current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: PF00018.26; YKA7_CAEEL/197-244; SH3 domain, from PfamA30U

Results of FFAS03 search in SCOP206
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .
1 -38.900d2lj0a_ b.34.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  38  11.ALYSYIPQNDDELELRDGDIVDVMEKCDDGWFVGTSRRTKQFGTFPG 57
2 -36.200d2cuca1 b.34.2.0 (A:8-64) automated matches {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  25  4VALHTYSAHRPEELDLQKGEGIRVLGKYQDGWLKGLSLLTGRTGIFPS 51
3 -34.800d3i35a_ b.34.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  29  5.AVYDYSAADEDEVSFQDGDTIVNVQQIDDGWMYGTVERTGDTGMLPA 51
4 -34.400d1yn8a1 b.34.2.0 (A:2-59) automated matches {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  35  4VALYDFEPENDNELRLAEGDIVFISYKHGQGWLVAENESGSKTGLVPE 51
5 -34.000d2o9sa1 b.34.2.0 (A:824-884) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  29  5.AKFNFNGDTQVEMSFRKGERITLLRQVDENWYEGRIPGTSRQGIFPI 51
6 -31.200d2j05a_ b.34.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  19  9.AILPYTKPDTDEISFLKGDMFIVHNELEDGWMWVTNLRTDEQGLIVE 56
7 -30.700d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  27  4TAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPS 51
8 -30.700d2gnca1 b.34.2.0 (A:9-60) automated matches {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  30  2IAKFDYVGRSARELSFKKGASLLLYHRASEDWWEGRH--NGIDGLVPH 47
9 -29.200d1w6xa_ b.34.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  24  5.ALFDFTGNSKLELNFKAGDVIFLLSRINKDWLEGTV--RGATGIFPL 49
10 -28.600d3i5ra_ b.34.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  25  9.ALYDYKKEREEDIDLHLGDILTVNKGSEIGWLNGYNETTGERGDFPG 70
11 -28.600d4lnpa_ b.34.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  40  7.AKFDFKAQTLKELPLQKGDIVYIYKQIDQNWYEGEH--HGRVGIFPR 51
12 -27.600d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  36  9EALFSYEATQPEDLEFQEGDIILVLSKVNEEWLEGES--KGKVGIFPK 54
13 -27.500d1x3va1 b.34.2.1 (A:8-62) p67phox {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  24  5.VLFGFVPETKEELQVMPGNIVFVLKKGNDNWATVMF--NGQKGLVPC 49
14 -26.900d2g6fx1 b.34.2.1 (X:10-63) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  28  4.AKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTH--NGRTGWFPS 48
15 -26.600d1x2pa1 b.34.2.0 (A:8-62) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  30  4VAIADYAATDETQLSFLRGEKILILRQTTADWWWGER--AGCCGYIPA 49
16 -26.400d2v1qa1 b.34.2.0 (A:4-60) automated matches {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  27  3IVQYDFMAESQDELTIKSGDKVYILDKKSKDWWMCQLVDSGKSGLVPA 51
17 -26.400d2rqta_ b.34.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  23  6.TIYDCQADNDDELTFIEGEVIIVTGEEDQEWWIGHIEGQERKGVFPV 53
18 -26.300d1ue9a1 b.34.2.1 (A:8-74) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  31  4QVTSAYVASGSEQLSLAPGQLILILKKNTSGWWQGELQKKRQKGWFPA 54
19 -26.200d1udla1 b.34.2.1 (A:8-92) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  34  31IAMYDYAANNEDELSFSKGQLINVMNKDDPDWWQGEI--NGVTGLFPS 76
20 -25.900d3m0ra_ b.34.2.1 (A:) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]}  ali model 3D-neighbors follow..  26  6LALYDYQEKSPDEVTMKKGDILTLLNSTNKDWWKVEV--NDRQGFVPA 51
21 -25.800d1x6ga1 b.34.2.0 (A:8-75) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  14ITKCEHTRPKPGELAFRKGDVVTILEACENSWYRVKHHTSGQEGLLAA 62
22 -25.800d1x2qa1 b.34.2.0 (A:8-82) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  31  15.ALYDFEAVEDNELTFKHGEIIIVLDDSDANWWKGEN--HRGIGLFPS 59
23 -25.800d2yuna1 b.34.2.0 (A:8-73) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  31  5.ALYSFQARQDDELNLEKGDIVIIHEKKEEGWWFGSL--NGKKGHFPA 49
24 -25.400d1zuya_ b.34.2.0 (A:) automated matches {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  27  5.AAYDFPGSGSSELPLKKGDVIYITREEPSGWSLGKLLDGSKEGWVPT 52
25 -25.200d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  23  5RALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSE-GKRGMIPV 51
26 -25.000d1x43a1 b.34.2.0 (A:8-75) automated matches {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  25  14RVLYDYDAANSTELSLLADEVITVFSGMDSDWLMGER--GNQKGKVPI 61
27 -24.700d2kgta_ b.34.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  14VGLWDFKSRTDEELSFRAGDVFHVARKEEQWWWATLLDEAVAQGYVPH 64
28 -24.500d2m0ya_ b.34.2.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  29  15VAFYNYDARGADELSLQIGDTVHILETYEGWYRGYTLRKKSKKGIFPA 62
29 -24.200d4xi2a1 b.34.2.0 (A:214-278) automated matches {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  25  7VALYDYMPMNANDLQLRKGEEYFILEESNLPWWRAR-DKNGQEGYIPS 53
30 -23.900d2iima2 b.34.2.1 (A:59-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  23  9IALHSYEPSHDGDLGFEKGEQLRILEQ-SGEWWKAQSLTTGQEGFIPF 55
31 -23.700d1zuua1 b.34.2.1 (A:3-57) BZZ1 {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  21  3.VLYAYVQKDDDEITITPGDKISLVARDTSGWTKINNDTTGETGLVPT 50
32 -23.600d1k9ab1 b.34.2.1 (B:4-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  22  12IAKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGIIPA 59
33 -23.600d2i0na1 b.34.2.0 (A:10-80) automated matches {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}  ali model 3D-neighbors follow..  23  6.ALKDYNVSDTSLLPFKRNDIITITFKDQENWFMGQL--NGKEGSFPV 51
34 -23.400d1j3ta1 b.34.2.1 (A:8-68) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  8.ALCSWTAKKDNHLNFSKHDIITVLEQ-QENWWFGEV--HGGRGWFPK 51
35 -23.000d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  31  5VALYSFAGEESGDLPFRKGDVITILKKSDNDWWTGRV--NGREGIFPA 52
36 -23.000d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  30  6RAIADYEKTSGSEMALSTGDVVEVVEKSESGWWFCQM--KAKRGWIPA 51
37 -22.600d2ekha1 b.34.2.0 (A:8-74) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  23  5MTCSAYQKVQDSEISFPAGVEVQVLEKQESGWWYVRFG--ELEGWAPS 50
38 -22.500d2j6ka_ b.34.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  29  4IVEYDYDAVHDDELTIRVGEIIRNVKKLQEGWLEGEL--NGRRGMFPD 50
39 -22.400d2mioa1 b.34.2.0 (A:12-70) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  19  8.AVYPCEAEHSSELSFEIGAIFEDVQTSREGWLEGTL--NGKRGLIPQ 53
40 -22.400d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  22  10QTLYPFSSVTEEELNFEKGETMEVIEKPDPEWWKCKNAR-GQVGLVPK 58
41 -22.400d2dl5a1 b.34.2.0 (A:8-72) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  21  11.VVYSYKASQPDELTIEEHEVLEVIEDGDEDWVKARNK-VGQVGYVPE 57
42 -22.200d1uffa1 b.34.2.1 (A:8-88) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  29  3.ALYPFEARNHDEMSFNSGDIIQVDEKTEPGWLYGSF--QGNFGWFPC 49
43 -22.000d1wyxa_ b.34.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  25  7.ALYDNVAESPDELSFRKGDIMTVLEQDTDGWWLCSL--HGRQGIVPG 54
44 -21.600d4a63b2 b.34.2.0 (B:1056-1121) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  29  9.ALWDYEPQNDDELPMKEGDCMTIIHREDEDWWWARL--NDKEGYVPR 56
45 -21.600d1wxua1 b.34.2.0 (A:8-87) automated matches {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  23  15.AEYDFVAVSDEEISFRAGDMLNLALKEQQGWLLASLDG-QTTGLIPA 64
46 -21.600d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  26  18VAIKAYTAVEGDEVSLLEGEAVEVIHKLLDGWWVIRK--DDVTGYFPS 63
47 -21.600d4j9fa_ b.34.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  9VALYDFVASGDNTLSITKGEKLRVLGYNHNGWCEAQT--KNGQGWVPS 55
48 -21.500d1wfwa1 b.34.2.1 (A:8-68) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  16  4TVIKDYYALKENEICVSQGEVVQVLAVNQQNMCLVYQPASAAEGWVPG 55
49 -21.400d2dnua1 b.34.2.0 (A:8-65) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  26  5VTVQPYTSQSKDEIGFEKGVTVEVIRKNLEGWWYIRY--LGKEGWAPA 50
50 -21.400d1gcqc1 b.34.2.1 (C:595-659) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  22  4EVFQEYYGAFGPFLRLNPGDIVELTKEAEHNWWEGRNTATNEVGWFPC 58
51 -21.400d4cc4b1 b.34.2.0 (B:1513-1577) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  22  7FAVYTFKARNPNELSVSANQKLKILEFKDTEWWLAEV--NGKKGYVPS 56
52 -21.400d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  34  17.AQHDYTATDTDELQLKAGDVVLVIEEQDEGWLMGVKESDKCRGVFPE 76
53 -21.300d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  22  6.SKYDFVARNSSELSVMKDDVLEILDDRRQWWKVRNA--SGDSGFVPN 50
54 -21.100d2yuqa1 b.34.2.1 (A:8-85) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  25  16IALYDYQTNDPQELALRRNEEYCLLDSSEIHWWRVQ-DRNGHEGYVPS 62
55 -20.600d2enma1 b.34.2.0 (A:8-77) automated matches {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  23  7.VMYDFAAEPGNELTVTEGEIITVTNPVGGGWLEGKNN-KGEQGLVPT 54
56 -20.500d3rnja1 b.34.2.1 (A:375-436) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  25  7.AIFSHAADNSTLLSFKEGDLITLVPEARDGWHYGESEKTKMRGWFPF 55
57 -19.300d2ct4a1 b.34.2.0 (A:8-64) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  10  5.AIYHFEGSSEGTISMAEGEDLSLMEEDKGDGWTRVRRKEGGEGYVPT 51
58 -19.100d2v1ra_ b.34.2.1 (A:) automated matches {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  27  10.ALYDFVPENPEEVALKKGDLMAILSKKDSDWWKVRTK-NGNIGYIPY 61
59 -18.900d2egca1 b.34.2.0 (A:8-69) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  7VSIADYEGDE-ETAGFQEGVSMEVLERNPNGWWYCQILDKPFKGWVPS 55
60 -18.700d2b86a_ b.34.2.1 (A:) Nck-2 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  26  8IAKWDYTAQQDQELDIKKNERLWLLDD-SKTWWRVR-NAANRTGYVPS 53
61 -18.400d1u3oa_ b.34.2.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  22  8VVLQDFSAAHSSELSIQVGQTVELLERPSEGWCLVRTRSPPQEGLVPS 59
62 -18.300d1ug1a1 b.34.2.1 (A:8-85) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  29  14QAERNFNAAQDLDVSLLEGDLVGVIKKKDQNRW--LIDNGVTKGFVYS 63
63 -17.300d2csia1 b.34.2.1 (A:8-70) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  31  4VALYDYDPDVEAELTFCTGDIITVFGEIDDGFYYGEL--NGQKGLVPS 57
64 -16.700d2egea1 b.34.2.0 (A:8-75) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  35  4IAALDYDPQGKGRLALRAGDVVMVYGPMDQGFYYGELG--GHRGLVPA 57
65 -15.200d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  23  26.ALQDYMAPDCRFLTIHRGQVVYVFSKLKQGDYYGDL--AARLGYFPS 81
66 -15.200d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Norway rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  21  26.TNVRYSAAQEDDISFEAKDFLHVKEKFNNDWWIGRLVKEGEIGFIPS 80
67 -14.200d3tvta1 b.34.2.0 (A:602-776) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}  ali model 3D-neighbors follow..  31  6.ALFDYDPNRDRGLPFKHGDILHVTNASDDEWWQARRNEDEQIGIVPS 61
68 -14.000d1ri9a_ b.34.2.1 (A:) Fyn-binding protein (T-cell adapter protein adap) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  24KVTTSITSKKWRDLQVKPGESLEVIQTTDDTKVLCR-NEEGKYGYVLR 72

FFAS is supported by the NIH grant R01-GM087218-01
9 7 8 4 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Zmasek CM, Zhang Q, Ye Y, Godzik A. Surprising complexity of the ancestral apoptosis network. Genome Biol. 2007 Oct 24;8(10):R226 [Epub ahead of print]