current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: PF00001.19; HRH2_CANLF/35-288; 7 transmembrane receptor (rhodopsin family), from PfamA30U

Results of FFAS03 search in SCOP206
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250
# Score Template Links and tools%idFirst GNVVVCLAVGLNRRLRSLTNCFIVSLAITDLLLGLLVLPFSAFYQLSCRWSFGKVFCNIYTSLDVMLCTASILNLFMISLDRYCAVTDPLRYPVLITPVRVAVSLVLIWVISITLSFLSIHLGWNSRNETSSFNHTIPKCKVQVNLVYGLVDGLVTFYLPLLVMCITYYRIFKIARDQAKRIHHMGSWKAATIGEHKATVTLAAVMGAFIICWFPYFTVFVYRGLKGDDAINEAFEAVVLWLGYANSALNPILYLast
1 -126.000d2rh1a1 f.13.1.3 (A:29-230,A:263-342) Beta2-adrenergic GPCR {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  37  22GNVLVITAIAKFERLQTVTNYFITSLACADLVMGLAVVPFGAAHILMKMWTFGNFWCEFWTSIDVLCVTASIETLCVIAVDRYFAITSPFKYQSLLTKNKARVIILMVWIVSGLTSFLPIQMHWYRATHQENCYAEETCCDFFTNQAYAIASSIVSFYVPLVIMVFVYSRVFQEAKRQLXKFC---------LKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQDN-LIRKEVYILLNWIGYVNSGFNPLIY 267
2 -105.000d3emla1 f.13.1.4 (A:3-208,A:222-310) Adenosine A2A receptor {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  29  21GNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITIST--GFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGC-DVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLXRST--------LQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCHAPLWLMYLAIVLSHTNSVVNPFIY 274
3 -58.600d2g87a_ f.13.1.2 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}  ali model 3D-neighbors follow..  17  54INFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLEGFFATLGGEIALWSLVVLAIERYVVVCKPMS-NFRFGENHAIMGVAFTWVMALACAAPPLV-GWSRYIPEGMQCSCYTPHEETNNESFVIYMFVVHFIIPLIVIFFCYGQLVFTVKEAAAQQQESAT---TQKAEKEVTRMVIIMVIAFLICWLPYAGVAFYIFTHQGSDFGPIFMTIPAFFAKTSAVYNPVIY 306
4 -5.820d2gtta1 a.260.1.1 (A:6-448) Nucleoprotein {Rabies virus [TaxId: 11292]}  ali model 3D-neighbors follow..  136..VGLLLSLYRLSKISGQNTGNYKTNIADRIEQIFETAPFVKIVEMCANWSTIPNFRFLAGTYDMFFSRSAIRVGTVVTAYEDCSGLVSFTGFIKQINLTAREAILYFFHKNFEEEIRRMFEPGQETAVPHSYFIHFRSLGLSGKSPYSSNAV----------HVFNLIHFVGCYMGQVRSLNATVIAACAPHEMSVLGGYLGEEFF............................................... 345
5 -5.780d1vf8a2 d.26.3.1 (A:246-315) Chitinase-like lectin ym1 {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  14  1.......................................................................................................................................................................YGHTFILSDPSKTGIGAPTISTGPPGKYTDESGLLAY----YEVC----FLNEGATEVWDAPQEVPYAYQGNEWVGY.......... 70
6 -5.760d2qvja_ a.260.1.1 (A:) Nucleoprotein {Vesicular stomatitis indiana virus [TaxId: 11277]}  ali model 3D-neighbors follow..  134..PLYLLGLYRVGRTQMPEYRKKLMDGLTNQCKMIFEPLVPEGRDIFDVWGNDSNYTKIVAAVDMFFHMFKKHECASFRYSRFCAALATFGHLCKITGMSTEDVTTWILNREVADEMVQMMLPGQEIDKADSYMPYLIDFGLSSKSPYWSVKN-----------FHFWGQLTALLLRSTRARNARQPDDIEYTSLTTAGLLYAYAVGSSADLAQQFCVGDNKYT--LTTNAPPQGRDVVEWLGWFED....... 383
7 -5.510d1olza3 g.16.2.1 (A:481-536) Semaphorin 4d {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  19  1.......................................................FCGKHGTCE-----------CVLARDPYCA-----------------------WSPPTATCVALHQTESPSRGLIQEMSGDASVC.................................................................................................................. 52
8 -5.090d2grea1 b.49.3.1 (A:74-186) Deblocking aminopeptidase YhfE {Bacillus cereus [TaxId: 1396]}  ali model 3D-neighbors follow..  11  24............................................................................................................................................NSVEGEYCEIETSSGKTYTGTILMHQTSVHVYKDAGEAKRDEKNIEVRIDERVFSADEVRELGIEVGDFVS........................................... 94
9 -4.840d1f5qb1 a.74.1.1 (B:6-146) Viral cyclin {Murine herpesvirus 68 [TaxId: 33708]}  ali model 3D-neighbors follow..  13  45.KVLTTWMFCVCKDLRQDNNVFPLAVALLDELFLSTRIDRENYQST---------------AAVALHIAGKVRAYMPIKATQLAYLCGGATTADKLLTLEVKSLDTLSWVAD.............................................................................................................................................. 140
10 -4.780d3hz2a_ b.11.1.0 (A:) automated matches {Methanosarcina acetivorans [TaxId: 2214]}  ali model 3D-neighbors follow..  5........................................................................................................................................................................VIVYEHVNFGGKSFDATSDQPGAGDNLNDKISSIKVKSGTWRFYEYINY..................................... 53

FFAS is supported by the NIH grant R01-GM087218-01
9 8 9 2 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Jaroszewski L, Godzik A. Sequence clustering strategies improve remote homology recognitions while reducing search times. Protein Eng. 2002 Aug;15(8):643-9.