current user: public

Query: PF00015.19; MCPC_SALTY/326-514; Methyl-accepting chemotaxis protein (MCP) signalling domain, from PfamA30U

Results of FFAS03 search in SCOP206
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .
1 -6.520g1avo.1 a.24.8.1 (A:,B:) Proteasome activator reg(alpha) {Human (Homo sapiens) [TaxId: 9606]}  ali 3D-neighbors follow..  11  31...............................PKKISELDAFLKEPALNEANLSNLKAPLDIXAVNCNEKIVVLLQRLKPEIKDVIEQLNLVTTWLQLQIPRIEDGNNF-----AVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVL 185
2 -6.390d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  16  56............................VGKTTAALALARELFGENWRHNFLELNASDE--------RGINVIREKVKEFARTKPIGGASFKIIFLDEADALTQDA---QQALRRTMEMFSSNVRSSKIIEPIQSRCAIRDEDIAKRLRYIAENEGLELTEEGLQAILYIAEGDMRRAINILQAAAALD 218
3 -6.370d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  19  16...................................................VILNKRTTMPKDSGALLGLKVVGGKMTDLGRLGAFITKVKKGSLADVVGHLRAGDEVLEWNGKPLPG--ATNEEVYNIILESKSEPQVE................................................. 102
4 -5.950d3s1xa_ c.1.10.1 (A:) automated matches {Thermoplasma acidophilum [TaxId: 273075]}  ali model 3D-neighbors follow..  14.................................RTGVNWGIVDGVTTNPTLIS--------KEAVNGKKYGDIIREILKIVDGPVSVSTKYEGMVEEARKIHGLGDNAVVKIPMTEDGLRAHINTNCTLVFNPIQALLAAKAGVTYVSPFVGRLDDIGEDGMQIIDMIRTIFNNYIIKTQILVASI... 168
5 -5.950d2zska1 c.78.2.0 (A:1-114) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}  ali model 3D-neighbors follow..  13  4......................................IGIIGGTTPESTLYKYIEISREKFEKYFYPELIIYSINFKEFFQNPEGWEGRKKILINAAKALERAGAELIAFAANTPHLVFDDVQREVNVMVSIIDAVAEE................................................. 109
7 -5.720d1vima1 c.80.1.3 (A:2-183) Hypothetical protein AF1796 {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  16  1........................LRFLEVVSEHIKNLRNHIDLETVGEMIKLIDSARSIFVIGAGRSGYIA-----KAFAMRLMHLGYTVYVVGETVTPRITDQDVLVGISGSETTSVVNISKKAKDIGSKLVAVTGKRDSSLAKMADVVMVVKGKMKQERDEILSQLAPLGTMFELTAMI....... 154
8 -5.590d2nn6a2 d.101.1.1 (A:185-302) Exosome complex exonuclease RRP45 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  8....................ICVSFAFFQQGTYLLVDPNEREERVMDGLLVIAMNKHREICTIQSSG-GIMLLKDQVLRCSKIAGVKVAEITELILKALEN........................................................................................ 87
9 -5.320d1s35a2 a.7.1.1 (A:1169-1273) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  13  5..............................................FQKDAKQAEAILSNQEYTLAHLEPPDSLEAAEAGIRKFEDFLGSMENNRDKVLSPVDSGNKLVAEGNLYSDKIKEKVQLIEDRHRKNNEKAQEASVLLRD........................................... 104
10 -5.300d1j2ha_ a.7.8.1 (A:) ADP-ribosylation factor binding protein Gga1 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  1....................................................AANKLIKEMVQEDQKR------MEKISKRVNAIEEVNNNVKLLTEMVMSHSQGGAAAGSSEDLMKELYQRCERMRPTLFRLASDTEDNDEALAEILQANDNLTQVINLYKQLVR....................... 108

FFAS is supported by the NIH grant R01-GM087218-01
8 3 0 1 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ginalski K, Grishin NV, Godzik A., Rychlewski L. Practical lessons from protein structure prediction. Nucleic Acids Res. 2005 Apr 1;33(6):1874-91.