current user: public

Announcement: our server is upgraded to a faster system. If you experience any issues during this period please let us know.

Query: PF00018.23; YKA7_CAEEL/197-244; SH3 domain, from PfamA26U

Results of FFAS03 search in SCOP175
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .
1 -37.100d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  29  8.AMYDYMAADADEVSFKDGDAIINVQAIDEGWMYGTVQRTGRTGMLPA 54
2 -37.100d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  27  4TAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPS 51
3 -31.700d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  36  9EALFSYEATQPEDLEFQEGDIILVLSKVNEEWLEGESK--GKVGIFPK 54
4 -31.300d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]}  ali model 3D-neighbors follow..  23  4LALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVN--DRQGFVPA 49
5 -30.800d1gria2 b.34.2.1 (A:157-217) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  31  7.ALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACH--GQTGMFPR 51
6 -30.700d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  21  4.VLYAYVQKDDDEITITPGDKISLVARDTSGWTKINNDTTGETGLVPT 51
7 -30.700d2rn8a1 b.34.2.1 (A:176-228) Bruton`s tyrosine kinase {Mus musculus [TaxId: 10090]}  ali model 3D-neighbors follow..  23  2IALYDYQTNDPQELALRCDEEYYLLDSSEIHWWRVQD-KNGHEGYAPS 48
8 -30.200d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  25  8.ALYDYKKEREEDIDLHLGDILTVNKGEEIGWLNGYNETTGERGDFPG 69
9 -29.800d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  23  5RALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAE-DSEGKRGMIPV 51
10 -29.800d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  30  6RAIADYEKTSGSEMALSTGDVVEVVEKSESGWWFCQMK--AKRGWIPA 51
11 -29.700d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  21  5KSKYDFVARNSSELSVMKDDVLEILDDRRQWWKVRNAS--GDSGFVPN 50
12 -29.400d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  23  10IALHSYEPSHDGDLGFEKGEQLRILEQ-SGEWWKAQSLTTGQEGFIPF 56
13 -29.300d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  23  11.ALFDYKAQREDELTFIKSAIIQNVEKQEGGWWRGDYG-GKKQLWFPS 56
14 -29.000d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  34  38IAMYDYAANNEDELSFSKGQLINVMNKDDPDWWQGEIN--GVTGLFPS 83
15 -28.600d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  29  4IAKYDFKATADDELSFKRGDILKVLNECDQNWYKAELN--GKDGFIPK 50
16 -28.500d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  34  17.AQHDYTATDTDELQLKAGDVVLVIEEQDEGWLMGVKESEKCRGVFPE 76
17 -28.400d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  25  6VAMYDFQATEAHDLRLERGQEYIILEKNDLHWWRAR-DKYGSEGYIPS 52
18 -27.900d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  31  5VALYSFAGEESGDLPFRKGDVITILKKSDNDWWTGRVN--GREGIFPA 52
19 -27.800d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  26  18VAIKAYTAVEGDEVSLLEGEAVEVIHKLLDGWWVIRKD--DVTGYFPS 63
20 -27.700d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  15.ALYACKAEHDSELSFTAGTVFDNVHPSQEGWLEGTLN--GKTGLIPE 60
21 -27.000d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  21  15.GIPPPPGAFGPFLRLNPGDIVELTKAAEHNWWEGRNTATNEVGWFPC 62
22 -26.900d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  15.ALCSWTAKKDNHLNFSKHDIITVLEQ-QENWWFGEVH--GGRGWFPK 58
23 -26.800d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  16  11TVIKDYYALKENEICVSQGEVVQVLAVNQQNMCLVYQPASAAEGWVPG 62
24 -26.700d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  22  10IAKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGIIPA 57
25 -26.600d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  29  10.ALYPFEARNHDEMSFNSGDIIQVDEKTEPGWLYGSFQ--GNFGWFPC 56
26 -26.500d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  10QTLYPFSSVTEEELNFEKGETMEVIEKPDPEWWKCK-NARGQVGLVPK 58
27 -25.700d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  17  4VALYDFVASGDNTLSITKGEKLRVLGYNHNGWCEAQT--KNGQGWVPS 50
28 -25.600d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  31  8YALWDYEPQNDDELPMKEGDCMTIIHREDEEWWWARLN--DKEGYVPR 56
29 -24.800d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  29  21QAERNFNAAQDLDVSLLEGDLVGVIKKKDQNRWLIDN--GVTKGFVYS 70
30 -23.700d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  27  10.ALYDFVPENPEEVALKKGDLMAILSKKDSDWWKVRT-KNGNIGYIPY 61
31 -23.000d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  27  21VARYSYNPFDEAELPLTAGKYLYVYGDMDDGFYEGELL-DGQRGLVPS 74
32 -23.000d1ri9a_ b.34.2.1 (A:) Fyn-binding protein (T-cell adapter protein adap) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  26TTSITSKKWGTRDLQVKPGESLEVIQTTDDTKVLCR-NEEGKYGYVLR 72
33 -22.500d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  22  25VALQDYMAPDCRFLTIHRGQVVYVFSKLKQGDYYGDLA--ARLGYFPS 81
34 -22.400d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}  ali model 3D-neighbors follow..  21  26.TNVRYSAAQEDAISFEAKDFLHVKEKFNNDWWIGRLKEGCEIGFIPS 80
35 -22.200d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  29  6.ALFDYDKTKDCALSFRFGDVLHVIDAGDEEWWQARRSETDDIGFIPS 61

FFAS is supported by the NIH grant R01-GM087218-01
6 1 2 5 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Jaroszewski L, Slabinski L, Wooley J, Deacon AM, Lesley SA, Wilson IA, Godzik A. Genome pool strategy for structural coverage of protein families. Structure. 2008 Nov 12;16(11):1659-67.