current user: public




PF13481
Query: PF13481.1; Q7U700_SYNPX/79-275; AAA domain, from PfamA26U

Results of FFAS03 search in PfamA26U
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .
# Score Template Links and tools%idFirst TARANLRGESEGISPDDVFKIPEERWLAQDLIAARTLTLVVALQKVGKSAVVCNILGELAKGRGEFLERFSLAPPCPKVIIVGTDQPLADWREVMVPNGLMIRTDLDNYRVCDPVVRLYTREHGLHLDEAGIEKITADCEQNPWAVLVLDAFLSLIGPLGLDSDSDAAVQPLQNLLESIAPFNITTVLLHHSSKSRALast
1 -88.700PF13481.1; Q7U700_SYNPX/79-275; AAA domain  ali  100  1TARANLRGESEGISPDDVFKIPEERWLAQDLIAARTLTLVVALQKVGKSAVVCNILGELAKGRGEFLERFSLAPPCPKVIIVGTDQPLADWREVMVPNGLMIRTDLDNYRVCDPVVRLYTREHGLHLDEAGIEKITADCEQNPWAVLVLDAFLSLIGPLGLDSDSDAAVQPLQNLLESIAPFNITTVLLHHSSKSRA 197
2 -29.200PF06745.8; O29463_ARCFU/20-274; KaiC  ali follow..  11  15.................EKEGDRYVRKPLGGIPHLAVMNITGVPDTGKSLLAEQFAITAGSGYR--------------VLYVTVESPANFLYTAMKERSEAMGVDFTKVESNVVVIDASESDELRENPKALMETMAYAIKEKKVTNTIIDSITGLY-----EHKEMMARQIVRQFFNFMKKYRQTGIFVSQKRSAQ. 175
3 -25.900PF08423.6; Q7Z9J0_PICAN/100-360; Rad51  ali follow..  15  30.....................KQLDTLLGGGIETGAITEVFGEFRTGKSQLCHTLAVTCQLPID-------NGGGEGKCLYIDTEGTFRP--IRLVAIARRFGLDENETLDNVAYARAYNADHQLQL----LHQAASMMTESRFSLLIVDSIMALYGRGELSARQMHVAKFMRTLQRLADEFGIAVVITNQVVAQ.. 195
4 -24.600PF07088.6; GVPD1_HALSA/23-536; GvpD gas vesicle protein  ali follow..  13  1...........................LSQFFDAGETLLINGAPGTGKTLFTIRGLDVLDRDSD--------------VLYVSTRVDQETVHEMYFADHSSLDTTAILDLFQDPFELPLDVDVPFE--DSLLEWIQEINAATTQLTIAFDSWELIYEYAVRHDDPPDIKTVTNQLAVLAREENIRLMLVTETAAPSS 161
5 -22.100PF13401.1; B2UJB3_RALPJ/42-210; AAA domain  ali follow..  14  2................................SQESILLVCGPTGAGKTTLAKFMVENAHSQSHAEMELNAGVIPAIYVQAPASGETKFSWRLFYQRILNQLGDDLDSPKVAYGVDSLSGRGTSGNSLAALRTAVERGLRARQVQFMVIDEAAHIFRD---TQRNSKLEVQLDTLKSLVNECGTQIVLV........ 160
6 -17.500PF13479.1; Q4EAN1_9RICK/15-248; AAA domain  ali follow..  2.................................STVKMVIFGPYGIGKTSLLKTI---------------------EPTLCLDFEAGLLAVQDWKGDSTEIRTWNEARDIACLIGGPNPALKSDQAYSQRHYEHVSSKYKDFSSRCIFVDSITVASRERSGKQDMRVAYGLLAQLNQFQHIRDKDIIIVGTLGQYL. 168
7 -17.300PF09807.4; CC075_HUMAN/1-251; Uncharacterized conserved protein (DUF2348 topsan)  ali follow..  11  13............................PDRAEQGKLTLLCDAKTDGSFLVHHFLSFYLKANCK--------------VCFVALIQSFSHYSIVGQKLGVSLTMARERGQLVLREANAGNLKPLFEFVREALKPVDSGEARWTYPVLLVDDLSVLLSLGMGAVAVLDFIHYCRAT--VCWELKGNMVVLVHDSGDA. 188
8 -16.600PF04665.7; A7XCQ5_9POXV/6-246; Poxvirus A32 protein  ali follow..  17  1......................EKHFSRKSLLKYPFRLALVGGSGSGKTAYLLSLFNTLVE-------------------------------RHIFLFTPVYNSEYDSYIWPDHVNKVSTSEELDYALITTKQKIEKYVKNRGNKLLILDDMG----------DKQIKSSCLLDFLNHGRHLNTSIILLCQTYKH.. 139
9 -15.900PF13521.1; A4CIV1_ROBBH/14-173; AAA domain  ali follow..  10  2.....................................VVLFGPESTGKTTLARELARHYGEPWVPEYAREYLQEKWDRVQQTCAPEDLLPIARGQMRLENIGAREASRLLICDTDLLETKVYSETYYGGGCDPKLQAAALANDYDLYFLTDIDIPWEADDLRDKPHERAEMFHYFKTALRENNRRFVILSGGREAR. 160
10 -15.900PF03796.10; Q9KUY7_VIBCH/203-462; DnaB-like helicase C terminal domain  ali follow..  12  16...............................LQGSDLIIVAARPSMGKTTFAMNLCENAAMEQD------------KPVLIFSLEMPAEQIMMRMLASLSRVDQTSSTMGILMEKKNMYIDDSSGLTPTEVRSRARRIAREHGLSLIMVDYLQLMRVPALTDNRTLEIAEISRSLKALAKELNVPVVALSQLNRS.. 183
11 -15.600PF05707.7; Q38198_9VIRU/7-180; Zonular occludens toxin (Zot)  ali follow..  12  1...................................SISLLTGLPGSGKSLRIIQAIRYLMD-------------KGAHVYVCNIDGISVP-------------------------------------GTTPWADPHKWQDLPAGSILFVDEAQHFF-----PARRGGDPVETIKAMSTIRHDGVRLVLATQ...... 101
12 -15.000PF05621.6; Q48383_KLEAE/1-302; Bacterial TniB protein  ali follow..  13  20.ARLPADERIQRLRADRWIGYPRAVEALNRL-QRMPNLLLVGPTNNGKSMIVEKFRRTHPA-------SSDADQEHIPVLVVQMPSEPSV-----------------IRFYVALLAAMGAPLRPRPRLPEMEQLALALLRKVGVRMLVIDELHNVL-----AGNSVNRREFLNLLRFLGNELRIPLVGV........ 186
13 -13.700PF01591.13; F262_BOVIN/27-250; 6-phosphofructo-2-kinase  ali follow..  15....................................LIVMIGLPARGKTYVSKKLTRYL-------------NWIGVPTKVFNLGVYRRQAVKSYKSYDFFRHDNEEAMKIRK------------QCALVALKDVKAYLTEESGQIAVFDAT-------------NTTRERRDLILNFAEENSFKVFFVE....... 130
14 -13.700PF09848.4; A1A222_BIFAA/236-699; Uncharacterized conserved protein (DUF2075 topsan)  ali follow..  10  1..................................SRLIFVQGVAGTGKTVLLSHLFYRIAT-ETDSSLKISKEDRRKAYILVNHNQQMHVYNQIASKLGLQKHFGEVALKPSQFINRFSEKTTSNRAIADK--------PRGKADVVLVDEAHLLLTQGDQGYSGKN------MLHDLLRRAKVVIAVFDPNQ.... 161
15 -13.600PF03266.10; NTPTH_METS5/13-164; NTPase  ali follow..  2.....................................LFITGRPGVGKTTLIKGLVSELRELKGFYTEEVRERGERTGFLFVVIGDGSCPLASTKPIGKERVGR--------------------YFVVDSLTLLPQVKQRLEVADLVIMDEIGPM---------EKKIGDLWKLIQGVLSSNKPVVASVHRSMNIE. 133
16 -13.300PF14516; B0C1H3.1/102-434; AAA-like domain  ali follow..  14  18.....................EVERHCCQIITHPGTLIRIKAAKGMGKTSLVNRILKTAEA-------------HPLQTLYLDFQWASQASINNLERFLRWFCFQMGRQLGLDNQLDDYWDTELLTSIDNCSQYFEDYLLPNIEAVLALDSVEQIFPYPEVAGDVLRMLRSWHEKSKSSAIWEKVRLVITHATE... 179
17 -12.800PF13191.1; B3QEJ6_RHOPT/306-495; AAA ATPase domain  ali follow..  14  24.................................TTEWVLISGYSGAGKSSVVSELRKSLAPTNGWFIAGKFDQQAFRSLVRQILGLDCGELDQWRTALQEAVGEHGELMVNLLPLPDLPPQESKSLFEAVLARFLAAIARAEHPLVLFLDDLQ-----------DKATSEFLVRLAQNIDTRHLLLV.......... 190
18 -12.400PF07652.9; Q32ZD8_9FLAV/1675-1822; Flavivirus DEAD domain  ali follow..  1...............................FKKKQLIVLDPHPGAGKTRKVLPEFIRQAVERR-----------LWTLALAPTRVVAAEMAEALNGLPVRYLTPAVIQQHTGKEIVDLMCHATF------TMRLLSGGRVPNYNMFIMDEAH---------FTDPSSIAARGYISTKVDMGEASAVFMTATPPGSR 140
19 -12.300PF02283.11; A3JAW9_9ALTE/3-170; Cobinamide kinase / cobinamide phosphate guanyltransferase  ali follow..  1.....................................TLVIGGIRSGKTALAERLARNTDG---------------EVVYLATATAGDDEMRRRIDRHQRQRSVNWGLSEEPLALASVLALHAS---------------ASQKAPCILVDCMSLWVSNLLHAGETVFAWEREEFLTQLAQYPGKLIIVSNEVGLG.. 128
20 -12.100PF08303.6; Q6CK12_KLULA/389-554; tRNA ligase kinase domain  ali follow..  13  1....................................LLVTIATIGCGKSTVSLTLNELFPES----------------WGLVVNDNITSNKTD--------------------------------------IKSALQLFKD-GKQFVLAD-------------KNNHQFRERAAVFEWINQYRDSYIPYN....... 87
21 -11.900PF00006.20; A0YD60_9GAMM/56-264; ATP synthase alpha/beta family, nucleotide-binding domain  ali follow..  12  12...............................IGMGQRGLIVAPPGCGKTTLLKHVCQAVGAAYP----------EIKLYALLIDERPEEVTDFKRSVPAQVHASSSDE-----------SYEHHVSVANDLLDTARRQAGEGHDVMIVIDSLTRLSRVGGIDARALEIPRKLFGAARKIENGGSLTILATILVDTGS 169
22 -11.900PF13671.1; B2JHT3_BURP8/20-178; AAA domain  ali follow..  10  1....................................LVFICGHAGTGKTTLAKRLIGPLMK------------ATGEACCLLDKDTLYGVYSAAAIGALTGDPNDRDSPLFLQ------------HFRDPEYRGLFDTAAEN----VIAVG------------SREVRERRLFDHVWLGVPKDAKISVVW....... 122
23 -11.800PF01443.13; RDRP_TMV/829-1085; Viral (Superfamily 1) RNA helicase  ali follow..  14  1.....................................VLVDGVPGCGKTKEILSRV-----------------NFDEDLILVPGKQAAEMIRRRANSSGIIVATKDNVKTVDSFMMN------------------FGKSTRCQFKRLFIDEGLML------------HTGCVNFLVAMSLCE--IAYVYGDTQQ... 108
24 -11.700PF13614.1; Q28JF6_JANSC/100-250; AAA domain  ali follow..  3....................................LAVTSPTASCGKTTMALNLALGFTR------------QPDIRVMLIELDLRRPSIAKVLGLQLHEHAFRFGKNVTISAARNVSKDPTSILLGPTTHQILEDIEATYDPDILMFDL---------------PPLLVSDDTRAFLKEVDCGMMIARA...... 144
25 -11.600PF05729.7; Q9GJD8_RAT/339-510; NACHT domain  ali follow..  17  1...................................QVVAVLGKAGQGKSHWARTVSHIWAQGQ----------PQYDFVFYVPCQCLDRPGDTYHLRDLLCPPNLQ---------------------PLAMNDEVIDHIVRQPDRVLILDAFEELEAQDSLLHGPCSLRGLLAGLFQRKLLRGCTLLLTARPRGRL. 140
26 -11.500PF01695.12; Y4IQ_RHISN/60-238; IstB-like ATP binding protein  ali follow..  15  42............................DSWLAKGANILLFGPPGGGKSHLAAAIGLALIE-------------NGWRVLFTRTTDLVQKLQVARR--------------------------------ELQLESAIAKLDK--FDLLILDDL-------AYVTKDQAETSVLFELISARYERRSIMILVHHA..... 176
27 -11.500PF13500.1; B1XHZ8_SYNP2/6-216; AAA domain  ali follow..  12  2...................................HIVVASTEPYSGKSAVLLGLVQSLKQKGISVAYSKPIGTVWHDEQNGRFTRIEDDLRFLGEAFGLKETEVRSPVLFLDEATVAQRLTGQ---QTDYPQKLKDDLGAIASDITFIEAPKSLWEGSLFNLSAGE----------IAATLGAKILLVIPYHHKLL 151
28 -11.300PF07931.7; Q98FG2_RHILO/59-238; Chloramphenicol phosphotransferase-like protein  ali follow..  14  1..................................ARIVLLNGVGSAGKSSIARALQTITAA------------------LHVQMDSFLEMLPDALQDHADGFSYETVRQDGKPAVVIRAGPVGERTL--RGMRHAIAAMAGQGNDLIVDDVLCN---------------GELSDCVDLLSAFDFHLVGVM....... 123
29 -11.100PF00154.16; RECA_METCL/7-329; recA bacterial DNA recombination protein  ali follow..  10  48.............................GGLPRGRIIEIYGPESSGKTTLTLSAIAEM-------------QKLGGVAAFIDADDALDPQYASKLGVNVPE--------------------SQPDTGEQALEIADMLVRSGSVDIVVVDSVAALTPRAEIEGEMGDSSQALRKLTGNIKRTNTLVIFINQIRMKIG 194
30 -11.000PF09818.4; Q2C6W1_9GAMM/1-438; Predicted ATPase of the ABC class  ali follow..  12  227...........................IRGMGIPEGITLIVGGGFHGKSTLLSAIERSVGDGRE----------------YVVTNYNAAKIRAEDGRCVHNVDLSPYISNLPMGKDTTAFTSQNASGSTSQASWLQESI-EAGAEALLIDEDTSASNFMIRDERMQALICKVDRIALLRDQHDISVMLVMG...... 386
31 -10.900PF13086.1; B6HQI4_PENCW/1305-1589; AAA domain  ali follow..  13  4.....................RAQARAIKSAVDNDAFTLIQGPPGSGKTKTITALVGSLLSDVL..................................................................................................................................... 46
32 -10.900PF13604.1; B9QRK8_9RHOB/353-542; AAA domain  ali follow..  14  4.....................DEQRVAIERITGEERMASVVGRAGAGKTTM-MKAAREVWEANGYQVVGAALAGKAAEGLEKEAGIASRTLASWQLSWGRGEGLPDKK------------------------------------SVFVID------------EAGMVDSRQMSVFVETIAKAGAKLVLVGDAEQLQP 130
33 -10.700PF08433.5; O46079_DROME/1-293; Chromatin associated protein KTI12  ali follow..  13  3....................................LVVITGLPASGKSTRARQLRDHFVE-------------RGRKVHLISENEAVPKAG-------------------FGKNSHTGDSQKEKVVRSDLKSEASRHLNQE--DLVILDAGNYIKG---------------YELYCMSKVSRTTQCTVF....... 109
34 -10.600PF06414.7; Q8P580_XANCP/35-230; Zeta toxin  ali follow..  12................................EHPKAIILAGQPGSGKGSLARAADVELGRD----------------VVLIDPDELRNAHPEVSALRNAHPYTWSGYTH---------------SDASQWADELLQVTIEGKKNLIF--------------DTTLSNGQWSAELIKDLQSRGYDVEVR........ 123
35 -10.500PF02374.10; ASNA_HUMAN/37-340; Anion-transporting ATPase  ali follow..  2...................................KWIFVGGKGGVGKTTCSCSLAVQLSKRESVLIISTDPAHNISDAFDQKFSKVPTKVKLGVAELPDEFFEEDNMLSMGKKMMQEAMSAFPGIDEAMSYAEVMRLVKGMNFSVVVFDT.............................................. 131
36 -10.300PF10649.4; A6X300_OCHA4/7-165; Protein of unknown function (DUF2478 topsan)  ali follow..  1....................................LAAILAAKDVPVDQLLAGVAHRARQGFLQHRESNTDECCRDIEIEHIGTGVTQIISQSLGSGSKGCRLDPAAL-------------------ADVAGSLLAELDS-GADMLILNRFGKG---------ETEGHGFRSIIEIAYARQIPVLTVVRETYVEG. 137
37 -10.300PF13207.1; B2WP20_PYRTR/6-173; AAA domain  ali follow..  1....................................IIGLYGISGSGKSYLLNHVKTEIALQAQRFA--AHVTPGGLDSFKLLDAAAKQSRIEAALALITQTCLDRGETAVVAGHYMFWNPGVVVAVEKDWQTYTHIVYLDTAPGVIASADLTRHRVVVDEEGLRSWQNKEKEDLRAICREKGIIFTTLREKPGD.. 168
38 -10.200PF00910.17; A7M6L1_9SECO/473-576; RNA helicase  ali follow..  16  1.....................................VYAYGESRTGKTLVVDKLITDFQN........................................................................................................................................ 24
39 -10.200PF09140.6; A5EKW2_BRASB/13-276; ATPase MipZ  ali follow..  13  3....................................VVLGNEKGGSGKSTTALHIAVALLK-------------AGQRVATIDLDSRQQSFTHYINNRSAWARRTGLHLELPTYCIKLGQTLQIDENEKAEFQQFMEAVCEHAFDFIVVDT.............................................. 107
40 -10.100PF10443.4; Q5B2U3_EMENI/373-791; RNA12 protein  ali follow..  8...........................LNSWLSAETFIVIHGPRGSGKRELVLDRTLKDNKYKLIIDCKQ----------IQDAKGDTAKIARAASQVGYRPVFSMNSISSFIDLAAQGMIGTKAGFSETLDAQLSNIWQPEVRPVVVIDNYLHN-----NPEATSVVYDKITEAAGLATGNIAHVIFLTT...... 192
41 -10.000PF13872.1; E8RVW0_9CAUL/378-705; P-loop containing NTP hydrolase pore-1  ali follow..  87......................................FLGDGTGVGKGTSVSAVIAENM-----------AQGRTKAIWVSKNDTLIEDARRDWISVGGDANDIVGLSTYKFGTPIRMDRGILFTTYASRLDQVVDWLGSDFEGALVFDESHEMANAASGKGTASQQGLAGLLLQYRVPNARVLYVSA........ 242
42 -9.960PF07015.6; Q1M9M0_RHIL3/1-231; VirC1 protein  ali follow..  4....................................VTCCSFKGGAGKTTALMGLCSALAA-------------DGKTIALFEADENRPLSKWKENATRRNAWDPLCEIFITDEL--------------PLLEVAYEEAAGRGFDYCLVETLIPTMLTPLDADEALATFRYIIELLIGENLAIPAAILRQRVPANR. 154
43 -9.960PF07728.9; Q82S33_NITEU/475-632; AAA domain (dynein-related subfamily)  ali follow..  14  2.....................................LILQGPPGTGKTWLAKRLAFALMGQKD--------DSKVRAVQFHPNLSYEDFVRGWRP-----------------------TGEGKLSLADGVFMEAIKAASKDPSSVVVIEEI-----------NRGNPAQIFGELLTLLEA................ 105
44 -9.820PF03205.9; Q9FLE2_ARATH/115-230; Molybdopterin guanine dinucleotide synthesis protein B  ali follow..  2....................................RVIIVGDIDSGKSTLAKMLLNWAVK-------------DGWKPTFVDLNVGQSSITTIAAAPIKMLVDPVEGFPLDKALIHYFGLTNPSVNLRLYRTLVEELARELKEEFMVIDT.............................................. 116
45 -9.670PF06431.6; Q8JUD5_POVJC/266-682; Polyomavirus large T antigen C-terminus  ali follow..  14  152...............................IPKKRYWLFKGPIDSGKTTLAAALLDLCG----------------GKSLNVNMPLERSNF------------------------------------------ELGVGIDQ---FMVVFEDIKGTGAES-RDLPSGHGISNLDCLRDYLDGSVKVNLERKHQNKRT. 254
46 -9.600PF10236.4; Q755C9_ASHGO/113-434; Mitochondrial ribosomal death-associated protein 3  ali follow..  23......................................ILTGQPGVGKSTLLAQVIINISHPELFLNGRNTQPMYLKKLLTKILKSNKKSVLSSVATRESASKRVTRLVPGKNTLYDLLSMKTTPAARGMLFQAVIDELVAQSPVYLTVDNFSRILSEPLSAYKDTS.............................. 187
47 -9.490PF01057.12; Q7TG44_9VIRU/193-485; Parvovirus non-structural protein NS1  ali follow..  10  127..........................WCQKKWGKRNTLWLFGHATTGKTNIAEAIAHAVPF-VNWTNENFPFNDCVEKMIIWWEEKVVETAKAILGGSRVRVDQKCKASVPIEPTPVIITSNTNMCYVIDGNTTTFEHKQPLEDRMFKL-ELLTRLPDDFGKVTKQEVRQFFRWSQDHLTPVIPEFL.......... 293
48 -9.450PF04310.7; MUKB_ECOLI/1-227; MukB N-terminal  ali follow..  16  26.................................DELVTTLSGGNGAGKSTTMAAFVTALIPDLT..................................................................................................................................... 56
49 -9.420PF03215.10; RAD17_HUMAN/83-593; Rad17 cell cycle checkpoint protein  ali follow..  11.......DKYKPETQHELAVHKKKIEEVETWLKAGSILLITGPPGCGKTTTLKILSKEH--------GIQVQEWINPVLPDFQKDDFKGMFNTESSFHMFPYQSQIAVF-----------KEFLLRATKYNKLQMLGDDLRTDKKIILVEDLPNQF--------YRDSHTLHEVLRKYVRIGRCPLIFI........ 175

FFAS is supported by the NIH grant R01-GM087218-01
6 0 5 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ye Y, Li Z, and Godzik A. Modeling and Analyzing Three-Dimensional Structures of Human Disease Proteins Pacific Symposium on Biocomputing 11:439-450(2006) [PDF]