current user: public




PF14353
Query: PF14353.1; C7N3B9_SLAHD/13-141; CpXC protein, from PfamA26U

Results of FFAS03 search in PfamA26U
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .
# Score Template Links and tools%idFirst QVKCPSCSHPGSVEVWPIITSTTDERAMELVLNGRLFEHVCPACGKKVAVAYDCLLHDVEHRAFLLYTTKENPEVTGPHRLMDARDALRAKSQNVDNYQLRLALTTFEFCEKVRIWHDGYDDRAIELMKLast
1 -71.000PF14353.1; C7N3B9_SLAHD/13-141; CpXC protein  ali  100  1QVKCPSCSHPGSVEVWPIITSTTDERAMELVLNGRLFEHVCPACGKKVAVAYDCLLHDVEHRAFLLYTTKENPEVTGPHRLMDARDALRAKSQNVDNYQLRLALTTFEFCEKVRIWHDGYDDRAIELMK 129
2 -12.900PF13542.1; B2SSB8_XANOP/29-93; Helix-turn-helix domain of transposase family ISL3  ali follow..  15  6..VCTACGSDRLIGHGRNEQVVRDLPTKRLAIYVDTRRWRCQSCGKTFMEPLPAV.......................................................................... 60
3 -12.500PF05605.7; DI193_ARATH/10-218; Drought induced 19 protein (Di19)  ali follow..  13  34EFACPFCSDYFDIVLCCHIDEDHPMEAKNGV---------CPVCAVR-------VGVDMVAHITLQHANIFKMHRKRKPRRGGSYSTLSILRREFPDGNFQSLFGGSSCIVSSSSSSNVAADPLLSSF. 146
4 -12.500PF09986.4; Q04ZY0_LEPBL/15-282; Uncharacterized protein conserved in bacteria (DUF2225 topsan)  ali follow..  20  5DTVCPICNEVHQKEN-RLIAGKLTIELRRLYEKNKYVISVCPRCLYSS................................................................................. 66
5 -11.800PF09845.4; A2SRG8_METLZ/2-124; Zn-ribbon containing protein (DUF2072 topsan)  ali follow..  21  3..KCTKCGREF-------------RDGSVEILRG------CPSCGGK-----KFLYVSDR--------VKNADVLEEKSIEKIAEETEQEVLEVKHQGPATRPTDILERVESVRIVSKGSYELNLERL. 96
6 -11.100PF03367.8; ZPR1_YEAST/292-453; ZPR1 zinc-finger domain  ali follow..  14  1RASCPSCTQECETH----MKPVNIPHFKEVI----IMSTVCDHCGYKSNVKTGGAIPDKGRRITLYCDDAADLSRDILKSETCSMVIPELHLDIQEGTLGGRFTTLEGLLRQVY............... 107
7 -10.700PF05876.7; Q8ZQH1_SALTY/36-646; Phage terminase large subunit (GpA)  ali follow..  13  214.WPCPHCGDWFQPAMENMVGYRDNPDLMAA---SEAARIQCPHCRA--------LIQPEQKRGLN---NRGVWLKEGQFINKDGEISGEARRSRIASFWMEGPATWQQLVYKLLTAEEEYERT...... 325
8 -10.600PF10601.4; LITAF_CHICK/74-147; LITAF-like zinc ribbon domain  ali follow..  31  7QMSCPSCNQMIVTRLCYESGALTWLSCGGLFLLGCIAEHFCPNCNAHV................................................................................. 69
9 -10.300PF12756.2; Q2ULX1_ASPOR/130-229; C2H2 type zinc-finger (2 copies)  ali follow..  11  1..RCLFCNEKSSMFIPEKDYLVDLEGLVHYLYRKINENSECLYCHAVRNNPEGARTHMRDKG................................................................... 74
10 -10.200PF07191.7; Q5PNI5_SALPA/2-71; Protein of unknown function (DUF1407 topsan)  ali follow..  22  1EIICPVCHHA--------LERNGDTAHCETCAKDFSLQALCPDCRQPL................................................................................. 40
11 -10.200PF15616; A4NEX6.1/218-345; TerY-C metal binding domain  ali follow..  20  75...CPHCGAAFGLCM----------NCGQIFCANGEKEVVCPGCNETLYFN.............................................................................. 113
12 -10.100PF08882.6; Q0RWI2_RHOSR/3-111; Acetone carboxylase gamma subunit  ali follow..  16  15QWVCRVCDHELNYKEGTLVYDRDPREIHQAIIDPDILEFYCPGCGTQMETEYVPPGHPPTVDMIW................................................................ 98
13 -9.920PF15499; G5B267.1/224-496; Ubiquitin-specific peptidase-like, SUMO isopeptidase  ali follow..  133EFECSQCGHRYQ-NRCVKNLVTFTNVIPEWHPLNAAHFGPCNSCSSK----------SQRRKMVLERMSP----------IFMLHFVEGLPRSDLQHYAFHFEGCLYQITSVIQYQANDCDDLKGLCAQ 255
14 -9.850PF13719.1; Q3A1H3_PELCD/1-37; zinc-ribbon domain  ali follow..  25  3.VQCPDCASRFRLA--------------DEKLKPGGTKVRCSKCQKIFTV............................................................................... 37
15 -9.730PF06750.8; Q3M8U1_ANAVT/15-100; Bacterial Peptidase A24 N-terminal domain  ali follow..  19  29..RCPHCLNQ--LKAYDNV----------PVLGWIWLKGRCRYCKSQISLRYPVV.......................................................................... 69
16 -9.700PF09855.4; Q03AT4_LACC3/6-69; Nucleic-acid-binding protein containing Zn-ribbon domain (DUF2082 topsan)  ali follow..  18  2..VCPKCQNT-AYVADQFQATGGNFSKIFDVQNKKFVTISCTRCGYT.................................................................................. 45
17 -9.620PF09779.4; Q873E2_NEUCR/10-137; Uncharacterized conserved protein (DUF2349 topsan)  ali follow..  1.LTCFYCGRKTSTP-----------------WNSSIRNFECRNCDATNYLDGNGDITDPPVATEYEASPAKFATTRATSPTVGSSSASVFCNKCLANQDKLRAVEYEERCRNIYKFRRLQERLYPQMCA 122
18 -9.420PF12660.2; Q2TY38_ASPOR/186-283; Putative zinc-finger of transcription factor IIIC complex  ali follow..  13  16..QCTICDAGLSWYSAVEAQCAAGHLFVRCGVTFLAIQKFCSRCGTEY................................................................................. 66
19 -9.390PF09788.4; T55BB_DANRE/1-255; Transmembrane protein 55A  ali follow..  17  156RVSCGHCAKTFLWTEF------------------DRTLARCPHCRKVSSIGQRYPRKR....................................................................... 196
20 -9.160PF09538.5; A0P3S8_9RHOB/1-112; Protein of unknown function (FYDLN_acid)  ali follow..  25  9KRLCPSCGAKY-------YDLNRNP-------------ITCPKCGTVFEAV.............................................................................. 39
21 -9.140PF05129.8; Q2GW55_CHAGB/2-75; Transcription elongation factor Elf1 like  ali follow..  24  21TFTCLFCNHEKSVEV-------------KLDKKAGCGRLECKICGQRFQCGINYVYSE....................................................................... 65
22 -9.100PF13717.1; Q3A1H3_PELCD/1-36; zinc-ribbon domain  ali follow..  23  3.VQCPDCASRFRLA--------------DEKLKPGGTKVRCSKCQKIFT................................................................................ 36
23 -9.080PF06524.7; ZN330_DROME/1-313; NOA36 protein  ali follow..  20  172..KCQSCNKLGQYSCLRCKTCYCEDHVRRKGFKYD---IPCPKCNYDTSVTKDLSMSTRSHK................................................................... 232
24 -9.020PF05495.7; A7TR54_VANPO/18-100; CHY zinc finger  ali follow..  14  49VILCGVCKYAMTFDEYRNSEFCDSK-------------LSCPKCHAHF................................................................................. 83

FFAS is supported by the NIH grant R01-GM087218-01
6 2 7 7 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Grynberg M, Li Z, Szczurek E, Godzik A. Putative type IV secretion genes in Bacillus anthracis. Trends Microbiol. 2007 May;15(5):191-5. Epub 2007 Mar 26.