current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: PF13555.4; Q0A6A1_ALKEH/19-80; P-loop containing region of AAA domain, from PfamA30U

Results of FFAS03 search in PfamA30U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60
1 -45.700PF13555.4; Q0A6A1_ALKEH/19-80; P-loop containing region of AAA domain  ali  100  1LQRLEVFNWGTFHDRVWSLQPGGDNSLLTGDIGSGKSTLVDAITTLLVPAQRITYNKAAGAE 62
4 -17.700PF11398.6; Q6D3T4_PECAS/1-377; Protein of unknown function (DUF2813 topsan)  ali follow..  30  3LESIEILGFRGINRLSLTLD---ENNVLIGENAWGKSSLLDALSLLLAPTLP.......... 51
6 -16.600PF13514.4; D8PEH4_9BACT/1-216; AAA domain  ali follow..  26  3LARLLLFAFGPFTNKTLDFS-SSSLHVIYGPNEAGKSSALRAMTDLRFG............. 52
7 -16.100PF13175.4; I1YS32_PREI7/1-378; AAA ATPase domain  ali follow..  17  3ISKLKLKNFRSYRSVEISFE---NLTAFIGRNDIGKSTILEALDIFFNEGKGVV........ 53
8 -10.900PF07931.10; Q98FG2_RHILO/59-238; Chloramphenicol phosphotransferase-like protein  ali follow..  32  1......................ARIVLLNGVGSAGKSSIARALQTIT............... 25
9 -10.400PF13304.4; A0ZCH2_NODSP/23-347; AAA domain, putative AbiEii toxin, Type IV TA system  ali follow..  42  2.........................TLLIGNNNSGKSNLLTGIQHF................ 22
10 -10.200PF08298.9; YEAG_ECOLI/19-380; PrkA AAA domain  ali follow..  19  72.........SYLKHAAQGLEEKKQILYLLGPVGGGKSSLAERLKSLMQLVPIYVLS...... 118
11 -10.100PF13401.4; B2UJB3_RALPJ/42-210; AAA domain  ali follow..  28  1...................DSQESILLVCGPTGAGKTTLAKFMV.................. 25
12 -9.620PF04275.12; F8W4R0_DANRE/22-132; Phosphomevalonate kinase  ali follow..  25  1...........................FSGKRKSGKDYVTDLIQKRLTAEICCILRLSA... 32
13 -9.540PF13245.4; B1YJE6_EXIS2/332-475; AAA domain  ali follow..  22  1............QREAIELAVKAPLMVLTGGPGTGKTTVIKGILHALQEIHDWPLEKSQVKS 50
14 -9.500PF10662.7; A6TJW6_ALKMQ/1-140; Ethanolamine utilisation - propanediol utilisation  ali follow..  38  5..........................ILVGRTGSGKTSLSQRLN.................. 22
15 -9.470PF05049.11; Q9DCE9_MOUSE/50-412; Interferon-inducible GTPase (IIGP)  ali follow..  35  39..........................AVTGDSGNGMSSFINALRFI................ 58
16 -9.390PF04665.10; Q6TUP8_YMTV5/6-246; Poxvirus A32 protein  ali follow..  28  17..........................ALVGGSGSGKTAYLLSLFNTF............... 37
17 -9.190PF03266.13; NTPTH_METAC/3-167; NTPase  ali follow..  29  2.........................IAVTGSPGVGKSTVVAKTAEKLAEKPGFKIGGIRTAE 38
18 -9.100PF04670.10; Q9VHJ4_DROME/4-230; Gtr1/RagA G protein conserved region  ali follow..  25  3..........................LLMGKSGSGKTSMRSIIFANYIARDTTRLGATIDVE 38
19 -9.070PF00519.15; VE1_BPV5/184-617; Papillomavirus helicase  ali follow..  18  262......................KNCLAFIGPPDTGKSLFTNSLMSFLKGKVLNFANSASH.. 299

FFAS is supported by the NIH grant R01-GM087218-01
1 0 8 9 2 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ginalski K, Grishin NV, Godzik A., Rychlewski L. Practical lessons from protein structure prediction. Nucleic Acids Res. 2005 Apr 1;33(6):1874-91.