current user: public

Query: PF00543.17; O54449_AZOVI/4-105; Nitrogen regulatory protein P-II, from PfamA26U

Results of FFAS03 search in SCOP175
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
1 -70.800d2ns1b1 d.58.5.1 (B:1-112) PII-homolog GlnK {Shigella flexneri [TaxId: 623]}  ali model 3D-neighbors follow..  77  4VTVIIKPFKLEDVREALSSIGIQGLTVTEVKGFGRQKGHAELYRGAEFSVNFLPKVKIDVAIADDQLDEVIDIVSKAAYTGKIGDGKIFVAELQRVIRIRTG 105
2 -70.300d1vfja_ d.58.5.1 (A:) PII (product of glnB) {Thermus thermophilus [TaxId: 274]}  ali model 3D-neighbors follow..  39  4IVAIVRPEKLNEVLKALFQAEVRGLTLSRVQGHGGETERVETYRGTTVKMELHEKVRLEIGVSEPFVKPTVEAILKAARTGEVGDGKIFVLPVEKVYRIRTG 105
3 -27.600d2cz4a1 d.58.5.1 (A:1-100) Hypothetical protein TTHA0516 {Thermus thermophilus [TaxId: 274]}  ali model 3D-neighbors follow..  13  9VTIVAESLLEKRLVEEVKRLGAKGYTITPARGEGSRGIRSVDWEG--------QNIRLETIVSEEVALRILQRLQEEYFPHY--AVIAYVENVWVVRGEK.. 98
4 -8.820d1o51a_ d.58.5.4 (A:) Hypothetical protein TM0021 {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  17  23..........EYLVKRAYELGMKGVTVYRIMGFGHKR---HMHRSDFFSLSPDLPIVLEIVDEEERINLFLKEIDNIDFDGLVFTADVNVV........... 101
5 -7.170d1s5aa_ d.17.4.10 (A:) Hypothetical protein YesE {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  12  18....MLEKDMKSWTELWDENAVFEFPYAPEGSPKRIEGKAAIYDYIKDYPKQIHLSSFTAPTVYRSADSNTVIAEFQCDGHVIETGLPYRQSYISVIETRDG 115
6 -6.220d2cy5a1 b.55.1.2 (A:31-159) EPS8-like protein 1, EPS8L1 {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  3............................................VSQYHVNHLVTFCLGEEDGVHTVEDASRKLAVMDSQGRVWAQEMLLRVSPSQVTL... 57
7 -6.060d1esza_ c.92.2.1 (A:) Periplasmic ferric siderophore binding protein FhuD {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  14  1....IDPNRIVALEELLLALGIVPYGVADTINYRLPDSVIDVGLRTEPNLELLTEMKPSFMVWSAGYGPSPEMLARIAPG...................... 87
8 -6.020d3ebta1 d.17.4.9 (A:1-131) Uncharacterized protein BPSS0132 {Burkholderia pseudomallei [TaxId: 28450]}  ali model 3D-neighbors follow..  13  46.................................GTKHGHDEVIAFIRHVPTHIAEMRLAP---DEFIESGERIVVLGTRRVTAVNGRSATLKFVHVWRFENG 111
9 -5.930d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  16  163.KIIVFTNYRETAKKIVNELVKDGIKAKRFVGQASKENDRGLFARGEFNVLVATSVEVDLVVFYEPVPSAIRSIQRRGRTGRHMPGRVIIL........... 271
10 -5.620d1wlta1 b.82.1.1 (A:1-176) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeon Sulfolobus tokodaii [TaxId: 111955]}  ali model 3D-neighbors follow..  20  14...LIKPKVFPDKREVFKSEDFTKMRIPNVIQTNMSFSRKGVVRGLHYQRTPKEQGKIIFVPKGRILDVAVDVRKSSPTFGK.................... 96

FFAS is supported by the NIH grant R01-GM087218-01
6 2 7 3 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Godzik A. VISSA: a program to visualize structural features from structure sequence alignment. Bioinformatics. 2006 Apr 1;22(7):887-8. Epub 2006 Jan 24.