PEP_1096686837219 /source_dna_id=JCVI_ORF_1096686837218 /offset=0 /translation_table=11 /length=158 /full_length=158  ali  72  49IEAIIKPFKLDEVKEALHEVGVKGLTVTEAKGFGRQKGHTELYRGAEYVVDFLPKVKIEVVIEDSMVESAVEAIQQAAHTGRIGDGKIFVSAVEDVLRIRTG 150
63 5.000e-67gi|499785988|ref|WP_011466722.1| nitrogen regulatory protein P-II 1 [Saccharophagus degradans]  clstr ali  74  4ITAVIKPFKLDDVRNALSEIGVQGMTVTEVKGFGRQKGHTELYRGAEYVIDFLPKVKLELVLGDELIDQAVEAISKAAQTGKIGDGKIFITPCEEVIRIRTG 105
64 5.000e-67gi|500139188|ref|WP_011815191.1| nitrogen regulatory protein P-II 1 [Halorhodospira halophila]  clstr ali  82  4VTAIIKPFKLDDVREALSAIGVQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKMKLEVAIDDSLVDRACDAIRQAANSGKIGDGKIFVFDVEQAIRIRTG 105
65 5.000e-67gi|385696305|gb|EIG26803.1| nitrogen regulatory protein P-II [Haemophilus paraphrohaemolyticus HK411]  clstr ali  71  31IEAIIKPFKLDDVREALTDAGITGMTVTEVKGFGRQKGHTELYRGAEYAIDFLPKVKVEVIVLDEQVDECIEAIMDVAQTGKIGDGKIFVYEADRAIRIRTG 132
66 5.000e-67gi|379044356|gb|AFC86412.1| nitrogen regulatory protein PII [Frateuria aurantia DSM 6220]  clstr ali  75  20ITAIIKPFTLDDVREALGEAGINGMTVTEVKGFGRQHGHTELYRGAEYVVDFLPKLKIEIAATDEQAERAIEAISTAARTGKVGDGKIFVIDLEQAIRIRT. 120
67 5.000e-67JGI.Meta 7058240197 SRS049959_WUGC_scaffold_47366__gene_91148 nitrogen regulatory protein P-II [Human Stool microbiome from visit number 1 o  ali  76  4VTAIVKPFKLDEVREALAELGVNGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIEAAVPDELLEQCLEAIQRSARTGKIGDGKIFVFDIEQAIRIRTG 105
68 5.000e-67gi|646374363|ref|WP_025514686.1| nitrogen regulatory protein P-II 1 [Bordetella trematum]  clstr ali  75  4VIAIIKPFKLDDVRAALSDIGVQGMTVTEVKGFGRQKGHTELYRGAEYTVDFLPKLRVEAAIPDALLDQAIDAIEQAAHTGKIGDGKIFTCPLDQAVRIRTG 105
69 5.000e-67gi|288567521|gb|EFC89081.1| nitrogen regulatory protein P-II [Neisseria mucosa ATCC 25996]  clstr ali  69  40IEAIIKPFKLDDVREALTEIGITGMTVSEVKGFGRQKGHTEIYRGAEYAVDFLPKVKVELIIADEDVERVIDVIIENARSGKIGDGKIFVLPVEEAIRIRTG 141
70 6.000e-67JGI.Meta 7023157897 SRS014578_WUGC_scaffold_54253__gene_72550 nitrogen regulatory protein P-II [Human Supragingival plaque microbiome from v  ali  67  21IEAIIKPFKLDDVRENLSDIGISGMTVTEVRGFGRQKGHTELYRGAEYMVDFLPKVKMEIVVPDDLLEQCLETIVETCQTGKIGDGKIFVYDVERVIRVRTG 122
71 6.000e-67gi|110614026|gb|ABF02693.1| nitrogen regulatory protein P-II 2 [Shigella flexneri 5 str. 8401]  clstr ali  78  50VTVIIKPFKLEDVREALSSIGIQGLTVTEVKGFGRQKGHAELYRGAEYSVNFLPKVKIDVAIADDQLDEVIDIVSKAAYTGKIGDGKIFVAELQRVIRIRTG 151
72 6.000e-67gi|505233621|ref|WP_015420723.1| nitrogen regulatory protein P-II [Polynucleobacter duraquae]  clstr ali  78  4ITSIIKPFKLDEVREALAEVGVTGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKVEVVVADDRVDSAIEAITKAARTGKIGDGKIFVSPIEQAIRIRTG 105
73 6.000e-67gi|511292379|ref|WP_016352646.1| nitrogen regulatory protein P-II [Spiribacter salinus]  clstr ali  79  4ITAIIKPFKLDDVRESLSDIGVQGVTVTEVKGFGRQKGHTELYRGAEYVVDFLPKMKVEVVLDDELVERAADAISKAANTGKIGDGKIFVSPVEQAIRIRTG 105
74 7.000e-67gi|655942440|ref|WP_028990610.1| hypothetical protein [Thermithiobacillus tepidarius]  clstr ali  74  4IEAIIKPFKLDDVREALSEIGVAGMTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKLEIVLPDDLADRAVEAIETAARTGKIGDGKIFVSTVEKVVRIRTG 105
76 7.000e-67gi|759383521|ref|WP_043109742.1| nitrogen regulatory protein P-II 1 [endosymbiont of unidentified scaly snail isolate Monju]  clstr ali  87  4VSAIIKPFKLDDVREALSEIGIAGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKIKIEVAIDDAQLDSVIEAITNAAGTGKIGDGKIFVYPLEQAIRIRTG 105
77 8.000e-67gi|503601149|ref|WP_013835225.1| nitrogen regulatory protein P-II 1 [Thioalkalimicrobium cyclicum]  clstr ali  71  4ITAIIKPFKLDDVRDALHDIGIHGMTVTEVKGYGRQKGHTEMYRGAEYVVDFLPKLKLEIATDDEQVDSAIEVIVAAAQTGKIGDGKIFVTSIEQTVRIRTG 105
78 9.000e-67gi|517549474|ref|WP_018719682.1| nitrogen regulatory protein P-II 1 [Arhodomonas aquaeolei]  clstr ali  82  5.TAIIKPFRLDDVREALSDIGVRGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKMKIEVALDDALVDQAVEAVAKAANTGKIGDGKIFVFPLEQAIRIRTG 105
79 1.000e-66gi|759380455|ref|WP_043107131.1| nitrogen regulatory protein P-II 1 [endosymbiont of unidentified scaly snail isolate Monju]  clstr ali  72  4IEAIIKPFKLDDVREALSNIGVNGMTVTEIKGFGRQKGHTELYRGAEYVVDFLPKLKLEIVIAEDRVDECVEAITQAARTGKIGDGKIFVLPVEEVVRIRTG 105
80 1.000e-66gi|1000063169|gb|KXJ40517.1| transcriptional regulator [Methylothermaceae bacteria B42]  clstr ali  81  4VTAVIKPFKLDDVREALSDVGVAGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIEVAVSDEQLDQVVEAVLNSARTGKIGDGKIFVSSLEQVIRIRTG 105
81 1.000e-66JGI.Meta 7057268185 C56540__gene_2976 nitrogen regulatory protein P-II [Human Anterior nares microbiome from visit number 1 of subject 76562  ali  77  42VTAIIKPFKLDDVREALSEIGVNGITITEVKGFGRQKGHTEMYRGAEYVVDFLPKIKLEIACADDVVDGIIGAIIDTAGTGKIGDGKIFVAPLEQVIRIRTG 143
82 1.000e-66gi|491913290|ref|WP_005667790.1| nitrogen regulatory protein P-II [Massilia timonae]  clstr ali  78  4ITAIIKPFKLDEVREALSEINVQGMTVTEVKGFGRQKGHTELYRGAEYVVDFLPKIKIEAAVDDAVVDQVIDAIQGAARTGKIGDGKIFVADLNQVIRIRTG 105
83 1.000e-66gi|496410833|ref|WP_009119697.1| nitrogen regulatory protein P-II [Neisseria shayeganii]  clstr ali  67  4IEAIIKPFKLDDVREALTEIGITGMTVSEVKGFGRQKGHTEIYRGAEYAVDFLPKVRLEIVLADDLVEHAVETIVQAAQSGKIGDGKIFVLPVESVIRIRTG 105
84 1.000e-66gi|498142546|ref|WP_010456702.1| nitrogen regulatory protein P-II 1 [Succinivibrionaceae bacterium WG-1]  clstr ali  73  4ISAIIKPFKLDDVREAISALGIDGMTVTEVKGFGRQKGHTELYRGAEYQVDFLPKVKLEVVVSDDSCDQVIEAIIKAARTGKIGDGKIFVYDCEHIVRIRTG 105
85 1.000e-66gi|765287634|ref|WP_044615346.1| nitrogen regulatory protein P-II 1 [Gynuella sunshinyii]  clstr ali  81  4VSAIIKPFKLDDVREALSEIGVQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKLEIVVSDALVDSAVESITKAANTGKIGDGKIFVSDVEQVIRIRTG 105
87 1.000e-66JCVI_PEP_1096693782573 /source_dna_id=JCVI_ORF_1096693782572 /offset=0 /translation_table=11 /length=164 /full_length=164  ali  69  55ITAVIKPFKLDDVREALTDVGIEGMTVTEVKGFGRQKGQAEIYRGAEYTIAFLPKVKIDIAVDDAAAEKVIEAIQQSANTGKIGDGKIFVQELTNAVRIRTG 156
88 1.000e-66gi|644435751|ref|WP_025314493.1| nitrogen regulatory protein P-II 1 [Gilliamella apicola]  clstr ali  72  4IEAIIKPFKLDDIREALADQGITGMTVTEVKGFGRQKGHTELYRGAEYMVDFLPKVKIELVVSDDILEMCIETIMKTAQTGKIGDGKIFVYNVEQVIRIRTG 105
89 1.000e-66gi|943609912|ref|WP_055439864.1| transcriptional regulator [Idiomarina woesei]  clstr ali  70  4IEAIIKPFKLDDVREALSEIGIAGMTVAEVKGFGRQKGHTELYRGAEYMVDFLPKVKLEIVVADNQVEQCIDTILETAQTGKIGDGKIFVTNVERVVRIRTG 105
91 2.000e-66gi|488761560|ref|WP_002684765.1| nitrogen regulatory protein P-II [Beggiatoa alba]  clstr ali  71  4IEAIIKPFRLDDVREALSNIGVTGMTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKLELIVASEQVEPCIDAIIQAARTGKIGDGKIFVTPVDKIIRIRTG 105
92 2.000e-66JGI.Meta 7058243685 SRS049959_WUGC_scaffold_48958__gene_94636 nitrogen regulatory protein P-II [Human Stool microbiome from visit number 1 o  ali  71  36IVAVIKPFKLDEVREALADLGLSGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVRVEAAVSDDMAEAVIETITKAAYTGKIGDGKIFVLELASAVRIRTG 137
93 2.000e-66gi|517548993|ref|WP_018719201.1| nitrogen regulatory protein P-II [Arhodomonas aquaeolei]  clstr ali  73  4VEAIIKPFKLDDVREALSEIGITGMTVTEVKGFGRQKGHTELYRGAEYVVDFLPKMRVEIVVADGQVERCLEAINQAAQTGKIGDGKIFVTPVERVIRIRTG 105
94 2.000e-66gi|516543104|ref|WP_017930729.1| nitrogen regulatory protein P-II 1 [Robiginitomaculum antarcticum]  clstr ali  71  4IEAVIKPFKLDEVKEALQEVGLQGMTVLEAKGFGRQKGHTELYRGAEYVVDFLPKLKIELVVTDEQVDAALEAIQTAAKTGKIGDGKIFVSTVEQAIRIRTG 105
95 2.000e-66gi|565866964|ref|WP_023948709.1| nitrogen regulatory protein P-II 1 [Pelistega indica]  clstr ali  73  4ITAIIKPFKLDEVREELSEVGISGLTVTEAKGFGRQKGHTELYRGAEYAVDFLPKVKIEMVVKDELVETAIETIVRAARTGKIGDGKIFVTPVEQAIRIRTG 105
96 2.000e-66gi|495761802|ref|WP_008486381.1| nitrogen regulatory protein P-II [Gallaecimonas xiamenensis]  clstr ali  69  4IEAIIKPFKLDDVREALAEVGVNGMTVSEVKGFGRQKGHTELYRGAEYMVDFLPKVKLELIVQDDDLERCIDAIMQTAQTGKIGDGKIFVTDVQRVIRIRTG 105
97 2.000e-66gi|502585910|ref|WP_012823685.1| nitrogen regulatory protein P-II [Halothiobacillus neapolitanus]  clstr ali  68  4IEAIIKPFRLDDVRTALMELGINGMTATEVKGFGRQKGHTELYRGAEYVVDFLPKIKLEIVVSDGLVDAVLDAIIKAAHSGKIGDGKIFVFPVERAVRIRTG 105
98 2.000e-66gi|505249688|ref|WP_015436790.1| PII-like signal transmitter protein [Azoarcus sp. KH32C]  clstr ali  69  4IEAIIKPFKLDEVREALSDVGIAGLTVSEVKGFGRQKGHTELYRGAEYVVDFLPKIKVEIVVGDDLAEQAVEAIIKAAHTGKIGDGKIFVMPVEQVVRIRTG 105
99 2.000e-66gi|504763013|ref|WP_014950115.1| nitrogen regulatory protein P-II [Alteromonas macleodii]  clstr ali  68  4IEAIIKPFKMDDVREALAEVGIAGMTVSEVKGFGRQKGHTELYRGAEYQVDFLPKIKIELVLDDDRVEQAVEAIQTSAKTGKIGDGKIFVYNVETAVRIRTG 105
100 3.000e-66gi|1000064626|gb|KXJ41906.1| transcriptional regulator [Methylothermaceae bacteria B42]  clstr ali  74  4ITAIIKPFKLDDVREALSDIGIAGMTVTEVKGYGRQKGHTELYRGAEYVVDFLPKVKVEVAVAEDFVDRVVEVIVKSARTGKIGDGKVFVSSLEQVVRIRTG 105
101 3.000e-66gi|652527540|ref|WP_026921625.1| nitrogen regulatory protein P-II 1 [Glomeribacter sp. 1016415]  clstr ali  76  4ITAIIKPFKLDEVREALSEIGISGITVTEVKGFGRQKGHTELYRGAEYVIDFLPKVKIEIAVPKELVEQVIDTIERAARTGKIGDGKIFVAPIEQAIRIRTG 105
102 3.000e-66gi|497865411|ref|WP_010179567.1| nitrogen regulatory protein P-II 1 [Glaciecola sp. HTCC2999]  clstr ali  75  4ITAIIKPFKLDDVREAISDIGIDGLTVTEVKGFGRQKGHTELYRGAEYQVDFLPKVKLEIAVNDDQVDRLVEVITENARTGKIGDGKVFVYNLEQAVRIRTG 105
104 3.000e-66gi|931457274|gb|KPK40411.1| transcriptional regulator [Gammaproteobacteria bacterium SG8_47]  clstr ali  76  4VEAIIKPFKLDDVREALSELGITGMTATEVKGFGRQKGHTELYRGAEYVVDFLPKVKIELVVDDGQVDGCIDAIVKAARTGKIGDGKIFVSGVDDAIRIRTG 105
106 3.000e-66gi|499785986|ref|WP_011466720.1| nitrogen regulatory protein P-II 1 [Saccharophagus degradans]  clstr ali  80  4ITAVIKPFKLDAVREALSEIGVQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKTKLEVAVADNQVDSVVETISKAAHSGKIGDGKIFVSALEQVIRIRTG 105
107 3.000e-66gi|696562918|ref|WP_033094768.1| nitrogen regulatory protein P-II 1 [Colwellia psychrerythraea]  clstr ali  77  4ISAIIKPFKLDDVREAISEVGVEGITVSEVKGFGRQKGHTELYRGAEYQVDFLPKVKLEIAVNDDLVERLLETITKAAYTGKIGDGKIFVYNLEQAIRIRTG 105
108 4.000e-66gi|489752925|ref|WP_003656923.1| nitrogen regulatory protein P-II 1 [Moraxella catarrhalis]  clstr ali  78  4ISAIIKPFKLDDVREALSEIGVNGITVTEVKGFGRQKGHTEMYRGAEYVVDFLPKIKIEIACRDEMVDSIIESIIKVANTGKIGDGKIFVSPLERVIRIRTG 105
109 4.000e-66gi|371550088|gb|EHN77614.1| nitrogen regulatory protein P-II, partial [Streptomyces coelicoflavus ZG0656]  clstr ali  66  1.EAIVKPFKLDDVKEALQDVGVQGMTVLEAKGCGRQKGHSELYRGAEYVIDFLPKIKIEVVVADDLAPAVVEAIQTSARTGKIGDGKIFVSDVADVIRIRTG 101
112 4.000e-66gi|651615957|ref|WP_026610078.1| nitrogen regulatory protein P-II 1 [Methylocaldum szegediense]  clstr ali  81  4VTAILKPFKLDDVREALSDVGISGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKLEVAVTDEQLDAVLDAIAKTANTGKIGDGKIFVLDLEQVIRIRTG 105
113 4.000e-66gi|506360239|ref|WP_015879958.1| nitrogen regulatory protein P-II [Tolumonas auensis]  clstr ali  71  4IEAIIKPFKLDDVREALGEIGISGMTVSEVKGFGRQKGHTELYRGAEYVVDFLPKVKLELVVNDEDVENCIEAINRSAKTGKIGDGKIFVTAVERVIRIRTG 105
114 5.000e-66gi|497354919|ref|WP_009669132.1| nitrogen regulatory protein P-II 1 [gamma proteobacterium IMCC1989]  clstr ali  77  4ITAIVKPFKLDDVRAALSEVGVQGMTVTEVKGFGRQKGHTELYRGAEYIVDFLPKVKIELVIDDSMVDQSVDAITKAAQTGKIGDGKIFVTAVEEVIRIRTG 105
115 5.000e-66JGI.Meta 7063776661 SRS049318_LANL_scaffold_75913__gene_97748 nitrogen regulatory protein P-II [Human Supragingival plaque microbiome from v  ali  67  4IEAIIKPFKLDDVRDALTDIGVNGMTVTEVKGFGRQKGHTEIYRGAEYAVDFLPKIRLEIVLEDSMVEQAVEAIVQAANSGKIGDGKIFILPVEGVVRIRTG 105
116 5.000e-66gi|498010413|ref|WP_010324569.1| nitrogen regulatory protein P-II 1 [Marinobacterium stanieri]  clstr ali  79  4ISAIIKPFKLDDVREALSDIGVQGITVTEVKGFGRQKGHTELYRGAEYIVDFLPKVRIDAAVADDIVDQVLEAISKASHTGKIGDGKIFVTPLEQVVRIRTG 105
118 6.000e-66gi|736407152|ref|WP_034429940.1| nitrogen regulatory protein P-II 1 [Candidatus Contendobacter odensis]  clstr ali  81  4VTAIIKPFKLDDVREALSGIGVQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKLEIAVDDILVDKVVEAICSTANTGKIGDGKIFIYDLERAIRIRTG 105
120 6.000e-66gi|589266285|emb|CDM24221.1| Nitrogen regulatory protein P-II [Castellaniella defragrans 65Phen]  clstr ali  76  9ITAIVKPFKLDEVREALSELGVNGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKIRIDVVVAADQAEGVIEAIIRAARTGKIGDGKIFVTPVEQAVRIRTG 110
121 6.000e-66gi|589604821|gb|EXI76672.1| Nitrogen regulatory protein P-II [Candidatus Accumulibacter sp. SK-11]  clstr ali  80  58VTAIIKPFKLDEVREALSAIGVQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKVEAAISDALLEQVIEAIEKSASTGKIGDGKIFISAIEEVIRIRTG 159
122 7.000e-66gi|491829887|ref|WP_005621365.1| nitrogen regulatory protein P-II [Actinobacillus ureae]  clstr ali  66  4IEAIIKPFKLDDVREALTDAGITGMTVTEAKGFGRQKGHTELYRGAEYAIDFLPKIQLEIVVADDQVDACIEAIIDTAQTGKIGDGKIFIYDIERVIRIRTG 105
125 7.000e-66gi|522190530|ref|WP_020699078.1| hypothetical protein [Reyranella massiliensis]  clstr ali  71  4VSAIIKPFKLDEVRDALTGVGVSGLTVSEVKGFGRQKGQTEIYRGAEYLVSFLPKVKIEIVVDDSQVERAIEAIQKAAHTGKIGDGKIFVTPVEQAVRIRTG 105
126 7.000e-66gi|499630019|ref|WP_011310753.1| nitrogen regulatory protein P-II 1 [Thiobacillus denitrificans]  clstr ali  81  4VTAIIKPFKLDEVREALSAIGVTGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKLEVAIKADLLERVIEAIEHAANTGKIGDGKIFVSSLEQVVRIRTG 105
127 7.000e-66JGI.Meta 7070577335 SRS063932_LANL_scaffold_50771__gene_65896 nitrogen regulatory protein P-II [Human Tongue dorsum microbiome from visit nu  ali  70  4ISAIIKPFKLDDVREALSDIGINGITITEVKGFGRQKGHTEMYRGAEYVVDFLPKIKLEIACTDDMVEKIIDTIISTANTNRIGDGKIFVTPLEQVIRIRTG 105
128 8.000e-66gi|503057839|ref|WP_013292815.1| nitrogen regulatory protein P-II 1 [Gallionella capsiferriformans]  clstr ali  71  4IEAVIKPFKLDEVREALSELNISGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKIKVEIVVSSEMLDTAVEAIIKAAHTGKIGDGKIFVSTVEQVIRIRTG 105
129 8.000e-66gi|965598356|dbj|BAT72411.1| nitrogen regulatory protein P-II 1 [Thermosulfidibacter takaii ABI70S6]  clstr ali  74  4VEAIIKPFKLDEVKEALREVGISGMTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIEVVVPDSMVEQVVEAIRNGAYTGKIGDGKIFVIDVENAIRIRTG 105
130 8.000e-66gi|931487415|gb|KPK67918.1| transcriptional regulator [Acidithiobacillales bacterium SM23_46]  clstr ali  76  4ITAVIKPFKLDDVRQALSEIGVQGMTVTEVKGFGRQKGHTELYRGAEYVVDFLPKTKIEVAVAADLTDRVVEAIAEAARTGKIGDGKIFISSIEQVVRIRTG 105
132 8.000e-66gi|504563595|ref|WP_014750697.1| nitrogen regulatory protein P-II 1 [Advenella kashmirensis]  clstr ali  78  4ITAIIKPFKLDEVRESLADIGVSGLTVAEVKGFGRQKGHTELYRGAEYVVDFLPKVRVEVVISDSLVDSAIEAIIKAARTGKIGDGKIFVTPVERAIRIRTG 105
133 8.000e-66gi|494662404|ref|WP_007420348.1| nitrogen regulatory protein P-II [Idiomarina sp. A28L]  clstr ali  70  4IEAIIKPFKLDDVRAALSEVGIAGMTVSEVKGFGRQRGHTELYRGAEYMVDFLPKVKLEIVVADADLDRCLEAITETAQTGKIGDGKIFVSAVERVIRIRTG 105
134 8.000e-66gi|518801699|ref|WP_019957653.1| hypothetical protein [Vitreoscilla stercoraria]  clstr ali  67  4IEAIIKPFKLDEVREALTEVGITGMTVTEVKGFGRQKGHTEIYRGAEYAVDFLPKIKLELVLPDQLAEQAVETIIQAAHSGKIGDGKIFVSAIEQAIRIRTG 105
135 8.000e-66gi|530269097|gb|EQB11474.1| nitrogen regulatory protein P-II 1 [Sphingobium lactosutens DS20]  clstr ali  73  30IEAIIKPFKLDEVKEALHEVGVSGITVTEAKGFGRQKGHTELYRGAEYVVDFLPKVKLEVVVDDSVADRVVEAISAAAQTGRIGDGKIFISNIEGAVRIRTG 131
136 8.000e-66gi|488795809|ref|WP_002708215.1| nitrogen regulatory protein P-II [Thiothrix nivea]  clstr ali  74  4IQAIIKPFKLDDVREALTEIGVTGMTAIEVKGFGRQKGHTELYRGAEYVVDFLPKVKLEIVVKEEDVDRCIETIQKAAHTGKIGDGKIFVFPVEQAIRIRTG 105
137 8.000e-66gi|644549134|ref|WP_025330440.1| nitrogen regulatory protein P-II 1 [Snodgrassella alvi]  clstr ali  68  4IEAIVKPFKLDDVREALSDVGFSGMTVSEVKGFGRQKGHTEIYRGAEYAVDFLPKVKIELVLPDDRVEQAIEVIITAAHSGKIGDGKIFVLPVESAIRIRTG 105
138 9.000e-66gi|740381054|ref|WP_038215878.1| hypothetical protein [Xenophilus azovorans]  clstr ali  73  4ITAIVKPFKLDDVREALAQVGVSGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKMKIEVVVSDADVDRCVEAIVSAARTGKIGDGKIFVTNVERVVRIRTG 105
139 9.000e-66gi|353672912|gb|EHD14608.1| nitrogen regulatory protein P-II [Commensalibacter intestini A911]  clstr ali  69  5IEAIIKPFKLDEVKEALQEIGLQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIELVCSEDLVERAVDIIMHTARTGRIGDGKIFVMPVENAIRIRTG 106
140 9.000e-66gi|521064492|ref|WP_020396443.1| hypothetical protein [Thiothrix disciformis]  clstr ali  77  4VQAIIKPFKLDDVREALTEIGVTGMTATEVKGFGRQKGHTELYRGAEYVVDFLPKIKLEIVINDEKVNDVIEAVMKAAQTGKIGDGKIFVMPVEQAIRIRTG 105
141 9.000e-66gi|759390660|ref|WP_043115965.1| nitrogen regulatory protein P-II 1 [Solemya velum gill symbiont]  clstr ali  75  4VDAIIKPFKLDDVREALSDIGITGMTATEVKGFGRQKGHTELYRGAEYVVDFLPKVKIELVVAEEQVDQCIEAITNASRTGKIGDGKIFVSPIEQVVRIRTG 105
142 9.000e-66JGI.Meta 7058973189 C4396731__gene_193955 nitrogen regulatory protein P-II [Human Supragingival plaque microbiome from visit number 2 of sub  ali  77  29ITAIIKPFKLDEVREALAAVGVTGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKLKIDVVVSDENLDAVIDAIVKAARTGRIGDGKIFVRSVEQVIRIRTG 130
143 9.000e-66gi|759370812|ref|WP_043099000.1| nitrogen regulatory protein P-II 1 [Oleiagrimonas soli]  clstr ali  76  4ITAIIKPFKLDDVREALAEIGVQGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKIKIEAAMADELLDRAVEVIQQSARTGKVGDGKIFVQTLEQVVRIRTG 105
144 9.000e-66gi|306275634|gb|EFM57358.1| nitrogen regulatory protein P-II [Brucella inopinata BO1]  clstr ali  73  42IEAIIKPFKLDEVKEALQEVGLQGITVIEAKGFGRQKGHTELYRGAEYVVDFLPKVKVEVIVADETADSAIEAIRKAAQTGRIGDGKIFVSNIEEVIRIRTG 143
145 1.000e-65gi|737840096|ref|WP_035807392.1| nitrogen regulatory protein P-II 1 [Cupriavidus basilensis]  clstr ali  76  4IIAIIKPFKLDDVREALSGLGVAGMTVTEVKGFGRQKGHTELYRGAEYVVDFLPKLKLEAVIRDDQVEHAIEAIEQAARTGKIGDGKIFVCDIEQAVRIRTG 105
146 1.000e-65gi|820780788|ref|WP_046742701.1| hypothetical protein [Lampropedia cohaerens]  clstr ali  76  4ITAIIKPFKLDDVREALAEAGITGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKVEIAVAEAVVETCIEAITKAARTGKIGDGKIFVTPLEQVVRIRTG 105
147 1.000e-65gi|751600966|ref|WP_041069121.1| nitrogen regulatory protein P-II 1 [Thiolapillus brandeum]  clstr ali  82  4VTAIIKPFKLDDVREALSEIGVSGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKIKLEAAVSADQVDAVIEAITNAARTGKIGDGKIFVSEVEQTIRIRTG 105
148 1.000e-65gi|504860839|ref|WP_015047941.1| nitrogen regulatory protein P-II 1 [Simiduia agarivorans]  clstr ali  76  4ITAVIKPFKLDDVRTALSEVGVQGMTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKLELAVDDSTVEQAVEAITKAAHTGKIGDGKIFITTLDDIIRIRTG 105
150 1.000e-65gi|517544709|ref|WP_018714917.1| nitrogen regulatory protein P-II 1 [Brachymonas chironomi]  clstr ali  76  4IIAIIKPFKLDDVREALSDIGVQGVTVTEVKGFGRQKGHTELYRGAEYVVDFLPKIKLEAAVDDAIVDQVVETIETSARTGKIGDGKIFVSPLEQVIRIRTG 105
151 1.000e-65gi|329761813|gb|EGG78303.1| Nitrogen regulatory protein P-II [Gluconacetobacter sp. SXCC-1]  clstr ali  65  35IEAIIKPFKLDEVKDALHEIGLMGITVIEAKGFGRQKGHTELYRGAEYIIDFLPKVKLEIVCPDDMTERAIEAIMGAARTGRIGDGKIFVTPVTDVIRIRTG 136
153 1.000e-65gi|522049104|ref|WP_020560313.1| nitrogen regulatory protein P-II 1 [Thiothrix flexilis]  clstr ali  79  4ITAIIKPFKLDDVRDALGEIGIKGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKIKLEAAVDDAIVDQVIEAITNSANTGKIGDGKIFVSPIEQAIRIRT. 104
154 1.000e-65gi|1012311218|gb|AMS29459.1| nitrogen regulatory protein P-II 1 [Hyphomonadaceae bacterium UKL13-1]  clstr ali  67  4IEAIIKPFKLDEVKEALQDLGLQGMTVVEAKGFGRQKGHTELYRGAEYVVDFLPKLKLEVVVGDDQVDAAVEAITNAARTGRIGDGKIFVSDISHVVRIRTG 105
155 1.000e-65gi|502912526|ref|WP_013147502.1| nitrogen regulatory protein P-II 1 [Methylotenera versatilis]  clstr ali  73  4IEAIIKPFKLDEVRESLSNIGVNGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKIKLELVVGDDLAEAAMDAIIKAAHTGKIGDGKIFVSTVEQVIRIRTG 105
157 1.000e-65gi|516884980|ref|WP_018147322.1| nitrogen regulatory protein P-II 1 [Henriciella marina]  clstr ali  69  4IEAIIKPFKLDDVKEALHGVGMQGMTVTEAKGFGRQRGHTELYRGAEYVVDFLPKLKLELVVSDSSVANAIDAITKAAQTGKIGDGKIFVSDVTEAVRIRTG 105
158 1.000e-65JCVI_PEP_1096672834661 /source_dna_id=JCVI_ORF_1096672834660 /offset=0 /translation_table=11 /length=172 /full_length=172  ali  70  63IEAIIKPFKLDEVKEALHEVGIQGITVLEAKGFGRQKGHTELYRGAEYVVDFLPKVKIEVVVEESLSERVVDAIQQAAQTGRIGDGKIFISTIDEAIRIRTG 164
159 1.000e-65gi|489878009|ref|WP_003781495.1| nitrogen regulatory protein P-II [Kingella denitrificans]  clstr ali  69  4IEAIIKPFKLDDVREALTELGITGMTVSEVKGFGRQRGHTEVYRGAEYAVDFLPKVKIEVVLPDDQIERTVEAIIEAARSGKIGDGKIFVLPVEEVIRIRTG 105
160 1.000e-65gi|494810371|ref|WP_007545779.1| MULTISPECIES: nitrogen regulatory protein P-II 1 [Sulfurihydrogenibium]  clstr ali  67  4IEAIIKPFKLDEVKDALTNIGIYGMTVTEAKGFGRQKGHTELYRGAEYVIDFLPKLKIEVVVDDAQVEKVVEAIMQAARTGRIGDGKIFIIPIEDVIRIRTG 105
161 2.000e-65gi|962294565|gb|KTD78226.1| Carbamoylphosphate synthase large subunit [Legionella worsleiensis]  clstr ali  70  39ITAIIKPFKLDDVHEALMEIGVPGITISETRGFGRQKGHTELYRGAEYVVDFLPKIKIELAVPENMVEIAIEAICKSAYTGKIGDGKIFVYELQQVVRVRTG 140
162 2.000e-65gi|640391578|ref|WP_024888849.1| nitrogen regulatory protein P-II 1 [Luteimonas huabeiensis]  clstr ali  78  4VVAIIKPFKLDDVREALADAGVTGMTVTEVKGFGRQKGHTELYRGAEYVVDFLPKLKIEIAVADDQADGVVEAILKAASTGKIGDGKVFVHALERAIRIRTG 105
163 2.000e-65gi|949070586|gb|KRO65993.1| transcriptional regulator [OM182 bacterium BACL3 MAG-120507-bin80]  clstr ali  81  4VTAIVKPFKSDDVREALSEIGISGMTLTEVKGFGRQKGHTELYRGAEYVIDFLPKAKIEVAVEDAIVDQVIEAICKAANTGQIGDGKIFVSNLEQTIRIRTG 105
164 2.000e-65gi|493799030|ref|WP_006746987.1| nitrogen regulatory protein P-II 1 [Thioalkalivibrio paradoxus]  clstr ali  75  4ITAIIKPFKLDDVREAISEIGVQGMTMTEVKGFGRQRGHTELYRGAEYVVDFLPKVKLEVAVDGDLVDRVVEAISKSASTGKIGDGKIFITPIEQVVRIRTG 105
165 2.000e-65gi|492796153|ref|WP_005966071.1| MULTISPECIES: nitrogen regulatory protein P-II 1 [sulfur-oxidizing symbionts]  clstr ali  77  4ISAIIKPFKLDDVREALSDIGVTGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKIKVEIAVDDGVVDQVLEAISGAAKTGKIGDGKIFVMPLEQAVRVRTG 105
166 2.000e-65gi|501029787|ref|WP_012081870.1| nitrogen regulatory protein P-II [Nitratiruptor sp. SB155-2]  clstr ali  64  4IEAVIKPFKLEDVKEALTEIGIIGMTVTEVKGYGRQQGHSELYRGAEYAVDFLPKIKIELVVSDENVDSCIDAIMNSARTGKIGDGKIFVSDIEKVVRIRTG 105
167 2.000e-65JGI.Meta 7014053899 SRS022721_LANL_scaffold_4913__gene_8350 nitrogen regulatory protein P-II [Human Buccal mucosa microbiome from visit numb  ali  68  36......PFKLDDVREVLTEIGITGMTVSEVKGFGRQKGHTEIYRGAEYAVDFLPKVKIELVLADDKVDQAVDAILETAHSGKIGDGKIFIYPVEEAIRIRTG 131
168 2.000e-65gi|647593954|ref|WP_025870601.1| nitrogen regulatory protein P-II 1 [Methylobacillus glycogenes]  clstr ali  72  4IEAVIKPFKLDEVREALSEIGANGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKIKVELVVTDEMVDAAVEAVIKAARTGKIGDGKIFVSPVEQIIRIRTG 105
169 2.000e-65gi|114316974|gb|ABI63034.1| nitrogen regulatory protein GlnK [Granulibacter bethesdensis CGDNIH1]  clstr ali  73  41IVAVIKPFKLDDVREALTPLGVQGLTVTEVKGFGRQKGQTEIYRGAEYHVSFLPKVKIEVAVPASLAEQVVEAIMKAANTGKIGDGKIFVLDIERAVRIRTG 142
170 2.000e-65JCVI_PEP_1096676354425 /source_dna_id=JCVI_ORF_1096676354424 /offset=0 /translation_table=11 /length=150 /full_length=150  ali  81  41VTAIVKPFKSDDVREALSEIGISGMTLTEVKGFGRQKGHTELYRGAEYVIDFLPKAKIEVAVEDGIVDQVIEAICKAANTGQIGDGKIFVSNLEQTIRIRTG 142
172 2.000e-65gi|652866922|ref|WP_027135821.1| nitrogen regulatory protein P-II 1 [Geminicoccus roseus]  clstr ali  69  4IEAVIKPFKLDEVKEALQEIGLKGMTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIEVVVDDQLSERAVEAIQQAAKTDRIGDGKIFVYSVEDAVRIRTG 105
174 2.000e-65gi|517461502|ref|WP_018632245.1| nitrogen regulatory protein P-II 1 [Meganema perideroedes]  clstr ali  73  4IEAVIKPFKLDDVKEALQEIGVQGLTVLEAKGFGRQRGHTELYRGAEYVVDFLPKIKIEVVVNDDLLDQAVEAVVKAAKTGKIGDGKIFVTPVEQVIRIRTG 105
175 2.000e-65gi|836609438|ref|WP_047761390.1| nitrogen regulatory protein P-II 1 [Neisseria sp. KH1503]  clstr ali  69  4ITAMIKPFKLDDVREALSDIGIQGMTVSEVKGFGRQKGHTEVYRGAEYAVDFLPKIQLDIVLPDEQVERAVEAIIETARTGKVGDGKIFVTPVEQVIRIRTG 105
176 3.000e-65gi|498327395|ref|WP_010641551.1| nitrogen regulatory protein P-II [Acidithiobacillus thiooxidans]  clstr ali  73  4IEAIIKPFKLDDVREALQEIGLAGMTVTEVKGFGRQKGHTELYRGAEYVVDFLPKLKLEVVVGDDMADRAIEAIEQSARTGKIGDGKIFVSAVERIIRIRTG 105
177 3.000e-65gi|517436835|ref|WP_018607717.1| nitrogen regulatory protein P-II 1 [Uliginosibacterium gangwonense]  clstr ali  71  4IEAVIKPFKLDEVREALSEVGITGLTVSEVKGFGRQKGHTELYRGAEYVVDFLPKIKVEVVVSEALVDQTIEAIVKAARTGKIGDGKIFVLPVEQVVRIRTG 105
178 3.000e-65gi|779885440|ref|WP_045363861.1| nitrogen regulatory protein P-II 1 [Methyloceanibacter caenitepidi]  clstr ali  67  4VMAIIKPFKLDEVRQALTELGLQGMTVTEVKGYGRQKGHTEIYRGAEYAVNFLPKIKIEVVVPAKMVDNAVDAIVAAAKTGQIGDGKIFVVPVEQTVRIRTG 105
179 3.000e-65gi|494890712|ref|WP_007616758.1| nitrogen regulatory protein P-II 1 [Paraglaciecola arctica]  clstr ali  69  4IEAVIKPFKMDDVREALSDVGVSGMTVTEVKGFGRQKGHTELYRGAEYNVDFLPKVKVELIVANEQVDRCVEAIMNTAKTGKIGDGKIFVYDVERVIRIRTG 105
180 3.000e-65gi|655493914|ref|WP_028875315.1| nitrogen regulatory protein P-II 1 [Tepidiphilus margaritifer]  clstr ali  79  4VMAIIKPFKLDEVREALSENGVQGLTVAEVKGFGRQKGHTELYRGAEYVVDFLPKVKLEVAIPDELLEQVLEAIEKSAFTGKVGDGKIFVFDLENAIRIRTG 105
181 3.000e-65gi|927350169|gb|ALE17180.1| Nitrogen regulatory protein P-II [Altererythrobacter epoxidivorans]  clstr ali  72  24IEAIIKPFKLDEVKEALHEIGVSGITVTEAKGFGRQKGHTELYRGAEYVVDFLPKVKLEVVVSDTIAERVVEAISSAAQTGRIGDGKIFVSSIENALRIRTG 125
182 3.000e-65gi|345644445|dbj|BAK78278.1| nitrogen regulatory protein P-II [Pseudogulbenkiania sp. NH8B]  clstr ali  81  6VTAIIKPFKLDEVREGLSSIGVQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKLEIAIDDALLDQVVEAIEKSARTGKIGDGKIFVFDLQQVVRIRTG 107
183 3.000e-65gi|504057460|ref|WP_014291454.1| nitrogen regulatory protein P-II [Oceanimonas sp. GK1]  clstr ali  69  4IEAIIKPFKLDDVREALAERGITGMTVSEVKGFGRQKGHTELYRGAEYMVDFLPKVKLELVVQDELVEACIEAIETTARTGKIGDGKIFVLDVGQVIRIRTG 105
184 3.000e-65gi|517577455|ref|WP_018747663.1| nitrogen regulatory protein P-II 1 [Chitiniphilus shinanonensis]  clstr ali  70  4IEAIIKPFKLDEVREALSDLGISGLTVLEVKGFGRQKGHTELYRGAEYVVDFLPKTKVEVILADDQVEAAIEAIVQAARTGKIGDGKIFVTPVEHVVRIRTG 105
185 3.000e-65gi|496985251|ref|WP_009427336.1| nitrogen regulatory protein P-II [Neisseria sp. oral taxon 020]  clstr ali  68  4IEAIIKPFKLDDVREALTDIGITGMTVTEVKGFGRQKGHTEVYRGAEYAVDFLPKVKIELVLRDEQVDQVVDVIIETARSGKIGDGKIFIIPVEEAVRIRTG 105
188 3.000e-65gi|671608533|ref|WP_031580065.1| nitrogen regulatory protein P-II 1 [Ruminobacter sp. RM87]  clstr ali  72  4ITAIIKPFKLDDVRESLSSKGISGMTVTEVKGFGRQKGHTELYRGAEYVVDFLPKCKLEIVVKDEDVDSCIEAITQGAHTGKIGDGKIFVTSVDRVVRIRTG 105
189 3.000e-65gi|940340206|ref|WP_054965319.1| transcriptional regulator [Thiohalorhabdus denitrificans]  clstr ali  79  4VTAIIKPFKLDDVREALGEAGVQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVRIDVVVPADQAQAVVDAITDTAQTGKIGDGKIFVSPVEQAVRIRTG 105
190 4.000e-65gi|761528808|gb|AJP49127.1| nitrogen regulatory protein P-II 1 [Rhodocyclaceae bacterium PG1-Ca6]  clstr ali  77  4ITAIIKPFKLDEVREALATVGVQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKVEAAVGDEMVDQVVEALEKSARTGKIGDGKIFVYSLEQVIRIRTG 105
192 4.000e-65gi|488796694|ref|WP_002709100.1| nitrogen regulatory protein P-II 1 [Thiothrix nivea]  clstr ali  79  4VTAIIKPFKLDDVRDALGDIGIKGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKIKLEAAVAESQVDQVIEAISKAANTGKIGDGKIFVTSVEQVVRIRTG 105
194 4.000e-65gi|353460254|gb|AEQ94533.1| nitrogen regulatory protein P-II [Xanthomonas oryzae pv. oryzicola BLS256]  clstr ali  75  6ITAIIRPFKLDEVREALSAAGVSGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKIKIETVVTDDRLDAVVEAIQNAAGTGKIGDGKIFVTAIEQVVRIRTG 107
195 4.000e-65gi|498139926|ref|WP_010454082.1| nitrogen regulatory protein P-II [Succinivibrionaceae bacterium WG-1]  clstr ali  67  4ISAIIKPFKLDEVREALSAKGISGLTVSEVKGFGRQKGHTELYRGAEYVVDFLPKIKLEIVVKDEDVDACIDAIVHGAHTGKIGDGKIFVSSVERVIRVRTG 105
196 4.000e-65gi|500031926|ref|WP_011712644.1| nitrogen regulatory protein P-II 1 [Magnetococcus marinus]  clstr ali  70  4VEAIIKPFKLDDVKEALAEVGIQGITVSEVRGFGRQKGHTELYRGAEYVVDFLPKLKVEVVLTDDHVERAVEAIENAARTGRIGDGKIFVSPVDTAIRIRTG 105
197 4.000e-65gi|499630586|ref|WP_011311320.1| nitrogen regulatory protein P-II 1 [Thiobacillus denitrificans]  clstr ali  74  4IEAIIKPFKLDEVREALSEIGVTGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKLEVVVADNLVERVTEAVVNAARTGKIGDGKIFVTAVEQVVRIRTG 105
198 4.000e-65gi|692174189|ref|WP_032092902.1| hypothetical protein [Necropsobacter rosorum]  clstr ali  72  4ITAIIKPFRLDEVRDALSDIGIQGITVTEVNGFGRQKGHTELYRGAEYQVDFLPKVKIDIALSDERVDEVVDAICNAARTGHIGDGKIFIKPLERVVRIRTG 105
199 4.000e-65gi|501018645|ref|WP_012071322.1| nitrogen regulatory protein P-II 1 [Marinomonas sp. MWYL1]  clstr ali  87  4ITAIIKPFKLDDVREALSEIGVQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIELAIADEMTDQVVEAITGAANTGKIGDGKIFIVNLEQAVRIRTG 105
201 5.000e-65gi|938316912|ref|WP_054621138.1| transcriptional regulator [Rhodocyclaceae bacterium Paddy-1]  clstr ali  77  4VEAIIKPFKLDEVREGLSEIGVTGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKIKVEIVVADNQVDSVIEAIIKASRTGKIGDGKIFVSPVEQVVRIRTG 105
202 5.000e-65gi|504517386|ref|WP_014704488.1| nitrogen regulatory protein P-II 1 [Methylophaga frappieri]  clstr ali  79  4VVAIIKPFKLDDVRESLSEIGVQGLTVSEVKGFGRQKGHTELYRGAEYVVDFLPKLKLEIAVDDGIVEQVIEAVIKGANTGKIGDGKIFVYPLEQVVRIRTG 105
204 5.000e-65gi|817104786|ref|WP_046478134.1| hypothetical protein [Candidatus Filomicrobium marinum]  clstr ali  66  4VSAIIKPFKLEEVRTALSDLGIQGMTVTEVKGYGRQKGHTEIYRGAEYAVDFLPKLKIEIVVQSPDVDKAVEAIIDAAKTGQIGDGKIFVSSIEHAVRIRTG 105
205 5.000e-65gi|196194977|gb|EDX89936.1| nitrogen regulatory protein P-II [Alcanivorax sp. DG881]  clstr ali  90  11VTAVIKPFKLDDVREALSEIGVQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIEVAIAESSLDQVIEAIAKAANTGKIGDGKIFVTSLEQAIRIRTG 112
206 5.000e-65gi|503793752|ref|WP_014027746.1| nitrogen regulatory protein P-II 1 [Acidithiobacillus ferrivorans]  clstr ali  75  4ITAIVKPFKLDDVREALSAVGIQGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIEAVISDDAVDQAVEAIEKGARTGKIGDGKIFVSEVLEAIRIRTG 105
207 5.000e-65gi|496216758|ref|WP_008931000.1| nitrogen regulatory protein P-II [Ectothiorhodospira sp. PHS-1]  clstr ali  74  4IEAIIKPFKLEDVREALMEIGVTGLTATEVKGFGRQKGHTELYRGAEYVVDFIPKVKLEIGVDDSLVDACVEAILKAARTGKIGDGKIFVTDMERAIRIRTG 105
208 5.000e-65gi|219675232|gb|EED31598.1| nitrogen regulatory protein P-II [gamma proteobacterium NOR5-3]  clstr ali  84  11ITAIVKPFKLDDVRESLSEIGVQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIEVAVAEGMVDQTIEAITKSANTGKIGDGKVFVSSLEQVIRIRTG 112
209 6.000e-65gi|238707496|gb|EEP99856.1| Nitrogen regulatory protein P-II 2 [Yersinia ruckeri ATCC 29473]  clstr ali  76  57VTVVIKPFKLEDVREALSSIGIQGLTVTEVKGFGRQKGHAELYRGAEYSVNFLPKVKIDIAIADDQLDEVVDVISKAAYTGKIGDGKIFVAELQRVIRIRTG 158
210 6.000e-65gi|636536112|gb|KDM68503.1| nitrogen regulatory protein P-II [Acidiphilium sp. JA12-A1]  clstr ali  73  52IEAIIKPFKLDEVKEALHEVGLQGITVMEAKGFGRQKGHTELYRGAEYVVDFLPKVKIEVICEDAVAERAIEAITNAARTGRIGDGKIFVSTIEEVIRIRTG 153
211 6.000e-65gi|499395973|ref|WP_011083440.1| nitrogen regulatory protein P-II 1 [Bradyrhizobium diazoefficiens]  clstr ali  70  25VMAIIKPFKLEEVRDALTAIGVHGLTVTEVKGYGRQKGHTEIYRGAEYAVSFLPKIKIEVAVASDQVDKTIDAITSAAKTGQIGDGKIFVINLDHAVRIRTG 126
212 6.000e-65gi|497538097|ref|WP_009852295.1| nitrogen regulatory protein P-II 1 [beta proteobacterium KB13]  clstr ali  70  4IDAIIKPFKLDEVREALAEVGIEGLTVTEVKGFGRQKGHTELYRGAEYVIDFLPKMKLEIVVSDKMVDKVIETIKNTAHTGKIGDGKIFVSPVEKAIRIRT. 104
213 6.000e-65gi|489256886|ref|WP_003164817.1| nitrogen regulatory protein P-II 1 [Brevundimonas diminuta]  clstr ali  65  4IEAVIKPFKLDEVKDALQDIGVQGMTVLEAKGYGRQKGHSELYRGAEYVIDFLPKIKIEVVVADDLAPAVVETIQNAARTGKIGDGKIFITPLEDVIRIRTG 105
214 7.000e-65gi|501280802|ref|WP_012323820.1| nitrogen regulatory protein P-II 1 [Shewanella woodyi]  clstr ali  77  4ITAIIKPFKLDDVREALSSLGVQGLTVTEVKGFGRQKGHAELYRGAEYSVDFLPKIKLEIAISSGHEDEVIEAIINAANTGKIGDGKIFVSPLEQVVRIRT. 104
215 7.000e-65gi|524660158|emb|CDD71471.1| candidate Nitrogen regulatory protein P-II [Sutterella sp. CAG:397]  clstr ali  74  4VVAIVKPFKLDEVREALADIGVNGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIEAAVADDLVERCLEAIQKSARTGKIGDGKIFVFDVEQVIRIRTG 105
217 7.000e-65gi|496211513|ref|WP_008928242.1| nitrogen regulatory protein P-II 1 [Alcanivorax hongdengensis]  clstr ali  75  5.TAVIKPFKVDDVRDALAQVGIQGMTVTEVKGFGRQKGHTELYRGAEYVVDFVPKVKLELAVREELLDQAIEAILKSAATGKIGDGKIFVSDLEQAIRIRTG 105
218 7.000e-65gi|551333308|ref|WP_022952745.1| nitrogen regulatory protein P-II 1 [Leucothrix mucor]  clstr ali  85  4ITAIIKPFKLDDVREALSEIGVAGITVTEVKGFGRQQGHTELYRGAEYVVDFLPKVKIEAAVDAALLDQAIEAITKAANTGKIGDGKIFVTALEQAIRIRT. 104
219 7.000e-65gi|748134565|ref|WP_039709861.1| nitrogen regulatory protein P-II 1 [Scytonema millei]  clstr ali  69  4IEAIIKPFKLDDVRDALQEIGVQGMTIVEAKGFGRQKGHSELYRGAEYVIDFLPKIKIELVAPDARVDAIVEAIQTAAHTGRIGDGKIFVTPVETAIRIRTG 105
220 7.000e-65gi|1001906295|gb|AMM40041.1| nitrogen regulatory protein P-II 1 [delta proteobacterium HotSeep1]  clstr ali  65  4IEAIIKPFKLDEVKEALTEIGIQGMTVTEVRGFGRQKGHTEIYRGAEYVVDFLPKIKIEIVVPDNLVLKTLEIIQHSASTGKMGDGKIFVFPVDEAVRIRTG 105
221 7.000e-65gi|494043986|ref|WP_006986105.1| nitrogen regulatory protein P-II 1 [Cardiobacterium valvarum]  clstr ali  74  4ITAIIKPFKLDDVREALSDIGVQGITVTEVKGFGRQKGHTELYRGAEYVIDFLPKLKLEIAVSDDLAGRVVETIRDTANSGKIGDGKIFVTSLERVVRIRTG 105
222 8.000e-65gi|659876247|ref|WP_029923022.1| nitrogen regulatory protein P-II 1 [Nevskia soli]  clstr ali  76  4IVAVIKPFKLDDVREALSELGVSGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKIKLEIAIEDERSEAAVDVISKAAHTGKIGDGKIFVYTLDQAIRIRTG 105
223 8.000e-65gi|492534344|ref|WP_005876183.1| nitrogen regulatory protein P-II 1 [Oxalobacter formigenes]  clstr ali  76  4ITAIIKPFKLDEVREALSDANINGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIEVVVDDSVLELAIEAILKSARTGKIGDGKIFVQDIEQVIRIRTG 105
224 8.000e-65gi|970579408|ref|WP_058836223.1| transcriptional regulator [Luteimonas abyssi]  clstr ali  74  4VMAIIKPFKLDDVREALGEVGVTGVTVTEVKGFGRQKGHTELYRGAEYVVDFLPKLKLEIAVPDDQAEAVVDAILKTANTGKIGDGKVFIYDLDRAIRIRTG 105
225 9.000e-65gi|660525490|gb|KEO55332.1| nitrogen regulatory protein P-II 1 [Thalassospira permensis NBRC 106175]  clstr ali  75  11VTAVIKPFKLDEVREALSALGVQGLTVTEVKGFGRQKGQTEIYRGAEYMVSFLPKVKLEVAITDNLVDQVVEAITKTAQTGKIGDGKIFVLDVSQAVRIRTG 112
226 9.000e-65gi|656109766|ref|WP_029133304.1| nitrogen regulatory protein P-II 1 [Sedimenticola selenatireducens]  clstr ali  77  4VDAIIKPFKLDDVREALSAVGITGMTASEVKGFGRQKGHTELYRGAEYVVDFLPKVKIEVVINDNQLDDCIEAITSAAKTGKIGDGKIFVSTVEKVVRIRTG 105
227 9.000e-65gi|503774063|ref|WP_014008135.1| nitrogen regulatory protein P-II 1 [Collimonas fungivorans]  clstr ali  78  4ITAIIKPFKLDEVREALSAIGVQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKTKIEAAVDDSILEQAVEAIENAARTGKIGDGKIFVFDLQEVIRIRTG 105
228 1.000e-64gi|947302304|ref|WP_056007862.1| transcriptional regulator [Frateuria sp. Soil773]  clstr ali  73  4ITAIIKPFKLDEVREALAEVGVQGMTVTEVKGFGRQHGHTELYRGAEYVVDFLPKLKIEIAVSDAQAEQAIEAIADTARTGKVGDGKILVFELEQVMRIRT. 104
229 1.000e-64gi|735025938|dbj|GAM04929.1| nitrogen regulatory protein P-II 1 [Novosphingobium sp. MBES04]  clstr ali  73  17IEAIIKPFKLDEVKEALHEVGVSGITVTEAKGFGRQKGHTELYRGAEYVVDFLPKVKLEVVVSDTLAERVVEAIADAAQTGRIGDGKIFVVPVETAIRIRTG 118
230 1.000e-64gi|659916237|gb|KEK29642.1| nitrogen regulatory protein P-II 1 [Shewanella xiamenensis]  clstr ali  76  23VSAIIKPFKLDDVREAIAGIGIEGMTVTEVKGFGRQKGHTELYRGAEYQVDFLPKVKLEIATKAENLDMLIEAITTAAHTGKIGDGKIFVIDLEHAIRIRTG 124
231 1.000e-64gi|662245323|gb|KEQ01832.1| Nitrogen regulatory protein PII, partial [Snodgrassella alvi SCGC AB-598-J21]  clstr ali  69  9ITAMIKPFKLDDVREALAEIGVQGMTVSEVKGFGRQKGHTEIYRGAEYEVDFLPKIKIEIVLVDDLVERAVEAIMTCASTGKVGDGKIFVSAVEQVVRIRTG 110
232 1.000e-64gi|493948491|ref|WP_006892404.1| nitrogen regulatory protein P-II 1 [Methylobacter tundripaludum]  clstr ali  79  4ITAIIKPFKMDDVREALSEIGVAGVTATEVKGFGRQKGHTELYRGAEYVVDFLPKVKLEIAVADDVLDKAVETIVNAANTGKIGDGKIFVSNLEQVIRIRTG 105
233 1.000e-64gi|145563610|gb|ABP74545.1| nitrogen regulatory protein P-II [Shewanella putrefaciens CN-32]  clstr ali  73  28VTTIIKPFKLDDVREALTQLGINGMTVTEVRGFGRQKGHTELYRGAEYAVDFLPKIKLEMAIHTEQEDAVIEAIMTAAHTGKVGDGKIFVTDLEQVVRIRT. 128
234 1.000e-64gi|226837518|gb|EEH69901.1| nitrogen regulatory protein P-II [Acinetobacter sp. ATCC 27244]  clstr ali  84  22VTAIVKPFKLDDVREALSDIGVQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIEIAISDEMVDAVIESITRVASTGKIGDGKIFVTNLEQVIRIRTG 123
235 1.000e-64gi|551331030|ref|WP_022950467.1| nitrogen regulatory protein P-II 1 [Leucothrix mucor]  clstr ali  80  4ITAIIKPFKLDDVRESLSEMGIYGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIETAVDDDRVDEAIEAIIKAANTSKIGDGKIFVTHIEQTIRIRTG 105
236 1.000e-64gi|524009685|emb|CCX92198.1| nitrogen regulatory protein P-II [Succinatimonas sp. CAG:777]  clstr ali  70  4IVAIIKPFKLDDVREALATIGISGMTVSDVKGFGRQKGHTELYRGAEYVVDFLPKCKLEVVVADDEADKCIQAIINAAHTGKIGDGKIFVSDVERVIRIRT. 104
237 1.000e-64gi|633287493|gb|KDB52407.1| nitrogen regulatory protein P-II [Sphaerotilus natans subsp. natans DSM 6575]  clstr ali  73  6ITAIIKPFKLEEVREALAEVGVTGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKVEIVVKGGDVDRCLEAIVKAAHTGKIGDGKIFVTPVEQVIRIRTG 107
238 1.000e-64gi|696545880|ref|WP_033078725.1| nitrogen regulatory protein P-II 1 [Thalassotalea sp. ND16A]  clstr ali  71  4INAIIKPFKLDDVREAISEVGIEGLTVSEVRGFGRQKGHTELYRGAEYQVDFLPKVKLEIAVKAEDAERIIEAITKSAHTGKIGDGKIFVYDLESAVRIRTG 105
239 1.000e-64gi|502587463|ref|WP_012825197.1| nitrogen regulatory protein P-II 1 [Halothiobacillus neapolitanus]  clstr ali  79  4VTAIIKPFKLDDVREALSTIGVKGITMTEVKGFGRQKGHTELYRGAEYVVDFLPKVKLEMVVDDATVEPVIDAITKAASTGKIGDGKIFVSTIEEAIRIRTG 105
240 1.000e-64gi|654341794|ref|WP_027835243.1| nitrogen regulatory protein P-II 1 [Maritalea myrionectae]  clstr ali  70  4IEAIVKPFKLDEVKEALQDAGFQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIEIVVADHMAEEAVEAIRNAAQTGRIGDGKIFVSTIDQAIRIRTG 105
241 1.000e-64gi|928911901|ref|WP_053937095.1| transcriptional regulator [Amantichitinum ursilacus]  clstr ali  73  4IEAIIKPFKLDEVREALSEIGISGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKIKVEVVLPADKVDAAVEAIQVAARTGKIGDGKIFVTSVEQAVRIRTG 105
242 1.000e-64gi|493948493|ref|WP_006892406.1| nitrogen regulatory protein P-II 1 [Methylobacter tundripaludum]  clstr ali  79  4ITAVVKPFKLDDVREALSDIGVSGVTVTEVKGFGRQKGHTELYRGAEYVVDFLPKAKIEVAVADNMLEQAVEAITKAANTSKIGDGKIFVTNLEQVVRIRTG 105
243 2.000e-64gi|504772514|ref|WP_014959616.1| nitrogen regulatory protein P-II [Desulfobacula toluolica]  clstr ali  66  4IEAIIKPFKLDDVKEALSEIGIYGMTVTEVNGYGRQKGHKEIYRGAEYVVDFVPKIKIEIVVSDERLDEAVETVRNAANTGKIGDGKIFILPVEQVVRVRTG 105
244 2.000e-64gi|954046956|gb|ALP40714.1| nitrogen regulatory protein P-II [Aeromonas schubertii]  clstr ali  71  13.TAIIKPFKLDDVREAIADLGVEGLTVSEVKGFGRQKGHTELYRGAEYQVDFLPKVKLEIATVAENVEQIIEAICSAAYTGKIGDGKIFVYDLQHAVRIRTG 113
245 2.000e-64gi|696561254|ref|WP_033093134.1| nitrogen regulatory protein P-II 1 [Colwellia psychrerythraea]  clstr ali  67  4IEAIIKPFKMDDVREALGEIGVTGMTVSEVKGFGRQKGHTELYRGAEYMVDFLPKVKLEIVIAKEDVERCVNAILETAQTGKIGDGKIFITDVERVIRIRTG 105
246 2.000e-64gi|515521518|ref|WP_016954772.1| nitrogen regulatory protein P-II [Catenovulum agarivorans]  clstr ali  72  4VEAIIKPFKLDDVREALAEIGITGMTVTEVKGFGRQKGHTELYRGAEYNVDFLPKVRLDIVLSDDEVDRCLETIVKVAQSGKIGDGKIFVTNVERVIRIRTG 105
247 2.000e-64gi|982009488|ref|WP_060185149.1| transcriptional regulator [Alcaligenes faecalis]  clstr ali  73  4ITAIIKPFKLDEVREALAELDVNGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKIRVDIVVAADRCDAIVEAIIKAAHTGKIGDGKIFVTPVEQAIRIRT. 104
248 2.000e-64gi|499962552|ref|WP_011643270.1| nitrogen regulatory protein P-II 1 [Maricaulis maris]  clstr ali  69  4IEAIIKPFKLDDVKEALQEIGVQGLTVIEAKGFGRQKGHTELYRGAEYVVDFLPKIKIELVLPADRVEAAVEAIQTAAQTGRIGDGKIFVSPIESVIRIRTG 105
249 2.000e-64gi|491065422|ref|WP_004927053.1| nitrogen regulatory protein P-II 1 [Providencia stuartii]  clstr ali  73  4IIAIIKPFKLDEVREALSDIGIQGLTMTEVRGFGRQKGHSELYRGAEYTVDFLPKVRLEIAVSDEFADLVIESIEKAANTGQVGDGKIFVLELEQAIRIRTG 105
250 2.000e-64gi|494438502|ref|WP_007231781.1| MULTISPECIES: nitrogen regulatory protein P-II 1 [unclassified Porticoccaceae]  clstr ali  73  4ITAIVKPFKLDEVREALGDLGVAGVTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKLEIALADEMVDSAVEAITNAAQTGKIGDGKIFISTLEEVIRIRTG 105
251 2.000e-64gi|952343015|gb|KRT65297.1| nitrogen regulatory protein P-II, nitrogen regulatory protein P-II 1 [Candidatus Dadabacteria bacterium CSP1-2]  clstr ali  69  4IEAIIKPFKLDDVKESLKEVGVQGLTVTEIKGFGRQKGHTELYRGAEYVVDFLPKIKLEIIVSDDMVTKVVDAIMDSARTGKIGDGKIFILPMEEVIRIRTG 105
252 2.000e-64gi|1000084214|gb|KXJ52170.1| transcriptional regulator [Colwellia sp. Phe_37]  clstr ali  71  4VTAIIKPFKMDDVREALSEIGIDGMTVTEVKGFGRQKGHTELYRGAEYSVDFLPKIKFEIAVKDDFAERVVETIISSAHTGKIGDGKIFVTDIESVTRIRTG 105
253 2.000e-64gi|759391217|ref|WP_043116425.1| nitrogen regulatory protein P-II 1 [Solemya velum gill symbiont]  clstr ali  76  4VTAIIKPFKLDDVREALGDLGLSGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKTKIEAVVPADVLDQVIEAISSAAQTGKIGDGKIFVSSVEQVVRIRTG 105
255 2.000e-64gi|518734307|ref|WP_019894085.1| nitrogen regulatory protein P-II 1 [Thiomicrospira halophila]  clstr ali  71  4ITAIIKPFKLDDVREALHDIGVHGMTVIDVKGYGRQKGHTEMYRGAEYVVDFLPKLKLEIAVSEEQVDQVVEAVVDASQTGKIGDGKIFVTNIEQTIRIRTG 105
256 2.000e-64gi|931486373|gb|KPK67029.1| transcriptional regulator [Acidithiobacillales bacterium SM23_46]  clstr ali  85  4VIAIIKPFKLDDVREALSEVGVQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKLEVAIEASLLDRVIEAISKAARTGKIGDGKIFITDLEQVVRIRTG 105
257 2.000e-64gi|494014016|ref|WP_006956391.1| nitrogen regulatory protein P-II 1 [Idiomarina baltica]  clstr ali  65  4ITALIKPFKLDDVRQALADIGCTGMTIAEVRGFGRQKGHTELYRGAEYRVDFLPKIRLELAVSDDQLERAVEVISEAAHTGNIGDGKIFVTHLEHCVRIRTG 105
258 2.000e-64gi|906868157|ref|WP_049726587.1| transcriptional regulator [Wenzhouxiangella marina]  clstr ali  68  4ITAIIKPFKLDDVRDALGEVGVTGMTVSEVKGFGRQKGHTELYRGAEYVVDFLPKLKLEIAVPDADADRVVETIVETAASGRIGDGKIFVTTIDRAVRIRTG 105
259 2.000e-64gi|651237546|ref|WP_026377009.1| hypothetical protein [Aestuariibacter salexigens]  clstr ali  76  4VEAIIKPFKLDDVREALAEVGITGMTVTEVKGFGRQKGHTEMYRGAEYQVDFLPKVKIEVVIVDDKVDLVTEAIIKTAQTGKIGDGKVFVYDLQQAIRIRTG 105
261 2.000e-64gi|488816444|ref|WP_002728850.1| nitrogen regulatory protein P-II 1 [Phaeospirillum molischianum]  clstr ali  73  4IMAIIKPFKLDEVREALTPLGVQGLTVSEVKGFGRQKGQTEIYRGAEYVVNFLPKVKIEVAVNDELADRVVEAIQAAARTGKIGDGKIFVTELQQAFRIRTG 105
262 2.000e-64gi|655940507|ref|WP_028988731.1| nitrogen regulatory protein P-II 1 [Thermithiobacillus tepidarius]  clstr ali  77  4IIAVIKPFKLDDVREALSEIGVQGVTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKLDVVVPDELLEQAIDAIERAARTGKIGDGKIFVQDVERAVRIRTG 105
263 2.000e-64gi|494334953|ref|WP_007184577.1| nitrogen regulatory protein P-II 1 [Hydrocarboniphaga effusa]  clstr ali  80  4IAAIIKPFKLDEVREALSEIGVAGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIEVAVDDDKTDAAIDAISKAAHTGKIGDGKVFVFGLEQAVRIRTG 105
264 2.000e-64gi|817528938|gb|KKO72400.1| nitrogen regulatory protein P-II 1 [Kerstersia gyiorum]  clstr ali  71  4IIAIIKPFKLDEVRVALSTAGVQGMTVSEVNGFGRQKGHTELYRGAEYAVDFLPKLRIEVVVPDAQLDTTLEAIESAAYTGKIGDGKLFVVPVERAVRIRTG 105
265 2.000e-64gi|659913575|gb|KEK27119.1| nitrogen regulatory protein P-II [Shewanella xiamenensis]  clstr ali  71  13ITAIIKPFKIDDVREALTQLGVHGMTVTEVRGFGRQKGHTELYRGAEYAVDFLPKMKLEIAIHSELEEAVIEAIIQAARTGKVGDGKIFVTPLEQVIRVRT. 113
266 2.000e-64gi|551027221|ref|WP_022771305.1| nitrogen regulatory protein P-II 1 [Candidatus Symbiobacter mobilis]  clstr ali  72  4ITAIIKPFKLEEVRRALSDCGVTGMTVTEVKGFGRQKGHTELYRGAEYVVDYLPKVKIDVVVADENLDRCIDAILQTARTGKIGDGKIFVTPVDRVIRIRTG 105
267 2.000e-64gi|494913512|ref|WP_007639550.1| nitrogen regulatory protein P-II 1 [Cellvibrio sp. BR]  clstr ali  76  4VTAIIKPFKLDVVREALSDIGVHGMTVTEVKGFGRQKGHSELYRGAEYVVDFLPKTKVEIAVSDAETDAVVEAISKAANSSKIGDGKIFVSSLEQVVRIRTG 105
269 2.000e-64gi|502027107|ref|WP_012698375.1| nitrogen regulatory protein P-II 1 [Laribacter hongkongensis]  clstr ali  80  4VSAIIKPFKLDEVREALAAVGVQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKLEIAIEDDQLDRVLESIEGAARTGKIGDGKIFVYDLEQVVRIRTG 105
270 2.000e-64gi|496118359|ref|WP_008842866.1| nitrogen regulatory protein P-II 1 [Aliiglaciecola lipolytica]  clstr ali  73  4IEAIIKPFKLDDVRASLTEAGVSGLTVTEVKGYGRQKGHTETYRGAEYNVDFLPKVKIEVVVPDADVDRCIEAIMEVAATGKIGDGKIFVTPVAQAIRIRTG 105
271 2.000e-64gi|494600868|ref|WP_007359121.1| MULTISPECIES: nitrogen regulatory protein P-II 1 [unclassified Opitutaceae]  clstr ali  67  4IIAIIKPFKLENVKEALSGIGIEGMTITEVKGFGRQKGHTEIYRGSEYTVDFLPKTKIEIVVSDDMLDKAINAILQAAKTGKIGDGKIFVLPIEEAVRIRT. 104
272 3.000e-64gi|551337436|ref|WP_022956863.1| nitrogen regulatory protein P-II 1 [Perlucidibaca piscinae]  clstr ali  77  4ITAVIKPFKLDDVREALSAIGVTGLTVTEVKGFGRQKGHTELYRGAEYVVDFVPKVRLDLAIADDQLDQVIEVITQSASTGKIGDGKIFVTDLLHVVRIRTG 105
273 3.000e-64gi|723288225|gb|KHD08492.1| nitrogen regulatory protein P-II 1 [Candidatus Thiomargarita nelsonii]  clstr ali  83  4VTAIIKPFKLDDVREALSEVGVQGITVTEIKGFGRQQGHTELYRGAEYVVDFLPKVKIEAAVSEDNLEKVIDAITKAANTGKIGDGKIFVYALEQTIRIRTG 105
274 3.000e-64gi|495528215|ref|WP_008252857.1| nitrogen regulatory protein P-II 1 [Limnobacter sp. MED105]  clstr ali  75  4VSAIIKPFKLDEVREALSEVGVTGLTVTEVKGFGRQRGHTELYRGAEYVVDFLPKVKIELVIEDKLVDQAIDAIQNAARTNKIGDGKIFVTDVERVIRIRTG 105
276 3.000e-64gi|653108831|ref|WP_027358633.1| nitrogen regulatory protein P-II 1 [Desulforegula conservatrix]  clstr ali  68  4IEAIIKPFKLDDVKEALNKIGVQGMTITEVKGYGRQKGHKEIYRGAEYVVDFIPKVKIELVVDDEQSEKVADAIINAARTGQIGDGKIFILNVEEAVRIRTG 105
277 3.000e-64gi|763067162|ref|WP_043948872.1| nitrogen regulatory protein P-II 1 [Candidatus Phaeomarinobacter ectocarpi]  clstr ali  68  4IEAIIKPFKLDEVKEALNDVGLQGITVTEAKGFGRQKGHTELYRGAEYVVDFLPKVKIEIVLSEEQVEPALEAIQNAARTGRIGDGKIFITNVEEVVRIRTG 105
278 3.000e-64gi|788036329|ref|WP_045777258.1| nitrogen regulatory protein P-II 1 [Elstera litoralis]  clstr ali  70  4ITAIIKPFKLEDVREALTALGIQGLTASEVKGFGRQKGQTEIYRGAEYAVSFLPKVKIEVAVADELEDQVVEAIQKAAHTGRIGDGKIFVLDLSRAVRIRTG 105
279 3.000e-64gi|736609540|ref|WP_034617986.1| hypothetical protein [Chelonobacter oris]  clstr ali  69  4IEAIIKPFKLDDVREALSDVGITGMTVSEVKGFGRQKGHTEIYRGAEYMVDFLPKVKLEIVIADEQVDICINTIIETAQTGKIGDGKIFVYDVERVIRIRT. 104
280 3.000e-64gi|648531130|ref|WP_026222881.1| nitrogen regulatory protein P-II 1 [Methylocystis rosea]  clstr ali  69  4VTAIIKPFKLDEVRDALTNIGVHGLTVTEVKGYGRQKGHTEIYRGAEYAISFLPKLKIEVAVDAALVEQVIQAISNTARTGQIGDGKIFVTPLERAIRIRTG 105
281 3.000e-64gi|495559426|ref|WP_008284005.1| nitrogen regulatory protein P-II 1 [gamma proteobacterium HTCC5015]  clstr ali  81  4VTAIIKPFKLDDVREALAEVGVQGVTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKLEVGIDDSAVDQVIEAISGAAHTGKIGDGKVFVTPLESALRIRTG 105
282 3.000e-64gi|522046800|ref|WP_020558009.1| hypothetical protein [Thiothrix flexilis]  clstr ali  71  4IQAIIKPFKLDDVREALTEIGITGMTAIEVKGFGRQKGHTELYRGAEYVVDFLPKIKLEIVTTDDKVEAVIDAILKAAQTSKIGDGKIFVLPVDQAIRIRTG 105
283 3.000e-64gi|760087474|ref|WP_043769940.1| nitrogen regulatory protein P-II 1 [Algiphilus aromaticivorans]  clstr ali  71  5.TAIIKPFKLDAVREALADIGVQGMTVTEVRGFGRQKGHTELYRGAEYTVDLLPKIKLEVALPEDMIDRAVEAIQSAAKTGQIGDGKIFISTLEQTVRIRTG 105
285 3.000e-64gi|692424392|ref|WP_032137689.1| nitrogen regulatory protein P-II 1 [Kingella sp. Sch538]  clstr ali  64  4IEALIKPFKLDDVREALTDVGITGMTVTEVKGFGRQKGHTEVYRGAEYAVDFLPKVKIELVLADDMVERVVEVLMETARSGKIGDGKIFIYPVEEVIRIRTG 105
287 3.000e-64gi|503302725|ref|WP_013537386.1| nitrogen regulatory protein P-II 1 [Thermovibrio ammonificans]  clstr ali  69  4IEAIIKPFKLEEVKDALTEIGVQGLTVSEVKGFGRQKGHTELYRGAEYVVDFIPKVKIEVVVPDSIAEKVVETIVNAARTGRIGDGKVFVIPVEDAVRIRTG 105
288 3.000e-64gi|517575954|ref|WP_018746162.1| nitrogen regulatory protein P-II 1 [Chitiniphilus shinanonensis]  clstr ali  80  4VTAIIKPFKLDEVREALSAIGVQGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKVDVAIADDLVEQTIEAIEKAAQTGKIGDGKIFVFDLQHVVRIRTG 105
289 3.000e-64gi|502478024|ref|WP_012801013.1| nitrogen regulatory protein P-II [Kangiella koreensis]  clstr ali  70  4IEAIIKPFKLDDIREALTDLGVNGMTVTEVKGFGRQKGHTELYRGAEYMVDFLPKAKIEVVINDELVDKCVETIIEVARTGKIGDGKIFVTNVERTVRIRTG 105
290 4.000e-64gi|494657985|ref|WP_007415929.1| nitrogen regulatory protein P-II 1 [Pedosphaera parvula]  clstr ali  65  6IEAIIKPFKLEEVKDALGEVGIEGMTVSEVKGFGRQKGHTEIYRGSEYTVDFLPKIKLELVVADDQLDAAVTAIVKSAKTGKIGDGKVFVSNVEDAIRIRT. 106
291 4.000e-64gi|517801681|ref|WP_018971889.1| nitrogen regulatory protein P-II 1 [Rudaea cellulosilytica]  clstr ali  76  4VTAVIKPFKLDDVRQALAEVGVQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKIKIEIAVADNLVERVVETILASANSGKIGDGKIFVHDLEQVIRIRTG 105
292 4.000e-64gi|500031952|ref|WP_011712670.1| nitrogen regulatory protein P-II 1 [Magnetococcus marinus]  clstr ali  69  4IVAIIKPFKLDEVREALTSVGISGITVSEVRGFGRQKGHTELYRGAEYRVDFLPKLKVELAVDDSILEQAVEAIQKGAKTSKIGDGKIFVYDLESAVRIRTG 105
293 4.000e-64gi|763068596|ref|WP_043950300.1| nitrogen regulatory protein P-II 1 [Candidatus Phaeomarinobacter ectocarpi]  clstr ali  68  4VMAVIKPFKLDEVREALTSLGVQGLTVTEVKGFGRQKGHTEVYRGAEYAVSFLPKLKIEVVIKDEQVEQVVESIASNAKTGQIGDGKIFVYPIDQVMRIRTG 105
294 4.000e-64gi|502735032|ref|WP_012970016.1| nitrogen regulatory protein P-II [Allochromatium vinosum]  clstr ali  71  4VEAIIKPFKLDDVREALSAAGITGMTAIEVKGFGRQKGHTELYRGAEYVVDFLPKVKIELVLADDQVEECINAITTAARTGKIGDGKIFVSDVTRVVRIRTG 105
295 4.000e-64gi|517842735|ref|WP_019012943.1| nitrogen regulatory protein P-II 1 [Elioraea tepidiphila]  clstr ali  72  4IMAIIKPFKLDDVREALTPLGVQGLTVSEVKGFGRQKGQTEIYRGAEYHVNFLPKVKIELVVEDGMVDAVCEAITKSAHTGKIGDGKIFVLDVGRAIRIRTG 105
296 4.000e-64gi|363715281|gb|EHL98734.1| nitrogen regulatory protein P-II [Acetobacteraceae bacterium AT-5844]  clstr ali  69  7IEAIIKPFKLDEVKDALHEIGLQGLTVVEAKGFGRQKGHTELYRGAEYVVDFLPKVKIEVVCSDDLAERAIEAIQAAARTGRIGDGKIFVSDIHEVIRIRTG 108
297 4.000e-64gi|506382371|ref|WP_015902090.1| nitrogen regulatory protein P-II [Nautilia profundicola]  clstr ali  65  4IEAVIKPFKLDDVKEALLEIGIHGMTISEVKGHGRQQGHAELYRGAEYIVDFLPKVKIELVVADDDVEKVIETISESARTGKIGDGKIFVSPVEKVIRIRTG 105
301 4.000e-64gi|492774647|ref|WP_005960798.1| MULTISPECIES: nitrogen regulatory protein P-II [sulfur-oxidizing symbionts]  clstr ali  74  4VEAIIKPFKLEDVREALSAEGITGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIEVVVAEAAVQSCIEAITNAARTGKIGDGKIFVSPVEKVIRIRTG 105
302 5.000e-64gi|501549290|ref|WP_012553804.1| nitrogen regulatory protein P-II 1 [Gluconacetobacter diazotrophicus]  clstr ali  65  4IEAIIKPFKLDEVKDALHEIGLMGISVTEAKGFGRQKGHTELYRGAEYIVDFLPKVKLEIVCADNLVDRAVETIMAAARTGRIGDGKIFILPVEDVIRIRTG 105
306 5.000e-64gi|490889830|ref|WP_004751783.1| nitrogen regulatory protein P-II [Acinetobacter sp. ANC 3789]  clstr ali  80  4ITAIIKPFKLDDVREALAAIGVQGITVTEVKGAGRQKGHTEMYRGAEYVVDFLPKVKLEIALDNSALDQAIEAISKAAATGKIGDGKIFVSHLEQVIRIRTG 105
307 5.000e-64gi|931477420|gb|KPK58624.1| transcriptional regulator [Gammaproteobacteria bacterium SG8_31]  clstr ali  76  4VCAIIKPFKLDDVREAIADLGVQGVTVTEVKGFGRQKGHTELYRGAEYVVDFLPKIKLELAVDDSLLEQVVESITNVARTGKIGDGKIFVYDLEKAIRIRTG 105
308 5.000e-64gi|518386158|ref|WP_019556365.1| nitrogen regulatory protein P-II 1 [Thiomicrospira arctica]  clstr ali  68  4ITAVIKPFKLDDVRDALHEIDIHGMTVSEVKGYGRQKGHTEMYRGAEYVVDFLPKLKLEIAVTADLAEAAIESIINAAQTGKIGDGKIFVTNIEQTIRIRT. 104
309 5.000e-64gi|503874086|ref|WP_014108080.1| nitrogen regulatory protein P-II [Glaciecola nitratireducens]  clstr ali  73  4IEAIIKPFKLDDVREGLSSIGVSGITMTEVRGFGRQKGHKELYRGAEYNVDFLPKVKIELVVPDDLLDRAVETILAHAKTGKIGDGKIFVFNVEQVIRIRTG 105
310 5.000e-64gi|502736532|ref|WP_012971516.1| nitrogen regulatory protein P-II 1 [Allochromatium vinosum]  clstr ali  76  4VSAVIKPFKLDDVREALGDIGVSGITVVEVKGFGRQKGHTELYRGAEYVVDFLPKIKVEIAVDDAMVDQVIEAISNAARTGKIGDGKIFVFELDQVIRIRTG 105
311 5.000e-64gi|551358220|ref|WP_022977574.1| nitrogen regulatory protein P-II 1 [Nevskia ramosa]  clstr ali  76  4ITGIIKPFKLDEVREALANIGVSGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKLKLEVAVRDELVEPTIDAITKAAHTGKIGDGKIFVTELEQVLRIRTG 105
312 5.000e-64gi|495338139|ref|WP_008062875.1| nitrogen regulatory protein P-II 1 [Methyloversatilis universalis]  clstr ali  74  4IEAVIKPFKLDEVREGLSEVGVTGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKIKIEVIVADETVEQAVEAIIKAARTGKIGDGKIFVMPVEQVIRIRTG 105
313 5.000e-64gi|1000080822|gb|KXJ49176.1| transcriptional regulator [Alcanivorax sp. Nap_24]  clstr ali  72  4ITAVIKPFKVDDVRDALAQIGVQGMTVTEVKGFGRQKGHTELYRGAEYVVDFVPKVKLELAVVDERVDQAVEAIAQAASSGKIGDGKIFITALEQALRIRTG 105
314 5.000e-64gi|779889997|ref|WP_045366679.1| nitrogen regulatory protein P-II 1 [Methyloceanibacter caenitepidi]  clstr ali  69  4IEAIIKPFKLDEVKEALQEIGLQGITVTEAKGFGRQKGHTELYRGAEYVVDFLPKVKLELVLVDNMVDKAVDAIVSSAKTGRIGDGKIFVSQVEEAVRIRTG 105
315 5.000e-64gi|654847429|ref|WP_028299927.1| nitrogen regulatory protein P-II 1 [Oceanospirillum beijerinckii]  clstr ali  80  4VTAVIKPFKLDDVREALSDIGIQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKLEVAVSDDQVDQVVEAVTGAANTGKIGDGKIFITALEEIVRIRTG 105
316 5.000e-64gi|696545919|ref|WP_033078764.1| nitrogen regulatory protein P-II 1 [Thalassotalea sp. ND16A]  clstr ali  73  4ITAIIKPFKLDDVREALSEIGIEGLTLSEVKGFGRQKGHTELYRGAEYQVDFLPKIKLEIGIHDELVERVIETIINSANTGKIGDGKIFVTNIEEIIRIRTG 105
317 5.000e-64gi|503245580|ref|WP_013480241.1| nitrogen regulatory protein P-II 1 [Asticcacaulis excentricus]  clstr ali  65  4IEAVIKPFKLDEVKEALQEIGVQGMTVLEAKGYGRQKGHSELYRGAEYVVDFLPKIKIELVVADDLAPAALEAIQTAARTGKIGDGKIFVSDVIDVVRIRTG 105
318 5.000e-64gi|563751150|ref|WP_023785844.1| nitrogen regulatory protein P-II 1 [Hyphomicrobium nitrativorans]  clstr ali  67  4ITAVIKPFKLEEVRSSLTDIGLQGMTVTEVKGYGRQKGHTEVYRGAEYAVSFLPKIKIEVVVADALVDKAVEAIVKAAKTGQIGDGKIFVSSIEHTLRIRTG 105
320 5.000e-64gi|502927395|ref|WP_013162371.1| nitrogen regulatory protein P-II [Desulfurivibrio alkaliphilus]  clstr ali  64  4VEAIIKPFKLDEVKEAVTALGVHGMTVTEVKGFGRQKGHTEVYRGAEYVVDFVPKVKLEIVVASEMVEQVVETIIQAARNGKIGDGKIFVLPVESVCRIRTG 105
321 6.000e-64gi|495528770|ref|WP_008253411.1| nitrogen regulatory protein P-II 1 [Zhongshania aliphaticivorans]  clstr ali  79  4VSAVIKPFKLDDVRAALSEIGVQGVTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKLEIAVTDDQVEKVIDTVTKAACTGKIGDGKIFVTSLEQVIRIRTG 105
322 6.000e-64gi|365180819|emb|CCE97674.1| Nitrogen regulatory protein P-II [Sinorhizobium fredii HH103]  clstr ali  64  29VMAIIKPFKLDEVREALTTVGIQGLTVTEVKGYGRQKGHTEIYRGTEYAVSFLPKLKIEIAVPSEIVDKAVDAIASAAKTGQIGDGKIFVYSIDHAVRIRTG 130
323 6.000e-64gi|491010414|ref|WP_004872123.1| nitrogen regulatory protein P-II 1 [Acidithiobacillus caldus]  clstr ali  71  4ITAIVKPFKLDDVREALSQAGIQGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIETVVPDNLVDIATDALIKGARTGKIGDGKIFVTEVLDAVRIRTG 105
324 6.000e-64gi|504563669|ref|WP_014750771.1| nitrogen regulatory protein P-II 1 [Advenella kashmirensis]  clstr ali  71  4ITAIIKPFKLDEVRAGLADIGIQGLTITEVKGFGRQKGHTELYRGAEYVVDFLPKIKLETAVADEQVEQAIETICQSGTTGKIGDGKIFVTDLEQVIRIRTG 105
325 6.000e-64gi|906868478|ref|WP_049726908.1| transcriptional regulator [Wenzhouxiangella marina]  clstr ali  72  4VTAIIKPFKLDDVRQAIAEAGIQGMTLSEVKGFGRQKGHTELYRGAEYKVDFLPKLKVEIAVADEDVDTAIEAIQEAAGTGKIGDGKIFVTALERVIRIRTG 105
326 6.000e-64gi|496434856|ref|WP_009143703.1| nitrogen regulatory protein P-II [Succinatimonas hippei]  clstr ali  70  4IVAIIKPFKLDDVREALSANGISGMTVSEVKGFGRQKGHTELYRGAEYVVDFLPKAKLELVVKDEDVDVCIEAIIKGAHTGKIGDGKIFVSDIERVVRIRTG 105
327 6.000e-64gi|495558737|ref|WP_008283316.1| nitrogen regulatory protein P-II [gamma proteobacterium HTCC5015]  clstr ali  67  4IEAVIKPFKLDDVRDALADIGVSGMTVTEVKGFGRQKGHTETYRGAEYVVDFLPKLKLEIVVAEKDADACVESITNAAKTGQIGDGKIFVSDVERTIRIRTG 105
329 6.000e-64gi|506307866|ref|WP_015827641.1| nitrogen regulatory protein P-II 1 [Hirschia baltica]  clstr ali  68  4IEAIIKPFKLDEVKEALHEVGLQGMTVIEAKGFGRQRGHTELYRGAEYVVDFLPKLKVEVVVADSQLDAALEAVSSAAQTGKIGDGKIFVSDVSEVVRIRTG 105
330 6.000e-64gi|937342841|dbj|BAS67417.1| nitrogen regulatory protein P-II 2 [endosymbiont of Bathymodiolus septemdierum str. Myojin knoll]  clstr ali  78  30ITAIIKPFKLDEVREALSEIGVSGITATEVKGFGRQKGHTELYRGAEYTVDFLPKVKLEIAISADQVDSVIEVISKSAKSGKIGDGKIFVGNLEQVVRIRTG 134
331 6.000e-64gi|749956390|ref|WP_040334875.1| nitrogen regulatory protein P-II 1 [Candidatus Magnetobacterium casensis]  clstr ali  69  4IEAIIKPFKLDEVKDALNAIGIQGMTVVEVKGFGRQKGHTELYRGAEYVIDFIPKLKIEVVVSDNILETVIDTIQKTAKTGKIGDGKIFVYNAEEAVRIRTG 105
334 7.000e-64gi|820779890|ref|WP_046741803.1| nitrogen regulatory protein P-II 1 [Lampropedia cohaerens]  clstr ali  76  4VTAIIKPFKLDEVREALSALNVRGLTVTEVKGFGRQKGHTELYRGAEYTVDFLPKVKVELAVAEDVLDAVIEAITSAARTGKIGDGKIFVQSLEESVRIRTG 105
335 7.000e-64gi|494951255|ref|WP_007677283.1| nitrogen regulatory protein P-II 1 [alpha proteobacterium BAL199]  clstr ali  69  4VMAIIKPFKLDEVRESLTALGIQGLTVSEVKGFGRQKGQTEIYRGAEYSVNFLPKVKVEVVVSDDLVTSVVEAIQKSANTGRIGDGKIFVLDVSQAVRIRTG 105
336 7.000e-64gi|495877306|ref|WP_008601885.1| nitrogen regulatory protein P-II [alpha proteobacterium JLT2015]  clstr ali  70  4IEAIIKPFKLDEVKEALHDVGVQGLTVTEAKGFGRQKGHTELYRGAEYIVDFLPKVKLEVVVDDALSDRVVEAIAGAAKTGRIGDGKIFVSDVLQAYRIRTG 105
337 7.000e-64gi|406912054|gb|EKD51729.1| nitrogen regulatory protein PII [uncultured bacterium]  clstr ali  68  12IEAIIKPFKLDDVKEAISELGVKGMTVSEVKGFGRQRGHTELYRGAEYIVDFLPKIKIELVIKDEDTAKVVEAIQNAAKTGRIGDGKIFILPVEEVIRIRT. 112
340 8.000e-64gi|120593584|gb|ABM37023.1| nitrogen regulatory protein P-II [Polaromonas naphthalenivorans CJ2]  clstr ali  67  25ITVILKPFKLEEVREALAECGVTGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKVEVVVNTADVERCVDAIVRAARTGKIGDGKIFVTSVERVLRIRTG 126
342 9.000e-64gi|644490413|ref|WP_025324228.1| nitrogen regulatory protein P-II 1 [Deferrisoma camini]  clstr ali  73  4IEAIIKPFKLDEVKESLSEIGVQGITVTEVKGFGRQKGHTEVYRGAEYIVDFLPKVKIEVVVPDELAWPVVEAIERSARSGKIGDGKIFVLPVAEAVRIRTG 105
343 9.000e-64gi|550893941|ref|WP_022654670.1| nitrogen regulatory protein P-II 1 [Aquaspirillum serpens]  clstr ali  76  4ISAIIKPFKLDEVREALAAVGVQGVTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIEIAIRDELLDQALEAIEQGAHTGKIGDGKIFVFELEQVVRIRTG 105
344 9.000e-64gi|503402987|ref|WP_013637648.1| nitrogen regulatory protein P-II 1 [Desulfurobacterium thermolithotrophum]  clstr ali  62  4IEAIIKPFKLDEVKDALTEIGITGMTISEVKGFGRQKGHTELYRGAEYVIDFIPKIKLEVIVPDESVEKVVEVIVNSAKTGRIGDGKIFILSVEDAVRIRTG 105
345 9.000e-64gi|497104473|ref|WP_009471663.1| nitrogen regulatory protein P-II 1 [gamma proteobacterium HIMB55]  clstr ali  78  4VTAVIKPFKLDDVREALSTIGVQGITVSEVKGFGRQKGHTELYRGAEYVVDFLPKTKVEVAVSEEMLEQTIEAISGAAQTGNIGDGKIFVTSLEQSIRIRTG 105
346 1.000e-63gi|652757135|ref|WP_027074784.1| nitrogen regulatory protein P-II 1 [Mannheimia granulomatis]  clstr ali  69  4VIAIIKPFKLADVREALSDLGISGMTVTEVNGFGRQQGHTESYRGTEYEVDFLPKIKIDLVISDEMLDSVVQTIIQAAHTGKVGDGKIFVSPVEQVIRIRTG 105
347 1.000e-63gi|504226736|ref|WP_014413838.1| nitrogen regulatory protein P-II 1 [Pararhodospirillum photometricum]  clstr ali  70  4VMAIIKPFKLDEVREALGTLGIQGMTVTEVKGFGRQKGQTEVYRGAEYVVNFLPKVKIELAVPDALVAQVVEAIQAAAQTGKIGDGKIFVFALNESVRIRTG 105
348 1.000e-63gi|1002734755|gb|AMN38672.1| nitrogen regulatory protein P-II [Rhodoplanes sp. Z2-YC6860]  clstr ali  68  4VMAIIKPFKLEDVRDALSAIGVHGMTVGEVKGYGRQKGHTEIYRGAEYAVNFLPKLKVEVAVEDQMADKAVAAIGNAAKTGQIGDGKIFVYDLGHAVRIRTG 105
350 1.000e-63gi|291091286|gb|EFE23847.1| nitrogen regulatory protein P-II [Edwardsiella tarda ATCC 23685]  clstr ali  69  20VSAVIKPFKLDEVRDALSAMGICGLTVTEVKGFGRQKGHAELYRGAEYAVNFLPKVKIEIALADDRLEAVIEAICQAAGSGKIGDGKIFVADLTRVVRIRTG 121
351 1.000e-63gi|736407149|ref|WP_034429937.1| nitrogen regulatory protein P-II 1 [Candidatus Contendobacter odensis]  clstr ali  77  4ITAVIKPFKLDDVREALSEVGAQGVTVTEVKGFGRQKGHTELYRGAEYVVDFLPKIKIEVGVPDELAERIIEAITRSANTGKVGDGKIFVYDLEGAIRIRTG 105
352 1.000e-63gi|492533876|ref|WP_005875879.1| nitrogen regulatory protein P-II 1 [Oxalobacter formigenes]  clstr ali  75  4ISAIVKPFKLDEVREALASIGIQGMTVTDVRGFGRQKGHTELYRGAEYVVDFLPKTKIEVAIADELLEQAIEAIGKSASTGKIGDGKIFIVDLEQVIRIRTG 105
353 1.000e-63gi|524149647|emb|CCZ21570.1| nitrogen regulatory protein P-II [Acetobacter sp. CAG:977]  clstr ali  73  4IEAIIKPFKLDDVRDALQDMDVQGITATEVKGFGRQKGHTELYRGAEYVVDFVPKVKLEIVIEDARVESVIEAIVQAAQTGKIGDGKIFVLPVEDAVRIRT. 104
354 1.000e-63gi|740191311|ref|WP_038033323.1| nitrogen regulatory protein P-II 1 [Thermopetrobacter sp. TC1]  clstr ali  68  4IEAIIKPFKLDEVKEALQDVGVQGITVIEAKGFGRQKGHTELYRGAEYVIDFLPKVKIEIVLPDDMVDKAVEAIQEAARTGRIGDGKIFISDIAEAIRIRTG 105
355 1.000e-63gi|501563472|ref|WP_012567936.1| nitrogen regulatory protein P-II 1 [Rhodospirillum centenum]  clstr ali  73  4VMAVIKPFKLDEVREALTGLGIQGLTVSEVKGFGRQKGQTEIYRGAEYSVSFLPKVKIEVAVTDDLTDAVVEAIQKAANTGRIGDGKIFVLELAQAIRIRTG 105
356 1.000e-63gi|951143440|ref|WP_057624370.1| transcriptional regulator [Coxiellaceae bacterium CC99]  clstr ali  73  4ITAIIKPFKLDDVREALMELKVQGITVSEVKGFGRQKGHTELYRGAEYVIDFLPKAKLEIAVKDEEVELIIEAILKSAQTGRIGDGKIFVQPLEEVIRIRTG 105
357 1.000e-63gi|493969611|ref|WP_006912834.1| nitrogen regulatory protein P-II 1 [Salinisphaera shabanensis]  clstr ali  75  4VTAVIKPFRLDDVREALAEVGVHGTTMTEVKGFGRQKGHTELYRGAEYAVDFLPKVKLEVAVADDRVDAVVEAIIEAAKTGQIGDGKIFVHNLEQVVRIRTG 105
358 1.000e-63gi|968547107|ref|WP_058574912.1| transcriptional regulator [Halothiobacillus sp. XI15]  clstr ali  76  4ITAIIKPFKLDDVREALGGVGVKGITMTEVKGFGRQKGHTELYRGAEYVVDFLPKVKLEMVIDDGLADQVIEVITNAASTGKIGDGKIFVSSVDEAIRIRTG 105
360 1.000e-63gi|499701090|ref|WP_011381824.1| nitrogen regulatory protein P-II 1 [Nitrosospira multiformis]  clstr ali  71  4IEAIIKPFKLDEVCEALNEIGISGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKIKIEIVVLAKQVDSVIETIISSARTGKIGDGKIFVTDIEQVVRIRTG 105
361 1.000e-63gi|759371809|ref|WP_043099981.1| nitrogen regulatory protein P-II 1 [Oleiagrimonas soli]  clstr ali  75  4VTVIIKPFKLDDVREALAEVGVQGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKLKLEIALSDDILEQAVEAIVGAARTGKVGDGKVFVSDLEQVIRIRT. 104
362 1.000e-63gi|671605729|ref|WP_031578161.1| nitrogen regulatory protein P-II 1 [Ruminobacter sp. RM87]  clstr ali  70  4ISAIIKPFKLDDVREAVSELGIEGMTVTEVKGFGRQKGHTELYRGAEYQVDFLPKALLEVVVKDEICEEVVESIVKAAKTGKIGDGKIFVYNCEHVVRIRTG 105
363 1.000e-63gi|340553203|gb|AEK62578.1| Nitrogen regulatory protein P-II [Collimonas fungivorans Ter331]  clstr ali  74  10ITAVIKPFKLDEVREALAEVGVTGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKVELVIDDALTERAVDAIIKAARTGKIGDGKIFVRNIEQVIRIRTG 111
364 1.000e-63gi|766750166|ref|WP_044833869.1| nitrogen regulatory protein P-II 1 [Thalassomonas actiniarum]  clstr ali  73  4VNAIIKPFKLDDVREAISEIGVEGLTVSEVKGFGRQKGHTELYRGAEYQVDFLPKVKLEIAVNSEVVERLVEAISKSAYTGKIGDGKIFVYDLQQAVRIRTG 105
366 1.000e-63gi|501880623|ref|WP_012663045.1| nitrogen regulatory protein P-II [Desulfobacterium autotrophicum]  clstr ali  68  4IEAIIKPFKLDDVKESLNEIGIHGMTITEVKGYGRQKGHKEIYRGAEYVVDFVPKIKLEIIVDKERADEVVETICKAANTGKIGDGKIFVMPVEQVIRVRTG 105
367 1.000e-63gi|504059522|ref|WP_014293516.1| nitrogen regulatory protein P-II 1 [Oceanimonas sp. GK1]  clstr ali  70  4ICAIIKPFKLDDVRSALAGMGIDGMTVTEVKGFGRQKGHTELYRGAEYQVDFLPKIKLEIAAQSEDVERVIETITEAAGTGKIGDGKIFVYDLQQAVRIRTG 105
368 1.000e-63gi|503057082|ref|WP_013292058.1| nitrogen regulatory protein P-II 1 [Gallionella capsiferriformans]  clstr ali  82  4VTAIIKPFKLDEVREALSAIGVQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKLEAAIAADQLDSVLEVIEKAAQTGKIGDGKIFVQEIEQVIRIRTG 105
369 1.000e-63gi|654997393|ref|WP_028446606.1| nitrogen regulatory protein P-II 1 [Chitinimonas koreensis]  clstr ali  73  4IEAVIKPFKLDEVREALAEVGVTGLTVAEVKGFGRQKGHTELYRGAEYVVDFLPKVKIEVVITADRVDAAIDAIVKAARTGKIGDGKIFVSPVEQVVRIRTG 105
371 1.000e-63gi|655156298|ref|WP_028602970.1| nitrogen regulatory protein P-II 1 [Ottowia thiooxydans]  clstr ali  75  4ITAIIKPFKLDEVREALSSLGVQGITVTEVKGFGRQKGHTELYRGAEYVIDFLPKVKIEAAVDASIVERAIEAIESSARTGKIGDGKIFVTDIEQVVRIRTG 105
372 1.000e-63gi|503674706|ref|WP_013908782.1| nitrogen regulatory protein P-II 1 [Thermodesulfatator indicus]  clstr ali  67  4IEAIIKPFKLEEVKEALAEIGVKGMTVSEVKGFGRQKGHREIYRGAEYIVDFLPKVKIELVLEDELVEKVVETIINSARTGKIGDGKIFIIPVEDAIRIRTG 105
373 2.000e-63JGI.Meta 7053299680 C2325699__gene_202968 nitrogen regulatory protein P-II [Human Stool microbiome from visit number 1 of subject 861967750]  ali  70  4IIAVVKPFKLDEVREALSDLGVSGMTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKVEVAVDDAVAESAVEAIVKSAYTGKIGDGKVFVMDLASAVRIRTG 105
374 2.000e-63gi|495323424|ref|WP_008048170.1| nitrogen regulatory protein P-II 1 [Reinekea blandensis]  clstr ali  82  4VTAIIKPFKLDDVREALSEVGVQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKIKLEIAIDDDKVDGVIDAVTGAAATGKIGDGKIFVSSLEQVIRIRTG 105
375 2.000e-63gi|822632449|ref|WP_047006318.1| nitrogen regulatory protein P-II 1 [Erythrobacter gangjinensis]  clstr ali  69  4IEAIIKPFKLDEVKDALHEVGVSGITVTEAKGFGRQKGHTELYRGAEYVVDFLPKVKLEIIVPDTLAGQVTEAIANAARTGRIGDGKIFVSDIASAIRIRTG 105
376 2.000e-63gi|505935126|ref|WP_015723100.1| nitrogen regulatory protein P-II [Desulfobulbus propionicus]  clstr ali  66  4IEAIIKPFKLDEVKDALNGIGIKGMTVTEVKGYGRQKGHTEIYRGAEYVVDFIPKIKIELIVQDELVDQVIETITKNARTGKIGDGKIFVLPVERIVRVRTG 105
379 2.000e-63gi|495383072|ref|WP_008107780.1| nitrogen regulatory protein P-II 1 [Methylophilales bacterium HTCC2181]  clstr ali  70  4IEAIIKPFKLDEVREALSEIDIMGLTATEVKGFGRQKGHTELYRGAEYVVDFLPKIRLDLVVADKMVEKVVETILKTAHTGKIGDGKIFVMDVEEAIRIRTG 105
380 2.000e-63gi|503287942|ref|WP_013522603.1| nitrogen regulatory protein P-II 1 [Taylorella equigenitalis]  clstr ali  73  4VTAIIKPFKLDEVREALGEVGITGLTVTETKGFGRQKGHTELYRGAEYAVDFLPKVKIELLVKDTEVDSALEAIVEAARTGKIGDGKIFVTNVEQVVRIRTG 105
381 2.000e-63gi|494061648|ref|WP_007003728.1| nitrogen regulatory protein P-II 1 [Roseomonas cervicalis]  clstr ali  69  4VMAVIKPFKLDEVREALTPLGVQGLTVTEVKGFGRQKGQTEIYRGAEYHVSFLPKLKIEVAVPSDLVDAVVEAIASTARTGKIGDGKIFVLDVERALRIRTG 105
383 2.000e-63gi|553749957|ref|WP_023082882.1| nitrogen regulatory protein P-II [Pseudomonas aeruginosa]  clstr ali  68  4IMAIIKPFKLDDVREALSAVGLHGLTVTEVKGFGRQKGHSEIYRGAEYVVDLIPKVKVEAVVTDDLCDAAVDAIIKAAATGKIGDGKIFVCDVEKAVRIRTG 105
384 2.000e-63gi|492845833|ref|WP_005999787.1| nitrogen regulatory protein P-II [Desulfuromonas acetoxidans]  clstr ali  60  4IECIIKPFKLDDVKNAITELGIAGMTVSEVRGFGRQKGHSELYRGAEYQIDFIPKVKIELVVSDDQVADLVASIQKAACTGRIGDGKIFVMPVEESVRIRTG 105
385 2.000e-63gi|953949729|dbj|BAT58202.1| nitrogen regulatory protein P-II 2 [Variibacter gotjawalensis]  clstr ali  69  4VVAIIKPFKLDEVRDALTSLGVHGLTVSEVKGYGRQRGHTEIYRGAEYAVSFLPKIKIEVAVASEQVDRVIEAITGAAKTGQIGDGKIFTLPLEHAVRIRTG 105
386 2.000e-63gi|501016148|ref|WP_012068833.1| nitrogen regulatory protein P-II 1 [Marinomonas sp. MWYL1]  clstr ali  76  4ITAIVKPFKLDEVREALSEIGINGITVTEVKGFGRQRGHTELYRGAEYVVDFLPKVKLELAVETDMVERAIEAIQHSANTGKIGDGKIFVTALEQIIRIRTG 105
387 2.000e-63gi|511821187|ref|WP_016401299.1| nitrogen regulatory protein P-II [Agarivorans albus]  clstr ali  69  4VTAIIKPFKMDDVREALADIGITGMTVTEVKGFGRQKGHTELYRGAEYKVDFLPKMKLELVVQKDDLERCIEAIVQTAQTGKIGDGKIFVRDVDRVIRIRTG 105
388 2.000e-63gi|759998607|ref|WP_043682155.1| nitrogen regulatory protein P-II 1 [Castellaniella defragrans]  clstr ali  65  4VTALIKPFKLEEVHAALEAAGIQGMTVTEAKGFGRQKGHTELYRGAEYQVDFLPKLQIQVAVPDALVEMTVECLCQAARTGKIGDGKLFVTPLEQVVRIRTG 105
389 2.000e-63gi|951162324|ref|WP_057642003.1| transcriptional regulator [Stenotrophomonas daejeonensis]  clstr ali  73  4ISAIIRPFKLDEVREALGEQGVSGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKIRIETAVTDEQVEAVIETLQAAAGTGKIGDGKIFVTPLEQVVRIRTG 105
390 2.000e-63gi|501816159|ref|WP_012646905.1| nitrogen regulatory protein P-II 1 [Geobacter daltonii]  clstr ali  69  4IEAIIKPFKLDEVKNALSEVGIEGITVTEVKGFGRQKGHTELYRGAEYVVDFIPKVKLEIVVADELVAKVIETIAESAKTGRIGDGKIFVLPLEEALRIRTG 105
391 2.000e-63gi|653035538|ref|WP_027287226.1| nitrogen regulatory protein P-II 1 [Rhodovibrio salinarum]  clstr ali  64  4VMAIIKPFKLDEVREALTGLGIEGLTVSEVKGYGRQKGQTEIYRGAEYAVNFLPKVKIELVLPDDRVESAVEAVSKAANTGRIGDGKIFVFDVSHAVRIRTG 105
393 2.000e-63gi|647350681|ref|WP_025770299.1| nitrogen regulatory protein P-II 1 [Thioalkalivibrio sp. HK1]  clstr ali  75  4VIAILKPFNLDDVRASLADIGIQGMTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIEIAVESERLDEVVEAITTVARTGKIGDGKIFVTPLDNVIRVRTG 105
395 2.000e-63gi|505277144|ref|WP_015464246.1| nitrogen regulatory protein P-II [Psychromonas sp. CNPT3]  clstr ali  66  4IEAIIKPFKMDDVREALADIDITGMTVSEVKGFGRQKGHTELYRGAEYMVDFLPKVKIELVVKKEDVERCIEVIMQTAQTGKIGDGKIFVMPVERVIRIRTG 105
396 3.000e-63gi|602597299|dbj|GAJ28452.1| nitrogen regulatory protein PII [Acidomonas methanolica NBRC 104435]  clstr ali  72  18VTAIIKPFKLDDVREALTPLGIQGLSVTEIRGFGRQKGQTEIYRGAEYHVSFLPKVKIEIAVADALVDDVIEAILDAAHTGKIGDGKIFVSPVERAIRIRT. 118
397 3.000e-63gi|501030717|ref|WP_012082800.1| nitrogen regulatory protein P-II [Nitratiruptor sp. SB155-2]  clstr ali  69  4VEAIIKPFKLDDVKEGLSEIGITGMTVTEVKGYGRQQGHSELYRGAEYVVDFLPKVKIEVIVPSDMVESVVETIMQNARTGKIGDGKIFVSDIEKVVRIRTG 105
398 3.000e-63gi|952348261|gb|KRT70221.1| glutamine synthetase regulatory protein P-II [candidate division NC10 bacterium CSP1-5]  clstr ali  65  4IEAIIKPFKLDEVKNALAEIGIQGLTISEVKGFGRQKGHTELYRGAEYTIDFLPKVKVEVVVADGKCEQVVETIQAAAKTGRIGDGKIFIIPCEEAVRIRTG 105
399 3.000e-63gi|914796362|ref|WP_050727009.1| transcriptional regulator [Vulgatibacter incomptus]  clstr ali  69  4IEAIVKPFKLDEVKEALAEVGVQGITVLEAKGFGRQKGHTELYRGAEYVVDFLPKMKVEVVVADEQVHAVVEAIQAAARTGRIGDGKIFVLPVDEVIRIRTG 105
400 3.000e-63gi|860360737|ref|WP_048398123.1| nitrogen regulatory protein P-II 1 [Candidatus Achromatium palustre]  clstr ali  76  4ITAIIKPFKLDNVREALSEIGVQGITVTEIKGFGRQKGHTELYRGAEYVVDFLPKIKIEAAVTADMADKVVDTIRIAANSGKIGDGKIFVCPLEEVIRIRTG 105
401 3.000e-63gi|494428477|ref|WP_007224115.1| nitrogen regulatory protein P-II 1 [marine gamma proteobacterium HTCC2143]  clstr ali  77  4ITAVIKPFKLDDVRQALSEVGVTGITATEVKGFGRQKGHTELYRGAEYVVDFLPKVKLEIAINDDQVETVIEAISGAANSGKIGDGKIFVAPLEHIVRIRTG 105
403 3.000e-63gi|737509737|ref|WP_035489187.1| nitrogen regulatory protein P-II 1 [Gammaproteobacteria bacterium MOLA455]  clstr ali  76  4ITAIIKPFKLDDVREALADVGVQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKIKLEIAIGQEMVDSVVEAIAKAAATGKIGDGKIFISTLDEVIRIRTG 105
404 3.000e-63gi|1015667745|gb|AMW35984.1| transcriptional regulator (plasmid) [Haematospirillum jordaniae]  clstr ali  70  4IEAIIKPFKLDEVREALGDIGLQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIEMVLEESCVEQAIAVIQQAARTGRIGDGKIFILPVDDAIRVRTG 105
405 3.000e-63gi|499691541|ref|WP_011372275.1| nitrogen regulatory protein P-II [Sulfurimonas denitrificans]  clstr ali  65  4VEAVIKPFKLEDVKDALAEIGITGMTVSEVKGYGRQKGHSELYRGAEYVVDFLPKIKIEIVVDDENVEQVTTTIVEAARTGKIGDGKIFVSDIEKIIRIRTG 105
406 3.000e-63gi|740247912|ref|WP_038088855.1| nitrogen regulatory protein P-II 1 [Acidihalobacter prosperus]  clstr ali  74  4IEAIIKPFKLDEVRAALMEIGIAGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKLEVVVGDDQLDASIDAIVSAAHTGKIGDGKLFVTPVERIIRIRTG 105
408 3.000e-63gi|950297386|emb|CUH85186.1| Nitrogen regulatory protein P-II [Thalassobius mediterraneus]  clstr ali  59  57IIATIKPFKLEEVREALTEIGVRGMMVTEIKGFGSQSGHTEIYRGAEYAVNFVPKIKLEIVVSAAMVDQTVETITNTARTGKIGDGKIFVLDVAQAVRVRTG 158
409 3.000e-63gi|1002741738|gb|AMN45652.1| nitrogen regulatory protein P-II 1 [Steroidobacter denitrificans]  clstr ali  72  4ISAIIKPFKLDDVRAALSEIGVSGMTVTEVKGFGRQRGHTELYRGAEYVVDFVPKTRIEVAVSDGLVDQVVEAIIGAAKTGKVGDGKIFITELERVLRIRTG 105
410 3.000e-63gi|518802124|ref|WP_019958078.1| nitrogen regulatory protein P-II 1 [Vitreoscilla stercoraria]  clstr ali  68  4ISAVIKPFKLDEVREALTELGVSGMTVTEVKGFGRQKGHTEIYRGAEYAVDFLPKIKIETAVSAEMVEQVCEAIVQAAYTGKTGDGKVFVFDLDQVIRIRT. 104
411 3.000e-63gi|516031015|ref|WP_017461598.1| nitrogen regulatory protein P-II 1 [Dyella ginsengisoli]  clstr ali  67  4VSCIIRPYKLDEVRDALATAGVSGITVTEVRGFGRQKGHTEMYRGAEYVVDFLPKLKVDVVVTDEQLDGALEAIQQSARTGNVGDGKIFVSPVEQVVRIRTG 105
413 3.000e-63gi|496311102|ref|WP_009020280.1| nitrogen regulatory protein P-II 1 [Luminiphilus syltensis]  clstr ali  82  4VTAVIKPFKLDDVRESLSQIGVQGITVSEVKGFGRQKGHTELYRGAEYVVDFLPKIKIEVAVKGDMVEQTIEAITKAAQTGKIGDGKIFISELEQAIRIRTG 105
414 3.000e-63gi|931477440|gb|KPK58644.1| transcriptional regulator [Gammaproteobacteria bacterium SG8_31]  clstr ali  77  4VTAIIKPFKLDDVRQTLSDLGVKGITVTEVKGFGRQRGHTELYRGAEYVVDFLPKVKIELAVDDEVVEQAIEAITNSARTGKIGDGKIFVTDLTQVIRIRTG 105
415 3.000e-63gi|518386651|ref|WP_019556858.1| nitrogen regulatory protein P-II 1 [Thiomicrospira arctica]  clstr ali  72  4VVAIIKPFKLDDVREALHDVDVHGMTVTESKGFGRQKGHTEIYRGAEYAIEFLPKLRLEVAVSDEQLDSVIETIGAAARTGKIGDGKIFVMPLEQAVRIRT. 104
417 3.000e-63gi|522187568|ref|WP_020696116.1| nitrogen regulatory protein P-II 1 [Reyranella massiliensis]  clstr ali  67  4IEAIIKPFKLDEVKDALNQIGLKGITVLEAKGFGRQKGHTELYRGAEYVVDFLPKVKIELIVEDEMVEKAVEAIRSSAHTGRIGDGKIFVSSIDDAIRIRTG 105
418 3.000e-63gi|289173962|emb|CBJ80749.1| regulatory protein (P-II 2) for nitrogen assimilation, regulates GlnL (NRII), GlnE (ATase), and AmtB (ammonium transport  clstr ali  68  16ITTIIKPFKLEEVREALSDIGIQGMTVTEVKGFGRQKGHSELYRGAEYNVNFLPKVKIDIATHDERVEEVIHVIQQSAFTGKMGDGKIFIFELQHAVRIRTG 117
419 3.000e-63gi|1012438727|dbj|GAT33508.1| nitrogen regulatory protein P-II 1 [Terrimicrobium sacchariphilum]  clstr ali  63  4IEAIIKPFKMEDVKEALAEVGIEGMTVSEVKGFGRQKGHTEIYRGSEYTVDFLPKVKFEIVVADSLVEKAVQAISASAKTGKIGDGKIFVLPIETAVRIRT. 104
420 3.000e-63gi|503066226|ref|WP_013301202.1| nitrogen regulatory protein P-II 1 [Parvularcula bermudensis]  clstr ali  69  4VEALIKPFKLDDVKEALQALGLKGMTVSEARGFGRQKGHTELYRGAEYVVDFLPKLKIEIVIEDSLVDDVLRAITEAAQSGRIGDGKIFVTTVERAVRIRTG 105
421 3.000e-63gi|998762818|gb|KXI27178.1| transcriptional regulator [Paraglaciecola sp. S66]  clstr ali  75  4VEAIIKPFKLDDVREALAQAGVSGITVTEVKGFGRQKGHSEMYRGAEYNVDFLPKIKMEIVIEDALLDRVIEAIMQTAQTGKIGDGKIFVVDVERVIRIRTG 105
423 4.000e-63gi|503507393|ref|WP_013742054.1| nitrogen regulatory protein P-II 1 [Pusillimonas sp. T7-7]  clstr ali  76  4VSAIIKPFKLDEVREALADIGVSGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKLRIDVVLPATMVDTAIDAIIKAAFTGKIGDGKIFVSAVEQAIRIRTG 105
424 4.000e-63gi|159882698|gb|EDP76203.1| nitrogen regulatory PII protein [Hydrogenivirga sp. 128-5-R1-1]  clstr ali  63  15IEAIIKPFKLDEVKDALVEIGIGGMTVTEVKGFGQQKGHTEIYRGTEYVIDFLPKVKIEVVVKDEDVEKVLDTIVKTAQTGRVGDGKIFVLPVEEVVRIRTG 116
425 4.000e-63gi|503601854|ref|WP_013835930.1| nitrogen regulatory protein P-II 1 [Thioalkalimicrobium cyclicum]  clstr ali  70  4IVAIIKPFKLDDVREALHEIDVHGMTVTEAKGFGRQKGHTEIYRGAEYAIEFLPKVRLEIGVADDKVDTAIEAIGNAARTGKIGDGKIFVMPIEQAIRIRT. 104
426 4.000e-63gi|948255362|ref|WP_056912928.1| transcriptional regulator [Pseudolabrys sp. Root1462]  clstr ali  67  4VTAIIKPFKLDAVREALNAIGIHGMTVTEVKGYGRQKGHKEIYRGAEYAVSFLPKVRIEIGVASEQIEQVIDALTGAARTGEIGDGKIFVMPIDQAVRIRTG 105
427 4.000e-63gi|778250263|gb|KJR40863.1| Nitrogen regulatory protein PII [Candidatus Magnetoovum chiemensis]  clstr ali  68  4IEAIIKPFKLDEVKDALSSIGIKGMTVVEVKGFGRQKGHTELYRGSEYVIDFIPKIKIELVVPDNTLDKVLETIERIAKTGKIGDGKIFVYNCENAIRIRTG 105
428 4.000e-63gi|738181462|ref|WP_036137985.1| nitrogen regulatory protein P-II 1 [Lysobacter daejeonensis]  clstr ali  71  4ITAIIRPFKLDEVREALAEVGVSGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKLKLECAVADAMLDAALEAVQNAAKSGKVGDGKIFVTSIERTIRIRTG 105
429 4.000e-63gi|516013571|ref|WP_017444154.1| nitrogen regulatory protein P-II 1 [Gayadomonas joobiniege]  clstr ali  75  4VSAIIKPFKLDDVREAISEIGIEGLTVTEIKGFGRQKGHTELYRGAEYQVDFLPKVKLEIATQDENVERLIEAISGAAKTGKIGDGKIFVFDLEQCIRIRTG 105
430 4.000e-63gi|501352581|ref|WP_012384216.1| nitrogen regulatory protein P-II 1 [Beijerinckia indica]  clstr ali  65  4IEAVIKPFKLDEVKDALHAAGVSGLTVTEAKGFGRQKGHTELYRGAEYIVDFLPKVKVEVIVPDSFVEGVVDAIRKAARTGRIGDGKIFISSIEDVVRIRTG 105
431 4.000e-63gi|754702632|ref|WP_042078666.1| nitrogen regulatory protein P-II 1 [Aeromonas sanarellii]  clstr ali  70  4ITAIIKPFKLDDVREAIAQLGVEGLTVTEVKGFGRQKGHTELYRGAEYQVDFLPKVKLEIATRADGVEPIIDAICQAARTGKIGDGKIFVYDLLAAVRIRTG 105
433 4.000e-63gi|739632526|ref|WP_037488498.1| nitrogen regulatory protein P-II 1 [Snodgrassella alvi]  clstr ali  68  4ITAMIKPFRLDAVREALADVGVQGMTVSEVKGFGRQKGHTEIYRGAEYEVDFLPKIKIEVVLPEELVERAIEAIKNAAKTGKVGDGKIFVMNVEEVIRIRTG 105
434 4.000e-63gi|908360779|gb|AKT43354.1| uncharacterized protein CMC5_075860 [Chondromyces crocatus]  clstr ali  63  57VEAIIKPFKLDEVKDALAEVGIQGMTVTEVKGFGRTGGKKEVYRGSAYVVDFVPKVKIEIVVPDDMVNDVIDAIEKSAKTGRIGDGKIFVMPVEEAVRIRTG 158
435 4.000e-63gi|258591813|emb|CBE68114.1| Glutamine synthetase regulatory protein P-II [Candidatus Methylomirabilis oxyfera]  clstr ali  64  4IEAIIKPFKLDEVKSALAEVGIQGLTVSEVKGFGRQKGHTELYRGSEYTIDFLPKVKIEVVVPDDKCDKVVETILSSAKTGRIGDGKIFIVSIDEVVRIRTG 105
436 5.000e-63gi|502986313|ref|WP_013221289.1| nitrogen regulatory protein P-II [Nitrosococcus watsonii]  clstr ali  74  4IEAIIKPFKLDDVREALSEIGVSGMTAIEVKGFGRQKGHTELYRGAEYVVDFLPKIMLEIVVGDEQVDACIEAITKAAQSGRIGDGKIFVTNVERATRIRTG 105
437 5.000e-63gi|671504309|ref|WP_031491752.1| hypothetical protein [Succinivibrio dextrinosolvens]  clstr ali  71  4IVAIIKPFKLDDVRESLSDIGISGITVSEAKGFGRQKGHTELYRGAEYVVDFLPKCKLEIVTTDEQLDDCVDAIIKSAYTGKIGDGKIFISDVSRVIRIRTG 105
438 5.000e-63gi|495564131|ref|WP_008288710.1| nitrogen regulatory protein P-II 1 [Hydrogenivirga sp. 128-5-R1-1]  clstr ali  66  4IEAIIKPFKLDEVKEAITELGNFGITITEVKGFGRQKGHTELYRGAEYVIDFLPKIKLEIVVEDEMVEKLVEAITNAAKTGKVGDGKIFILPVEDAVRIRTG 105
439 5.000e-63gi|750246661|ref|WP_040542510.1| nitrogen regulatory protein P-II 1 [marine gamma proteobacterium HTCC2148]  clstr ali  79  4VTAVIKPFKLDDVRASLSQIGVQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKLEIAVADGDVESAIEAIAATANSGKIGDGKIFVSDLEQVIRIRTG 105
440 5.000e-63gi|551346191|ref|WP_022965602.1| nitrogen regulatory protein P-II 1 [Pseudomonas caeni]  clstr ali  76  4ISAIIKHFKLDDVREAISEIGVKGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKLKLEVAVSDDNLHRVIDAIIKAAHTGSIGDGKIFVTDLEHVVRIRTG 105
441 5.000e-63gi|589615696|gb|EXI86965.1| Nitrogen regulatory protein P-II [Candidatus Accumulibacter sp. BA-94]  clstr ali  77  4IEAIIKPFKLDEVREALSEIGVTGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIEIVVTDSATDGAIDAIVKAARTGKIGDGKIFVSSVEQVVRIRTG 113
442 5.000e-63gi|1015517395|gb|AMV71712.1| nitrogen regulatory protein P-II [Desulfuromonas sp. DDH964]  clstr ali  59  4IECIIKPFKLDDVKSALTDLGITGMTVSEVRGFGRQKGHTELYRGAEYQIDFIPKVKIELVVSEERVNEVVTTVQKEACTGRIGDGKIFVLPVEQSVRIRTG 105
443 5.000e-63gi|497289406|ref|WP_009603623.1| nitrogen regulatory protein P-II 1 [SAR116 cluster alpha proteobacterium HIMB100]  clstr ali  71  4IEAIIKPFKLDEVKEALHEVGIQGITVLEAKGFGRQKGHTELYRGAEYVVDFLPKVKIEVVVEDDMAENVVEAIKAAAQTGRIGDGKIFISTIDEAIRIRTG 105
444 5.000e-63gi|780087521|ref|WP_045466765.1| nitrogen regulatory protein P-II 1 [Burkholderiales bacterium GJ-E10]  clstr ali  71  4ITAIIKPFKLDEVREALADVGVTGLTVTDVKGFGRQKGHTELYRGAEYVVDFLPKIKVDAVVSDAIVDRAVEAITRSARTGKIGDGKIFVQSVEQVVRIRTG 105
445 5.000e-63gi|652422008|ref|WP_026817448.1| nitrogen regulatory protein P-II 1 [Arenimonas composti]  clstr ali  77  4VMAIIKPFKLDDVREALSEVGVTGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKIKLEVAVTGDQVERVVEAIQTAANTGKIGDGKIFVYGLDKVLRIRTG 105
446 5.000e-63JGI.Meta 7058504904 C3984359__gene_355855 nitrogen regulatory protein P-II [Human Stool microbiome from visit number 1 of subject 765701615]  ali  78  4VIAVVKPFKLDEVREALAEIGVNGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIEAVVTDDILDRVLEAIQKSARTGKIGDGKIFVVDLEQVIRIRTG 105
447 6.000e-63gi|971140693|emb|CEF39886.1| nitrogen regulatory protein P-II [Acetobacter senegalensis]  clstr ali  70  14VTAIIKPFKLDDVREALAPLGIQGLTVSEVKGFGRQKGQTEIYRGAEYRISFLPKIKVEIAVSDTLVDQVIEAVLDAAHTGKIGDGKIFVSELERVIRIRT. 114
448 6.000e-63gi|501514190|ref|WP_012522127.1| nitrogen regulatory protein P-II 1 [Phenylobacterium zucineum]  clstr ali  67  4IEAIIKPFKLDEVKEALQELGVQGMTVIEAKGYGRQKGQTELYRGAEYVVDFLPKIKIEVVVADDQLSRALEAISAAARTGRIGDGKIFVSEVLDVMRIRTG 105
449 6.000e-63gi|494079766|ref|WP_007021811.1| nitrogen regulatory protein P-II 1 [Neptuniibacter caesariensis]  clstr ali  78  4VSAVIKPFKLDDVREALSEIGVQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVRVDAAVASDIVDQVVEAISSAAQTGKIGDGKIFVSEIEQVVRIRTG 105
452 6.000e-63gi|495374894|ref|WP_008099606.1| nitrogen regulatory protein P-II 1 [Verrucomicrobiae bacterium DG1235]  clstr ali  70  4VVAIIKPFKLEEVKEALSEIGIEGMTVTEVKGFGRQKGHTEIYRGSEYTVDFLPKVKIEIAVPDDVVSKAAEAIVKSAKTGKIGDGKVFVIPLEEAVRIRT. 104
453 6.000e-63gi|515486003|ref|WP_016919271.1| nitrogen regulatory protein P-II 1 [Methylocystis parvus]  clstr ali  64  4ITAIIKPFKLDEVRDALMTLEVHGMTATEVRGYGRQKGHTEIYRGAEYVVAFLPKVKIEIAVSDEFVERAVELIRRAAHTGHIGDGKIFVTPLDRAVRIRTG 105
454 6.000e-63gi|501124901|ref|WP_012173993.1| nitrogen regulatory protein P-II [Desulfococcus oleovorans]  clstr ali  67  4IEAIIKPFKLDDVKNVLNELGIQGMTVTEVKGYGRQKGHTEIYRGAEYIVDFVPKIKLEVVVAASMADKVVDAIAKAALTGKVGDGKIFVMPVEQAVRVRTG 105
455 6.000e-63gi|496310827|ref|WP_009020005.1| nitrogen regulatory protein P-II 1 [Luminiphilus syltensis]  clstr ali  77  4VTTIIKPFKLDDVRGALADIGVNGVTVSEVKGFGRQRGHTELYRGAEYVVDFLPKLKLEVACADDQLDQIVEAIVAAANTGKIGDGKIFVTDLEQIIRIRTG 105
457 6.000e-63gi|654617042|ref|WP_028081586.1| nitrogen regulatory protein P-II 1 [Solimonas soli]  clstr ali  71  5.IAVIKPFKLDAVREALADIGVQGMTVTEVRGFGRQKGHTELYRGAEYTVDLLPKVKIEVAVAPDMAERATEAILKAAKTGQIGDGKIFIYDLEQTVRIRTG 105
458 7.000e-63gi|498331888|ref|WP_010646044.1| nitrogen regulatory protein P-II 1 [endosymbiont of Bathymodiolus sp.]  clstr ali  73  4ISAILRPHQLDDVREALSEVGVSGITVTEVKGFGRQKGHTEMYRGAEYQVDFLPKVKLEIAVAASELDSVIETIAKTANTGKVGDGKIFVSNLEKVVRIRTG 105
459 7.000e-63gi|780108228|ref|WP_045475871.1| nitrogen regulatory protein P-II 1 [Thioploca ingrica]  clstr ali  83  4VIAIIKPFKLDDVREALSEIGVQGITVTEVRGFGRQKGHTELYRGAEYVVDFLPKIKIEAVIGDELLDQVIDSIKKSANTGKIGDGKIFVINIEQAIRIRTG 105
460 7.000e-63gi|491575014|ref|WP_005432593.1| nitrogen regulatory protein P-II 1 [Sutterella wadsworthensis]  clstr ali  73  4VTVIIKPFKLDDVREALSAAGVHGLTVTEVKGFGRQRGHTELYRGAEYVVDFLPKIRIDIAVTDDAVDTVIEAVLASARTGKVGDGKIFVSPLEHVVRIRTG 105
461 7.000e-63gi|655125392|ref|WP_028572507.1| nitrogen regulatory protein P-II 1 [Desulfonatronum lacustre]  clstr ali  74  4ITAVIKPFKLDDVRTALMEIGVQGLTVTEVKGFGRQKGHTEVYRGAEYVVDFRPKLKLEAAIADDQVDKVIQTIQKAAHTGKIGDGKVFVFDLEKCLRIRTG 105
463 7.000e-63gi|740193205|ref|WP_038035193.1| nitrogen regulatory protein P-II 1 [Thermopetrobacter sp. TC1]  clstr ali  64  4IIAIIKPHRLEHVREALANLGVEGMTVSEVKGHGRQKGHTEVYRGAEYVVNFLPKVKVEVAVTADMADKVVETIREAAQTGQIGDGKIFVLPVEQVVRIRTG 105
464 7.000e-63gi|517522937|ref|WP_018693145.1| nitrogen regulatory protein P-II [Algicola sagamiensis]  clstr ali  71  4IDAIIKPFKLDDVREALGEIGVTGMTVTEVKGFGRQKGHTELYRGAEYMVDFLPKVKLEIVLAEEQVDLCVETILKIAQTGRIGDGKIFVTDVERVIRIRT. 104
465 7.000e-63gi|653104016|ref|WP_027354057.1| nitrogen regulatory protein P-II 1 [Desulfosarcina sp. BuS5]  clstr ali  66  4VEAIIKPFKLDDVKEALNEIGIQGMTISEVKGYGRQKGHKEIYRGAEYVVDFIPKIKIEIIVDAPAADQVVETIQKAANTGKIGDGKIFILPVEDVLRVRTG 105
466 7.000e-63gi|652389316|ref|WP_026785168.1| nitrogen regulatory protein P-II 1 [Pleomorphomonas koreensis]  clstr ali  68  4VMAIIKPFKLDEVRDALNALGVHGLTVTEVKGYGRQKGHTEIYRGAEYAVSFLPKLKVEVAVATDQVDKVVEAIATAAKTGQIGDGKIFVTSIEHAVRIRTG 105
467 8.000e-63gi|951277354|emb|CUS89686.1| nitrogen regulatory protein P-II family [bacterium JGI-20]  clstr ali  64  4IEAIIRPFKLDDVKEALSEIGVRGMTITEVKGYGRQKGHTELYRGAEYKIDFLPKIKIEIVAPDNMVDKIVSTIIKAAKTGQVGDGKIFIYPVEEVIRVRT. 104
468 8.000e-63gi|998763123|gb|KXI27468.1| transcriptional regulator [Paraglaciecola sp. S66]  clstr ali  64  4IEAIIKPFKLDEVREALTELGIKGLTVTEVVGYGRQKGHTETYRGAEYQVDFLPKTKIELVVPDSLVERCVDIIQNMARTGKIGDGKIFVLDVQRAIRIRTG 105
469 8.000e-63gi|550947166|ref|WP_022695567.1| nitrogen regulatory protein P-II 1 [Ponticaulis koreensis]  clstr ali  61  4IEAVIKPFKLDEVKDALQELGLHGMTVVEAKGFGRQRGHTELYRGAEYVVDFLPKLKIEIIVSDDMAEEAISVITKTAQTGKIGDGKIFLSTIDDVVRIRTG 105
470 8.000e-63gi|738414792|ref|WP_036366343.1| nitrogen regulatory protein P-II 1 [Moraxella bovoculi]  clstr ali  71  4ITAIIKPFKLDDVRESLTLIDIHGMTITEVKGFGRQKGHAEIYRGAEYVVDFLPKLKIEVAVSDDLSGEVVHTITNAANTGKIGDGKIFVQPLDEIVRIRTG 105
471 8.000e-63gi|494916844|ref|WP_007642882.1| nitrogen regulatory protein P-II [Paraglaciecola psychrophila]  clstr ali  74  4VTAIVKPFKLDDVREAISEIGIDGLTVTEVKGFGRQKGHTELYRGAEYQVDFLPKVKLEVAVQDEHVERLVEAIVGAAKTGKIGDGKVFVYDLEHAVRIRTG 105
472 8.000e-63gi|928928765|ref|WP_053953691.1| transcriptional regulator [Idiomarina zobellii]  clstr ali  69  4IIALIKPFKLDDVKESLFEIGCQGLTVSEVRGVGRQKGHTELYRGAEYTVDFLPKIRIEIAVSDAQLERALEVIQSAAQTGAIGDGKIFVTPLEHCIRIRTG 105
473 9.000e-63gi|522190528|ref|WP_020699076.1| nitrogen regulatory protein P-II 1 [Reyranella massiliensis]  clstr ali  67  4VMAIFKPFKLDEVRDALTSLGIQGLTVSEVKGFGRQKGQTEIYRGAEYAVSFLPKVKIEVVIDDAMIERAVETICKAAGTGKIGDGKVFVLPVEQAVRIRTG 105
475 9.000e-63gi|502620423|ref|WP_012857262.1| nitrogen regulatory protein P-II [Sulfurospirillum deleyianum]  clstr ali  65  4IESIIKPFKLEDVKDALAELDITGMTVSEVKGYGRQQGHSELYRGAEYVVDFLPKVKIEVVVADELVDKVIDVIIKNARTGKIGDGKIFVTDVEKSIRIRTG 105
476 9.000e-63gi|238702535|gb|EEP95085.1| Nitrogen regulatory protein P-II 2 [Yersinia aldovae ATCC 35236]  clstr ali  77  38VTVVIKPFKLEDVREALSSVGIQGLTVTEVKGFGRQKGHAELYRGAEYSVNFLPKVKIDVAIADDQLDEVIDVISKAAYTGKIGDGKIFVAELQRVIRIRTG 139
477 9.000e-63gi|502982283|ref|WP_013217259.1| nitrogen regulatory protein P-II 1 [Hyphomicrobium denitrificans]  clstr ali  62  4ITAVIKPFKLEEVRSALTDLALQGMTVTEVKGYGRQKGHTEIYRGAEYAVSFLPKIKIEVVVPAAQVDKAIAAIQRSAKTGQIGDGKIFVSPIEHTVRIRTG 105
478 1.000e-62gi|700403497|gb|KGO33683.1| nitrogen regulatory protein P-II 1 [Desulfobulbus sp. Tol-SR]  clstr ali  62  4IEAIIKPFKLDDVKDALNELGIKGMTISEVKGYGRQKGHTEIYRGAEYVVDFIPKIKIEIVLPADQVDLVVNKIRAAANTDKIGDGKIFVLPVERVVRVRTG 105
479 1.000e-62gi|411027772|gb|AFW01027.1| nitrogen regulatory protein P-II, GlnK [Gluconobacter oxydans H24]  clstr ali  75  7VTAIIKPFKLDDVREALTPLGVQGLTVTEVKGFGRQKGQTEIYRGAEYHVSFLPKLKIEIAVADSVVEDVIEAIMTAARTGKIGDGKIMVSNLDQLIRIRTG 108
480 1.000e-62gi|949066317|gb|KRO62954.1| transcriptional regulator [Verrucomicrobia subdivision 6 bacterium BACL9 MAG-120507-bin52]  clstr ali  64  6IEAIIKPFKLEEVKEALHEAGVEGMTVTEVKGFGRQKGHTEIYRGSEYTVDFLPKVKLEIILDSASVEKATAAIIKSAKTGKIGDGKIFVLPVDEAIRIRT. 106
481 1.000e-62gi|1002802662|gb|KXU37096.1| transcriptional regulator [Opitutaceae bacterium CV41]  clstr ali  66  4ITAIIKPFKLEEVKQGLSEIGVEGMTVTEVKGFGRQKGHTEIYRGSEYTVDFLPKVKLEIVLCDSLVPKALDTIVAAAKTGKIGDGKVFVSPIEEVIRIRT. 104
482 1.000e-62gi|492843806|ref|WP_005997760.1| nitrogen regulatory protein P-II [Desulfuromonas acetoxidans]  clstr ali  61  4IDCIIKPFKLDDVKTALTDLGIAGMTVSEVRGFGRQKGHMELYRGAEYQTDFLPKVKVELVVDDQQVSDVVSALQKEACTGRIGDGKIFVTPVEESIRIRTG 105
483 1.000e-62gi|734860522|ref|WP_034110509.1| nitrogen regulatory protein P-II [Comamonadaceae bacterium A1]  clstr ali  69  4ITAVIKPFKLEEVREALAEQGVTGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVRIDVVLKSEDVERCVDAIIRAARTGKIGDGKIFVTPVERVVRIRTG 105
484 1.000e-62gi|293326254|dbj|BAJ00985.1| nitrogen regulatory protein P-II [Shewanella violacea DSS12]  clstr ali  75  5VEAIIKPFKLDDVRESLAEIGITGMTVLEVKGFGRQKGHTELYRGAEYMVDFLPKVKIELVIQDELLDRAIEVIVDTARTGKIGDGKIFVTEIERVIRIRTG 106
485 1.000e-62gi|654872291|ref|WP_028324327.1| nitrogen regulatory protein P-II 1 [Desulfatirhabdium butyrativorans]  clstr ali  67  4IEAIIKPFKLDEVKEALNEIGIQGMTVSEVKGYGRQKGHKEIYRGAEYIVDFIPKIKIEVVVEDTMVEQVIDRICSAAKTGKLGDGKIFVVPIEQVIRVRTG 105
486 1.000e-62gi|517801858|ref|WP_018972066.1| nitrogen regulatory protein P-II 1 [Rudaea cellulosilytica]  clstr ali  64  4ITAIIRPFKLEEVREALTQAGVSGLTVTEVKGYGRQKGHTELYRGAEYVVDLLPKIKIEAVVPEELLERALDAVIAGARTDKIGDGKIFVSPIEQALRIRTG 105
488 1.000e-62gi|656110145|ref|WP_029133681.1| nitrogen regulatory protein P-II 1 [Sedimenticola selenatireducens]  clstr ali  81  4VSAIIKPFKLDDVREALSEIGVSGITVVEVKGFGRQKGHTELYRGAEYVVDFLPKIRVDVAIAADKLDQVIEAISEAAKTGKIGDGKIFVSSLEQVVRIRTG 105
489 1.000e-62gi|211958420|gb|EEA93620.1| nitrogen regulatory protein PII [Pseudovibrio sp. JE062]  clstr ali  66  42VMAIIKPFKLDEVRDALTTLGIQGLTVTEVKGYGRQKGHTEIYRGTEYAVTFLPKLKVEVAIASDMADKVVEAIGNAAQTGQIGDGKIFVYSIDQVVRIRTG 143
491 1.000e-62gi|517800396|ref|WP_018970604.1| nitrogen regulatory protein P-II 1 [Rubritalea marina]  clstr ali  69  4IEAIIKPFKLEEVKEALAEVGVQGMTVTEVKGFGRQKGHTEIYRGSEYTVDFLPKVRIDIVVDDEQAQTVAEAIVKSANTGKIGDGKVFLSTVDEAIRIRTG 105
492 1.000e-62gi|946815451|gb|KRG22079.1| Nitrogen regulatory protein P-II 2 [Coxiellaceae bacterium HT99]  clstr ali  75  4ICAIVKPFKLDDVREALSELNVQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKAKIEIAVKDSEVSLIIDTIIKAAHTGKIGDGKIFVTSLDEVIRIRTG 105
493 1.000e-62gi|490285017|ref|WP_004180832.1| nitrogen regulatory protein P-II [Nitrosospira lacus]  clstr ali  68  4IEAIIKPFKLDEVCEALNEAGVSGLTITEVKGFGRQKGHTELYRGAEYVVDFLPKIKIEIVVPEALVDGVIDTIVNVARTGKIGDGKIFVTSIEQVVRIRTG 105
495 1.000e-62gi|497261492|ref|WP_009575709.1| nitrogen regulatory protein P-II 1 [gamma proteobacterium IMCC3088]  clstr ali  78  4VTAIIKPFKMDDVRLALSEIGVQGITGTEVKGFGRQRGHTELYRGAEYVVDFLPKLKLEIAVAESQVDATIDAILKSASTGKIGDGKIFVSPLEQVIRIRTG 105
497 2.000e-62gi|400756884|gb|EJP71096.1| nitrogen regulatory protein P-II [SAR86 cluster bacterium SAR86A]  clstr ali  68  4ITAIIKPFKVEEVRSSLDEIGVSGMTMTEVKGFGRQKGHTELYRGAEYTIDFLPKIKIEIAVKDDLVDQVKNAIIKSAGSGKIGDGKIFVSPIDEVIRIRTG 105
498 2.000e-62gi|518473506|ref|WP_019643713.1| nitrogen regulatory protein P-II 1 [Novispirillum itersonii]  clstr ali  63  4VMAIIKPFKLEDVREALGGIGIQGMTVSEVKGYGRQRGQTEIYRGAEYVVNFLPKVRLEIVVDDELADKVVETIQSTARSGKIGDGKIFVMDVGRAVRIRTG 105
499 2.000e-62gi|196174611|gb|ACG75584.1| nitrogen regulatory protein P-II [Anaeromyxobacter sp. K]  clstr ali  71  9VEAIIKPFKLDEVKQALSEVGVAGLTATEVKGFGRQKGHTELYRGAEYVVDFLPKVKVEVVVADSLVGRVVEVIERAAKTGRIGDGKIFVLPVEEVIRIRTG 110
502 2.000e-62gi|643595892|ref|WP_025236863.1| hypothetical protein [Mannheimia varigena]  clstr ali  65  4IEAIIKPFKLDDVREALTDVGISGMSITEIKGFGRQKGHTELYRGAEYAIDFLPKVKVEIVIPDELEEQCIEAIMETAQTGKIGDGKIFVYDVGRVIRIRTG 105
503 2.000e-62gi|822126516|gb|KLD80175.1| nitrogen regulatory protein P-II 1 [Xanthomonas hyacinthi DSM 19077]  clstr ali  73  20IMAVIKPFKLDDVREALAAQGVAGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKLEVAVTEDQVERVLEAIVKAAGTGKIGDGKVFVYDLGTVVRIRTG 121
504 2.000e-62gi|739155427|ref|WP_037019619.1| nitrogen regulatory protein P-II 1 [Rhizobiales bacterium YIM 77505]  clstr ali  67  4ITGIIKPFKLEEVRDALTALGVHGLTVAEVKGYGRQKGHTEIYRGAEYAVSFLPKLKIEVAVPSEVAPKVIEAITAAARTGQIGDGKIFVTPLERAVRIRTG 105
505 2.000e-62gi|503306314|ref|WP_013540975.1| nitrogen regulatory protein P-II 1 [Variovorax paradoxus]  clstr ali  69  4ITAIVKPFKLEDVREALAEVGVTGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKMKVEVVVNEGDVERCIEAIVNSARTGKIGDGKIFVTAVERIVRIRTG 105
506 2.000e-62gi|494041447|ref|WP_006983571.1| nitrogen regulatory protein P-II 1 [Chthoniobacter flavus]  clstr ali  64  4IEAIIKPFKLEDVKEALSEIGIEGMTISEVKGFGRQKGHTEIYRGSEYTVDFLPKVKFEIVLADDRVTRAVEAIVSSAKTGKIGDGKVFILPIEDAIRIRT. 104
507 2.000e-62gi|476509679|gb|AGI67690.1| nitrogen regulatory protein P-II [Octadecabacter antarcticus 307]  clstr ali  72  15IEAIIKPFKLDEVKEALQEAGIQGLSVVEVKGFGRQKGHTELYRGAEYVVDFLPKVKIEVVLADDQVDGAIQAIITAAKTDKIGDGKIFVSDVSQAIRIRTG 116
508 2.000e-62gi|495762497|ref|WP_008487076.1| nitrogen regulatory protein P-II 1 [Idiomarina xiamenensis]  clstr ali  72  4ITALIKPFKLDDVRAALAEIGCKGLTVTEVRGFGRQKGHTELYRGAEYRIDFLPKVKIDIAASDDQVEAIIDAISDAAHTGNIGDGKIFITQLEQALRIRTG 105
509 2.000e-62gi|751603034|ref|WP_041071181.1| hypothetical protein [Thiolapillus brandeum]  clstr ali  70  4IEVILKPFKLDDVREALSEIGITGMTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKLELVVRGEQMEQCVETIIGAARTGKIGDGKIFVSDVERVIRIRT. 104
510 2.000e-62gi|499816598|ref|WP_011497332.1| nitrogen regulatory protein P-II 1 [Shewanella denitrificans]  clstr ali  75  4VSAIIKPFKLDDVREAIAGIGVEGMTVTEVKGFGRQKGHTELYRGAEYQVDFLPKVKLDIAIKEEQVEFLVEAIIAAARTGKIGDGKIFVTELEQVVRIRTG 105
512 2.000e-62gi|753206757|ref|WP_041512755.1| nitrogen regulatory protein P-II 1 [Nitrosospira sp. NpAV]  clstr ali  79  4VTAIIKPFKLGEVREALSAIGVQGLTVTEVKGFGRQKGHTELYRGAEYVIDFVPKVKIEAAVRSELLVQTIEAISKAANTGKIGDGKIFVFDLEQVIRIRTG 105
513 2.000e-62gi|496120414|ref|WP_008844921.1| nitrogen regulatory protein P-II 1 [Aliiglaciecola lipolytica]  clstr ali  69  4IEAIIKPFKMENVREALSEIGVSGMTVTEVKGFGRQKGHSELYRGAEYHVGFLPKHKIDLVVPDDLVERAIEVILDNARTGKIGDGKIFVSDIERAIRIRTG 105
514 2.000e-62gi|499758538|ref|WP_011439272.1| nitrogen regulatory protein P-II 1 [Rhodopseudomonas palustris]  clstr ali  64  4VVAIIKPFKLDEVRQALTEIGVHGMTVTEVKGYGRQRGHTEIYRGAEYIVNFLPKLRIEIAVDSALADKAVEVITRGARTGQIGDGKIFVTPIDHALRIRTG 105
515 2.000e-62gi|647623705|ref|WP_025897262.1| nitrogen regulatory protein P-II 1 [Sneathiella glossodoripedis]  clstr ali  63  4VMAIIKPFKLDDVRDALTSIGIDGLTATEVKGFGRQKGHTEIYRGAEYAISFLPKIKIELAVKDDLVEQAVETIMTTAKTGQIGDGKIFVYDLNNVVRIRTG 105
516 2.000e-62gi|931388432|gb|KPJ78171.1| transcriptional regulator [Deltaproteobacteria bacterium SG8_13]  clstr ali  62  4IEAVIKPFKLEEVKEALNDIGVNGMTISEVKGFGRQRGHKEIYRGAEYQVDFVPKVQLGLVVDDDMADKVIEVIQKTAKTGKIGDGKIFVSPMDGAIRIRTG 105
517 3.000e-62gi|973987237|emb|CUA93938.1| nitrogen regulatory protein P-II family [Pannonibacter indicus]  clstr ali  66  23VMAIIKPFKLDEVRDALTSIGIQGLTVTEVKGYGRQKGHTEIYRGTEYAVSFLPKLKIEVAVSSESVDKVVEVISGAAKTGQIGDGKIFVYSIDQVVRIRTG 124
518 3.000e-62gi|499707579|ref|WP_011388313.1| nitrogen regulatory protein P-II 1 [Rhodospirillum rubrum]  clstr ali  63  4IMAIIKPFKLDEVCEALTSLDVHGLTVSEVKGFGRQKGQTEIYRGAEYQVNFLPKVKIEVAVSDGLADLAVEAICNAARTDRIGDGKVFVYDLDKIVRIRTG 105
519 3.000e-62gi|815929263|ref|XP_012249078.1| PREDICTED: ammonium transporter 1-like [Bombus impatiens]  clstr ali  69  5.TAIIKPFKLEEVREALSNIGITGLTVTEVKGFGRQKGHSELYRGAEYNVNFLPKVKIELAINDDMVDEVINILVHTAHTGTMGDGKIFVTQLEHVVRIRTG 105
520 3.000e-62gi|492847100|ref|WP_006001054.1| nitrogen regulatory protein P-II 1 [Desulfuromonas acetoxidans]  clstr ali  70  4VEAIIKPFKLDEVKESLSEIGIQGITVSEVKGFGRQKGHTELYRGAEYVVDFIPKIKMEIIVSDDIVAKVIDQIAEAAKTGRIGDGKIFVTPVEEVVRIRTG 105
521 3.000e-62gi|651245383|ref|WP_026380520.1| nitrogen regulatory protein P-II 1 [Afifella pfennigii]  clstr ali