current user: public

Query: PF00543.20; C1DJ64_AZOVD/4-105; Nitrogen regulatory protein P-II, from PfamA30U

Results of FFAS03 search in SCOP206
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
1 -71.300d4affa1 d.58.5.1 (A:1-112) automated matches {Synechococcus elongatus [TaxId: 32046]}  ali model 3D-neighbors follow..  58  4IEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFGRQKGQTERYRGSEYTVEFLQKLKLEIVVEDAQVDTVIDKIVAAARTGENGDGKIFVSPVDQTIRIRTG 105
2 -21.800d2cz4a1 d.58.5.1 (A:2-100) Hypothetical protein TTHA0516 {Thermus thermophilus [TaxId: 274]}  ali model 3D-neighbors follow..  16  8VTIVAESLLEKRLVEEVKRLGAKGYTITPARGEGS--------RGIRSVDWEGQNIRLETIVSEEVALRILQRLQEEYFPH--YAVIAYVENVWVV...... 93
3 -20.800d3dfea_ d.58.5.0 (A:) automated matches {Anabaena variabilis [TaxId: 240292]}  ali model 3D-neighbors follow..  20  7LVIVTEKVLLKKVAKIIEEAGATGYTVVDTGGKGSRNVRSTGKPN---TSDTDSNVKFEVLTENREMAEKIADQVAIKFFTDYA-GIIYICEAE........ 96
4 -7.780d2dcla_ d.58.5.0 (A:) automated matches {Pyrococcus horikoshii [TaxId: 53953]}  ali model 3D-neighbors follow..  21  28..........KVIVEKLREMGIAGATVYRIYGFGK---KSRVHSSDVIRLSTDLPIIVEVVDRGHNIEKVVNVIKPMIKDGMI................... 98
5 -6.990d1o51a1 d.58.5.4 (A:1-100) Hypothetical protein TM0021 {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  17  21..........EYLVKRAYELGMKGVTVYRIMGFGH---KRHMHRSDFFSLSPDLPIVLEIVDEEERINLFLKEIDNIDFDGLVFTADVNVV........... 99
6 -6.600d1s5ac1 d.17.4.10 (C:1-142) Hypothetical protein YesE {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  12  24........DMKSWTELWDENAVFEFPYAPEGSPKRIEGKAAIYDYIKDYPKQIHLSSFTAPTVYRSADSNTVIAEFQCDGHVIETGLPYRQSYISVIETRDG 117
7 -6.510d3ep1a_ d.118.1.0 (A:) automated matches {Alvinella pompejana [TaxId: 6376]}  ali model 3D-neighbors follow..  16  59TEQIVKALQDADFKEGNDDIKYNFLVIYEGRGWGVVGQHTKGRDSHSIGVAVIGDFGKKEP-SQALQDALSKLIICGQAAEELSSG................ 148
8 -6.500d4g38a4 d.134.1.0 (A:426-570) automated matches {Escherichia coli K-12 [TaxId: 83333]}  ali model 3D-neighbors follow..  22  27......PSFIDNIDNLMAKHGVSDEHIVEVGLVGKAPGRYNLHLGGNRIGTRIPRMYKENITEPEILASLDELIGRWAKEREAGEG................ 122
9 -6.460d1efdn_ c.92.2.1 (N:) Periplasmic ferric siderophore binding protein FhuD {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  14  13...........LPVELLLALGIVPYGVADTINYRLWVSEPPLPDSVEPNLELLTEMKPSFMVWSAGYGPSPEMLARIAPG...................... 88
10 -6.400d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  14  187.......ITSDDLTQMLDNLGLKYECYDLLSTMDISDCFIDGNENGDLLWDFLTETCNFNATAPPDLRAELGKDLQEPEFSAKKEGKVLFNNTLSFIVIEA. 280

FFAS is supported by the NIH grant R01-GM087218-01
8 7 1 4 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.