current user: public




Query: PF14353.4; R6EE02_9BACE/9-141; CpXC protein, from PfamA30U

Results of FFAS03 search in PfamA30U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130
# Score Template Links and tools%idFirst VTCSQCGKEHDIQTYPNINVKESPELKARIKDGTLFLWTCPDCGQVNLAPYQTLYHDPDEKVMIWLTPNSMSFSERALVDSHIQAIAGQLAEDKSGELLRGYALRRVKEAGELIEKVNIFDAGLDDIAMEMCKLast
1 -71.000PF14353.4; R6EE02_9BACE/9-141; CpXC protein  ali  100  1VTCSQCGKEHDIQTYPNINVKESPELKARIKDGTLFLWTCPDCGQVNLAPYQTLYHDPDEKVMIWLTPNSMSFSERALVDSHIQAIAGQLAEDKSGELLRGYALRRVKEAGELIEKVNIFDAGLDDIAMEMCK 133
2 -12.200PF09986.7; Q898V4_CLOTE/16-227; Uncharacterized protein conserved in bacteria (DUF2225 topsan)  ali follow..  12  6IHCPVCDSKFHVKAVKSSSYSKDSDFFLRYALINPYFYLCNECGYSA...................................................................................... 58
3 -11.800PF09845.7; A2SRG8_METLZ/2-123; Zn-ribbon containing protein  ali follow..  19  3.KCTKCGREF-------------RDGSVEILRG------CPSCGGK----------------KFLYVSDRVKNADVLEEKSIEKIAEETEQEVLEVKHQGPATRP--TDILERVESVRIVSKGSYELNLERL. 96
4 -11.400PF10083.7; Q3A032_PELCD/5-158; Uncharacterized protein conserved in bacteria (DUF2321 topsan)  ali follow..  13  39.ACPSCGSNIRGHYHVPGVISFSNFHAPSY---------CFNCGSPYPWTAIRL---EAAAELADELDGLTTDEKEKLKSSLPDLVKDGPKTVVAETRFKKIIKKAGADAYEGMKTILV------DVVSETVK 152
5 -10.800PF15616.4; Q5NWS3_AROAE/221-349; TerY-C metal binding domain  ali follow..  20  76.GCPHCGNRFGLAM----------GCGQIFCVSGTGEATCPGCNQTVVMG................................................................................... 115
6 -10.600PF03367.11; G0RL10_HYPJQ/42-197; ZPR1 zinc-finger domain  ali follow..  11  2.LCMNCHKNGITR----LLLTQIPYFREVV----IMSFSCDHCNFQNNIQPAGTIQPKGTHYELRLTDLADFSRQVVKSDTATVKFIEIDLEIPAGRGQLTNVEGLLTGVVDDLEMGQEERKEKAPEVYEKVA 126
7 -10.400PF04032.14; C1H166_PARBA/21-185; RNAse P Rpr2/Rpp21/SNM1 subunit domain  ali follow..  11  123..CKLCDSLLIPNATCVERTENFSR-SKKKPWADVRVVRCNSCG......................................................................................... 165
8 -10.300PF17032.3; J9D3W3_EDHAE/30-102; zinc-ribbon family  ali follow..  16  1VLCDKCGNRINAVYRRNDYYFSICFLNLFRISKGTPYLSCNYCEASFGGH................................................................................... 50
9 -10.200PF13695.4; G3GT94_CRIGR/49-160; Zinc-binding domain  ali follow..  17  6FLCSICDRYWSAQVKILCHLYREPGKSQGQVLMRIFGQRCQKCTR........................................................................................ 51
10 -9.940PF10601.7; G2QUW3_THITE/67-133; LITAF-like zinc ribbon domain  ali follow..  12  6IDCPFCHRRTLTRVSKEGTSMQ-PCLAGWFEETI---YVCTQCNKKV...................................................................................... 65
11 -9.930PF06676.9; S5XXI8_PARAH/1-135; Protein of unknown function (DUF1178 topsan)  ali follow..  7....RCDQGHDFDGWFRSSEGFESLRTAGQVS-------CALCGSIRALMAPNVATRAATAPDLQSPQTEQEKALADLRRQVEENSDMSFAAEARAMHDGTKPERAIHGEAKLEDARKLLEDGIPVAPLPFT. 133
12 -9.860PF09855.7; R6QWZ3_9FIRM/11-73; Nucleic-acid-binding protein containing Zn-ribbon domain (DUF2082 topsan)  ali follow..  13  1.VCPKCGCN-SYEHDQFQATGGNFAKIFDVQNKKFITISCTRCGFT....................................................................................... 44
13 -9.820PF09538.8; B9JYL9_AGRVS/1-108; Protein of unknown function (FYDLN_acid)  ali follow..  20  11.TCPDTGKKF-------YDLNNDP-------------VVSPYTKKSWPLS................................................................................... 39
14 -9.750PF09788.7; T55BB_DANRE/3-255; Transmembrane protein 55A  ali follow..  24  155VSCGHCAKTFLWTEFTDRTL-----------------ARCPHCRKVSSIG................................................................................... 187
15 -9.620PF09779.7; G4UUQ1_NEUT9/10-137; Ima1 N-terminal domain  ali follow..  14  1LTCFYCGRKTSTP-----------------WNSSIRNFECRNCDATNYLDGNGDITDPEASPAKFATTRATSPTVGSSSASVFCNKCLANQDKLRAVLAQYLPDPDDSEYEERCRNIYKFRRLQERLYPQMCA 122
16 -9.570PF09862.7; E3GNG2_EUBLK/8-121; Protein of unknown function (DUF2089 topsan)  ali follow..  11  1..CPVCGGRLKAV-----------------------KLQCENCDTAIENDFCLYLSAEDLFFAETFLVCRGNIKEVEKRLKISYPTVRSRLDGIIEKLGGKPESPPSVSEARKKEILDALENG--EEALEQMK 114
17 -9.550PF12773.5; A4H9B2_LEIBR/373-437; Double zinc ribbon  ali follow..  17  15..CGTCGQPVQGA-----PSHRRTPGGTNEGVSTARRLVCPACEALSDADGNF................................................................................ 60
18 -9.520PF15499.4; G5B267_HETGA/225-496; Ubiquitin-specific peptidase-like, SUMO isopeptidase  ali follow..  12  133FECSQCGHRYQNRCVKNLVTFTNVIPEWHPLNAA-HFGPCNSCSSKSQRRK--MVLERMSPIFMLHFVEGLPRSDLQHYAFHFEGCLYQITSVIQYQANDHFITWNLHADGSWLE--------CDDLKGLCAQ 254
19 -9.420PF05876.10; Q8ZQH1_SALTY/36-646; Phage terminase large subunit (GpA)  ali follow..  214WPCPHCGDWFQPAMENMVGYRDNPDLMAA---SEAARIQCPHCRA--------LIQPEQKRGLNNRGVWLKEGQFINKDGEISGEARRSRIASFWMEGPAAAYQTWQQLVYKLLTAEEEYERTGSEETLKAV. 334
20 -9.380PF04502.11; H2UVM9_TAKRU/1-347; Family of unknown function (DUF572 topsan)  ali follow..  12  41MRCKTCGE---IYKGKKFNARKETVQNQLYLGLPIFRFKCTRCLAEITFKT-----DPENTDYAMEHGATRNFQAEKLIEEEEKRIQQEREDEELNNPMKVLENRTKDSKMEMLQELKELNQRQARVDFEGMI 173
21 -9.220PF06750.11; F8A8U1_THEID/14-97; Bacterial Peptidase A24 N-terminal domain  ali follow..  26  29.RCPHCKSP--IKWYDNI----------PILSFLWLRGRCRNCGGQISWRYPLV............................................................................... 69
22 -9.080PF05129.11; D5G8G1_TUBMM/90-168; Transcription elongation factor Elf1 like  ali follow..  19  23FMCLFCNNQDTVAC-------------VLDKKAGIGSLSCRACGQRFKMNINYLSAPID.......................................................................... 68
23 -9.060PF13435.4; C7LUU2_DESBD/35-108; Cytochrome c554 and c-prime  ali follow..  15  1.ACKDCHEEQYENFTKYAKKSHSDRSVKIMASDLTEAATCYGCHAT....................................................................................... 45
24 -9.020PF13719.4; A1AJZ4_PELPD/1-37; zinc-ribbon domain  ali follow..  17  3IQCEQCRTKFRLD--------------DSKIKENGVKVRCAKCRHVFTV.................................................................................... 37
25 -9.000PF11023.6; Y906_OCEIH/6-116; Zinc-ribbon containing domain  ali follow..  24  68VICPSCEKPTKM------------------------VDACMHCKQPLTMDKNLEGIEFDEKY....................................................................... 108

FFAS is supported by the NIH grant R01-GM087218-01
8 5 9 5 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ma H, Xiong H, Liu T, Zhang L, Godzik A., Zhang Z. Aggregate formation and synaptic abnormality induced by DSCR1. J Neurochem. 2004 Mar;88(6):1485-96.