current user: public

Query: PF13555.1; Q0A6A1_ALHEH/19-80; P-loop containing region of AAA domain, from PfamA26U

Results of FFAS03 search in PfamA26U
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60
1 -43.300PF13555.1; Q0A6A1_ALHEH/19-80; P-loop containing region of AAA domain  ali  100  1LQRLEVFNWGTFHDRVWSLQPGGDNSLLTGDIGSGKSTLVDAITTLLVPAQRITYNKAAGAE 62
5 -20.100PF11398.3; Q6D3T4_ERWCT/1-377; Protein of unknown function (DUF2813 topsan)  ali follow..  29  3LESIEILGFRGINRLSLTLD---ENNVLIGENAWGKSSLLDALSLLLAPTLPLY........ 53
6 -18.300PF13175.1; A9A6W0_METM6/4-391; AAA ATPase domain  ali follow..  18  1LTKFRIKNYKSIKDSGDVYLSPDNITILAGMNESGKTSVLEALEDFNVGKTVRE........ 54
7 -13.000PF13304.1; B1HP30_LYSSC/55-363; AAA domain  ali follow..  42  2.........................AFIFGPNGSGKSNLFTALKVL................ 22
8 -13.000PF13166.1; Q63PW4_BURPS/9-780; AAA domain  ali follow..  22  1.......SFGCFSDHGNNVAKFKKMNVIYGRNYSGKTTLSRIIRSLETGSISPRYASPSFS. 63
9 -12.700PF13401.1; B2UJB3_RALPJ/42-210; AAA domain  ali follow..  21  1...................DSQESILLVCGPTGAGKTTLAKFMVENAHSQSHAEMELNAG.. 41
10 -12.000PF04275.9; A4IGD4_DANRE/12-127; Phosphomevalonate kinase  ali follow..  25  1...........................FSGKRKSGKDYVTDLIQKRLTAEICCILRLSA... 32
11 -11.900PF07931.7; Q98FG2_RHILO/59-238; Chloramphenicol phosphotransferase-like protein  ali follow..  32  1......................ARIVLLNGVGSAGKSSIARALQTIT............... 25
12 -11.100PF04665.7; A7XCQ5_9POXV/6-246; Poxvirus A32 protein  ali follow..  33  16.........................LALVGGSGSGKTAYLLSL................... 33
13 -11.100PF13207.1; B2WP20_PYRTR/6-173; AAA domain  ali follow..  39  1........................IIGLYGISGSGKSYLLNHVKTEI............... 23
14 -11.000PF13521.1; A4CIV1_ROBBH/14-173; AAA domain  ali follow..  33  3..........................VLFGPESTGKTTLARELA.................. 20
15 -10.700PF03266.10; NTPTH_METS5/13-164; NTPase  ali follow..  26  2.........................LFITGRPGVGKTTLIKGLVSELRELKIAGF....... 31
16 -10.600PF00519.12; VE1_RHPV1/186-616; Papillomavirus helicase  ali follow..  18  261......................KNCIVLFGPPNTGKSYFGMSLIHFLQGSIISYVNSNSH.. 298
17 -10.600PF13671.1; B2JHT3_BURP8/20-178; AAA domain  ali follow..  30  1........................LVFICGHAGTGKTTLAKRLIGPL............... 23
18 -10.400PF08298.6; YEAG_ECOLI/19-380; PrkA AAA domain  ali follow..  19  72.........SYLKHAAQGLEEKKQILYLLGPVGGGKSSLAERLKSLMQLVPIYVLS...... 118
19 -10.200PF00910.17; A7M6L1_9SECO/473-576; RNA helicase  ali follow..  25  2..........................YAYGESRTGKTLVVDKLITDFQNH............ 25
20 -10.100PF03205.9; Q9FLE2_ARATH/115-230; Molybdopterin guanine dinucleotide synthesis protein B  ali follow..  35  3.........................VIIVGDIDSGKSTLAKMLLNWAVKDGWK......... 30
21 -10.100PF06414.7; Q8P580_XANCP/35-230; Zeta toxin  ali follow..  34  13.....................HPKAIILAGQPGSGKGSLARAAD.................. 35
22 -9.950PF13238.1; A5UL64_METS3/4-148; AAA domain  ali follow..  44  2..........................VLTGIPGSGSTTLLNKAL.................. 19
23 -9.720PF09818.4; Q2C6W1_9GAMM/1-438; Predicted ATPase of the ABC class  ali follow..  34  230..................MGIPEGITLIVGGGFHGKSTLLSAIE.................. 255
24 -9.580PF10662.4; A5ZM04_9FIRM/1-141; Ethanolamine utilisation - propanediol utilisation  ali follow..  33  5..........................FLMGRSEAGKTSLTQALK.................. 22
25 -9.530PF10443.4; Q5B2U3_EMENI/373-791; RNA12 protein  ali follow..  33  17......................ETFIVIHGPRGSGKRELVLDR................... 37
26 -9.480PF08303.6; Q6CK12_KLULA/389-554; tRNA ligase kinase domain  ali follow..  30  1........................LLVTIATIGCGKSTVSLTLN.................. 20
27 -9.450PF01057.12; Q7TG44_9VIRU/193-485; Parvovirus non-structural protein NS1  ali follow..  16  135......................RNTLWLFGHATTGKTNIAEAIAHAVPFYGCVNWTNEN... 171
28 -9.340PF13479.1; Q4EAN1_9RICK/15-248; AAA domain  ali follow..  26  1....................ISTVKMVIFGPYGIGKTSLLKTI................... 23
29 -9.330PF03193.11; RSGA_STRA5/122-274; Protein of unknown function, DUF258 topsan  ali follow..  33  26....................LANKVTVFMGQTGVGKSTLLNKIA.................. 49
30 -9.280PF04548.11; Q8R379_MOUSE/9-219; AIG1 family  ali follow..  47  4..........................VLVGKTGSGKSATANTI................... 20
31 -9.120PF01591.13; F262_BOVIN/27-250; 6-phosphofructo-2-kinase  ali follow..  21  15........................LIVMIGLPARGKTYVSKKLTRYL............... 37
32 -9.050PF04670.7; Q9VHJ4_DROME/4-230; Gtr1/RagA G protein conserved region  ali follow..  25  3..........................LLMGKSGSGKTSMRSIIFANYIARDTTRLGAT.... 34
33 -9.040PF13514.1; B5J9R5_9RHOB/33-1144; AAA domain  ali follow..  22  1...........................IYGPNEAGKTTTMEAALRLFYGFPLRE........ 27
34 -9.040PF13086.1; B6HQI4_PENCW/1305-1589; AAA domain  ali follow..  29  16.....................NDAFTLIQGPPGSGKTTITALVGSLLSDVLGKQVVKVNGAP 57

FFAS is supported by the NIH grant R01-GM087218-01
5 7 1 1 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ye Y, Godzik A. FATCAT: a web server for flexible structure comparison and structure similarity searching. Nucleic Acids Res. 2004 Jul 1;32(Web Server issue):W582-5.