current user: public




Query: PF00017.22; P85B_BOVIN/326-401; SH2 domain, from PfamA30U

Results of FFAS03 search in SCOP206
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .
# Score Template Links and tools%idFirst WYWGDISREEVNEKLRDTPDGTFLVRDASSKIQGEYTLTLRKGGNNKLIKVFHRDGHYGFSEPLTFCSVVDLITHYLast
1 -53.700d2iuga1 d.93.1.1 (A:10-112) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  85  3WYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFSSVVELINHY 78
2 -48.400d2dlza1 d.93.1.0 (A:8-112) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  24  11WFAGNMERQQTDNLLKSHASGTYLIRERPAE-AERFAISIKFNDEVKHIKVVEKDNWIHITEAKKFDSLLELVEYY 85
3 -47.700d3eaza_ d.93.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  28  10WFHGKITREQAERLLYPPETGLFLVRESTNY-PGDYTLCVSSDGKVEHYRIMYHASKLSIDEEVYFENLMQLVEHY 84
4 -44.300d4eiha_ d.93.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  27  7WYHGPVSRSAAEYLLSSLINGSFLVRESES-SPGQLSISLRYEGRVYHYRINTADGKVYVTAESRFSTLAELVHHH 82
5 -42.900d1qada_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Cow (Bos taurus) [TaxId: 9913]}  ali model 3D-neighbors follow..  30  11WNVGSSNRNKAENLLRGKRDGTFLVRESSK--QGCYACSVVVDGEVKHCVINKATGYGFAEPYNLYSSLKELVLHY 85
6 -42.500d2izva2 d.93.1.1 (A:274-385) Suppressor of cytokine signaling 4, SOCS-4 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  21  13CYWGVMDKYAAEALLEGKPEGTFLLRDSAQE-DYLFSVSFRRYSRSLHARIEQWNHNFSFDAHDPSPDITGLLEHY 91
7 -42.000d1ju5a_ d.93.1.1 (A:) Crk proto-oncogen {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  28  2WYWGRLSRQEAVALLQGQRHGVFLVRDSSTS-PGDYVLSVSENSRVSHYIINSSGPRPPVPGDQEFDSLPALLEFY 93
8 -41.400d2c9wa2 d.93.1.1 (A:32-134) Suppressor of cytokine signaling 2, SOCS-2 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  34  17WYWGSMTVNEAKEKLKEAPEGTFLIRDSSHS-DYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICFDSVVHLIDYY 98
9 -41.000d1ayaa_ d.93.1.1 (A:) Tyrosine phosphatase Syp {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  27  4WFHPNITGVEAENLLLTRVDGSFLARPSKSN-PGDFTLSVRRNGAVTHIKIQNTGDYYDLYGGEKFATLAELVQYY 79
10 -40.700d2b3oa2 d.93.1.0 (A:109-215) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  31  2WYHGHMSGGQAETLLQAKEPWTFLVRESLSQ-PGDFVLSVLSDQRVTHIKVMCEGGRYTVGGLETFDSLTDLVEHF 86
11 -40.400d3ov1a_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  27  6WFFGKIPRAKAEEMLSKQHDGAFLIRESESA-PGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYH 81
12 -40.300d2hdva1 d.93.1.1 (A:519-627) automated matches {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  26  9WFHGMLSRLKAAQLVLEGSHGVFLVRQSETR-RGECVLTFNFQGKAKHLRLSLNAAGQCRVQHLHFQSIFDMLEHF 86
13 -39.800d2gsba1 d.93.1.0 (A:8-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  27  11WFHGKISKQEAYNLLMTVQVCSFLVRPSDNT-PGDYSLYFRTNENIQRFKICPTPNNQFMMGGRYYNSIGDIIDHY 86
14 -39.400d2ciaa1 d.93.1.0 (A:284-380) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  30  2WYYGNVTRHQAECALNERVEGDFLIRDSESS-PSDFSVSLKASGKNKHFKVQLVDNVYCIGQR-RFHTMDELVEHY 76
15 -38.800d2dx0a_ d.93.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  31  13WFHKKVSRTSAEKLLQGAKDGTFLVRESETF-PNDYTLSFWRSGRVQHCRIRSTMENYYLTDNLTFNSIYALIQHY 98
16 -38.000d2oq1a1 d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  27  8FFYGSISRAEAEEHLKGMADGLFLLRQCLRS-LGGYVLSLVHDVRFHHFPIERLNGTYAIAGGKAHCGPAELCEFY 85
17 -37.000d2cs0a1 d.93.1.1 (A:8-113) Hematopoietic SH2 domain containing protein HSH2D {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  28  11WFHGAISREDAENLLESQPLGSFLIRVSHSHVG--YTLSYKAQSSCCHFMVKLLDDGTFMGEKVAHTSLDALVTFH 86
18 -36.900d1lkka_ d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  27  6WFFKNLSRKDAERQLLGNTHGSFLIRESEST-AGSFSLSVRDFDQVKHYKIRNDNGGFYISPRITFPGLHELVRHY 88
19 -36.600d1nrva_ d.93.1.1 (A:) Growth factor receptor-bound protein 10, GRB10 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  27  7WFHGRISREESHRIIKGLVDGLFLLRDSQSN-PKAFVLTLCHHQKIKNFQILPCEDDGQTDGNTKFSDLIQLVDFY 88
20 -36.400d4k44a1 d.93.1.1 (A:664-764) Phospholipase C-gamma-1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  32  5WYHASLTRAQAEHMLMRVPDGAFLVRKRNE--PNSYAISFRAEGKIKHCRV-QQEGQTVMLGNSEFDSLVDLISYY 78
21 -36.400d2oq1a2 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  30  31WYHSSLTREEAERKLYAQTDGKFLLRPRKE--QGTYALSLIYGKTVYHYLISQKAGKYCIPEGTKFDTLWQLVEYL 107
22 -35.000d3s9ka1 d.93.1.1 (A:5-110) automated matches {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  30  7WYNKSISRDKAEKLLLDTKEGAFMVRDSRT--PGTYTVSVFTNPCIKHYHIKETNKRYYVAEKYVFDSIPLLIQYH 90
23 -34.100d1mila_ d.93.1.1 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  31  9WFHGKLSRREAEALLQL--NGDFLVRESTTT-PGQYVLTGLQSGQPKHLLLVDPEGVVRT-KDHRFESVSHLISYH 80
24 -34.000d2kk6a1 d.93.1.0 (A:12-116) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  37  8WYHGAIPRIEAQELLKK--QGDFLVRESHGK-PGEYVLSVYSDGQRRHFIIQYVDNMYRF-EGTGFSNIPQLIDHH 79
25 -34.000d1i3za_ d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  23  5YYHGCLTKRECEALLKGGVDGNFLIRDSES-VPGALCLCVSFKKLVYSYRIFREKHGYYRTPRTIFPNLQELVSKY 86
26 -33.700d2ysxa1 d.93.1.0 (A:8-119) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  27  5WNHGNITRSKAEELLSRTKDGSFLVRASES-ISRAYALCVLYRNCVYTYRILPNEDDKFTVSMRFFTKLDQLIEFY 86
27 -33.700d1d4ta_ d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  27  6VYHGKISRETGEKLLATGLDGSYLLRDSES-VPGVYCLCVLYHGYIYTYRVSQTETGSWSVHKRYFRKIKNLISAF 87
28 -33.400d2eo6a1 d.93.1.0 (A:8-135) automated matches {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  27  18WYAGACDRKSAEEALHRNKDGSFLIRKSSGHDKQPYTLVAFFNKRVYNIPVRFIEATKQYNGEEYFGSVVEIVNSH 101
29 -31.600d1xa6a2 d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  33  37EFHGIISREQADELLGG-VEGAYILRESQRQ-PGCYTLALRFGNQTLNYRLFHDGKHF--VGEKRFESIHDLVTD. 107
30 -26.500d1bg1a3 d.93.1.1 (A:576-716) STAT3b {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  24  9YIMGFISKERERAILSTKPPGTFLLRFSESSKEG--GVTFTWVEKDISGSTQIQSVEPYTKQQLNNMSFAEIIMGY 82
31 -24.800d1uura3 d.93.1.1 (A:577-707) STAT homologue {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}  ali model 3D-neighbors follow..  19  11IIYGYMGRQEVNDALQNQDPGTFIIRFSER-NPGQFGIAYIMPARIKHYLVQPNDTAAAKKTPDFLSEHSQFVNLL 89

FFAS is supported by the NIH grant R01-GM087218-01
8 5 6 6 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Slabinski L, Jaroszewski L, Rychlewski L, Wilson IA, Lesley SA, Godzik A. XtalPred: a web server for prediction of protein crystallizability. Bioinformatics. 2007 Dec 15;23(24):3403-5. Epub 2007 Oct 5.