current user: public

Announcement: our server is upgraded to a faster system. If you experience any issues during this period please let us know.

Query: PF00017.19; P85B_BOVIN/326-401; SH2 domain, from PfamA26U

Results of FFAS03 search in SCOP175
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .
1 -49.600d1fu6a_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  84  13WYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKSIKIFHRDGKYGFSDPLTFNSVVELINHY 88
2 -46.500d1k9aa2 d.93.1.1 (A:77-177) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  28  6WFHGKITREQAERLLYPPETGLFLVRESTNY-PGDYTLCVSCEGKVEHYRIMYHASKLSIDEEVYFENLMQLVEHY 80
3 -45.200d1rpya_ d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  25  7WFHGTLSRVKAAQLVLARSHGLFVIRQSETR-PGECVLTFNFQGKAKHLRLSLNGHGQCHVQHLWFQSVFDMLRHF 84
4 -43.500d2shpa2 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  27  5WFHPNITGVEAENLLLTRVDGSFLARPSKSN-PGDLTLSVRRNGAVTHIKIQNTGDYYDLYGGEKFATLAELVQYY 80
5 -43.100d1jyra_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  27  5WFFGKIPRAKAEEMLSKRHDGAFLIRESESA-PGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYH 80
6 -43.000d2izva2 d.93.1.1 (A:274-385) Suppressor of cytokine signaling 4, SOCS-4 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  21  13CYWGVMDKYAAEALLEGKPEGTFLLRDSAQE-DYLFSVSFRRYSRSLHARIEQWNHNFSFDAHDHSPDITGLLEHY 91
7 -42.500d2eyva1 d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  28  2WYWGRLSRQEAVALLQGQRHGVFLVRDSSTS-PGDYVLSVSENSRVSHYIINSSGPRPPVIGDQEFDSLPALLEFY 93
8 -42.000d2c9wa2 d.93.1.1 (A:32-134) Suppressor of cytokine signaling 2, SOCS-2 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  34  17WYWGSMTVNEAKEKLKEAPEGTFLIRDSSHS-DYLLTISVKTSAGPTNLRIEYQDGKFRLDSIKQFDSVVHLIDYY 98
9 -41.600d1qada_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Cow (Bos taurus) [TaxId: 9913]}  ali model 3D-neighbors follow..  30  11WNVGSSNRNKAENLLRGKRDGTFLVRESSK--QGCYACSVVVDGEVKHCVINKATGYGFAEPYNLYSSLKELVLHY 85
10 -40.600d2cs0a1 d.93.1.1 (A:8-113) Hematopoietic SH2 domain containing protein HSH2D {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  28  11WFHGAISREDAENLLESQPLGSFLIRVSHSHVG--YTLSYKAQSSCCHFMVKLLDDGTFMGEKVAHTSLDALVTFH 86
11 -39.600d2oq1a1 d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  27  8FFYGSISRAEAEEHLKGMADGLFLLRQCLRS-LGGYVLSLVHDVRFHHFPIERLNGTYAIAGGKAHCGPAELCEFY 85
12 -39.100d1mila_ d.93.1.1 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  31  9WFHGKLSRREAEALLQ--LNGDFLVRESTTT-PGQYVLTGLQSGQPKHLLLVDPEGVVRT-KDHRFESVSHLISYH 80
13 -38.900d1bg1a3 d.93.1.1 (A:576-716) STAT3b {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  25  9YIMGFISKERERAILSTKPPGTFLLRFSESSKEGGVTFTWVEKDISGSTQIQSVE--PYTKQQLNNMSFAEIIMGY 82
14 -38.800d2oq1a2 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  30  31WYHSSLTREEAERKLYAQTDGKFLLRPRKE--QGTYALSLIYGKTVYHYLISQKAGKYCIPEGTKFDTLWQLVEYL 107
15 -37.500d1nrva_ d.93.1.1 (A:) Growth factor receptor-bound protein 10, GRB10 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  27  7WFHGRISREESHRIIKGLVDGLFLLRDSQSN-PKAFVLTLCHHQKIKNFQILPCEDDGQTDGNTKFSDLIQLVDFY 88
16 -37.000d2fcia1 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 9913]}  ali model 3D-neighbors follow..  31  11WYHASLTRAQAEHMLMRVRDGAFLVRKRNE--PNSYAISFRAEGKIKHCRVQQ-EGQTVMLGNSEFDSLVDLISYY 84
17 -36.900d1lkka_ d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  27  6WFFKNLSRKDAERQLLGNTHGSFLIRESEST-AGSFSLSVRDFDQVKHYKIRNDNGGFYISPRITFPGLHELVRHY 88
18 -36.400d1i3za_ d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  23  5YYHGCLTKRECEALLKGGVDGNFLIRDSESV-PGALCLCVSFKKLVYSYRIFREKHGYYRTPRTIFPNLQELVSKY 86
19 -36.000d1d4ta_ d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  28  6VYHGKISRETGEKLLLATLDGSYLLRDSESV-PGVYCLCVLYHGYIYTYRVSQTETGSWSVHKRYFRKIKNLISAF 87
20 -35.900d1xa6a2 d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  33  37EFHGIISREQADELLGG-VEGAYILRESQRQ-PGCYTLALRFGNQTLNYRLFHDGKHFV--GEKRFESIHDLVTDG 108
21 -34.100d1luia_ d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  30  8WYNKSISRDKAEKLLLDTKEGAFMVRDSRT--PGTYTVSVFTNPCIKHYHIKETNKRYYVAEKYVFDSIPLLIQYH 91
22 -33.100d1uura3 d.93.1.1 (A:577-707) STAT homologue {Dictyostelium discoideum [TaxId: 44689]}  ali model 3D-neighbors follow..  18  11IIYGYMGRQEVNDALQNQDPGTFIIRFSERN-PGQFGIAYIGPARIKHYLVQNDTAAAKKTFPDFLSEHSQFVNLL 89

FFAS is supported by the NIH grant R01-GM087218-01
6 1 2 3 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Jaroszewski L, Slabinski L, Wooley J, Deacon AM, Lesley SA, Wilson IA, Godzik A. Genome pool strategy for structural coverage of protein families. Structure. 2008 Nov 12;16(11):1659-67.