current user: public




Query: PF13481.4; B2JV40_BURP8/220-401; AAA domain, from PfamA30U

Results of FFAS03 search in PfamA30U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180
# Score Template Links and tools%idFirst YEPRYRVLSGAAITSQPIIDDLVDDVIPAHAVGAVWGASAAAKSFLVLDLAAALTECRSFFGHDVFEPVPVLLVSLEGNNGLPRRYLAWEKHNGRPVPARLHTLTQGFSLLDPRDTDDLCEAIETCGITGGVVFIDPFALATIGLEENSSADMGRAGAALNTLRERTGCTVIAVHHTGKKQELast
1 -97.600PF13481.4; B2JV40_BURP8/220-401; AAA domain  ali  100  1YEPRYRVLSGAAITSQPIIDDLVDDVIPAHAVGAVWGASAAAKSFLVLDLAAALTECRSFFGHDVFEPVPVLLVSLEGNNGLPRRYLAWEKHNGRPVPARLHTLTQGFSLLDPRDTDDLCEAIETCGITGGVVFIDPFALATIGLEENSSADMGRAGAALNTLRERTGCTVIAVHHTGKKQE 182
2 -20.600PF08423.9; W1Q8L5_OGAPD/106-359; Rad51  ali follow..  18  24................KQLDTLLGGGIETGAITEVFGEFRTGKSQLCHTLAVTCQLPIDNGGGE----GKCLYIDTEGTF-RPIRLVAIARRFGLDENETLDNVAYARAYNADHQLQLLHQAASMTESRFSLLIVDSIMALYSGRGELSARQVAKFMRTLQRLADEFGIAVVITNQVVAQVD 191
3 -19.300PF06745.11; O29463_ARCFU/20-274; KaiC  ali follow..  15  18...............GDRYVRKPLGGIPHLAVMNITGVPDTGKSLLAEQFAITQAG----------SGYRVLYVTVESPANLYTAMKERSEAMGVDFTSNVVVIDASESDELRENPKALMETMAYAEKKVTNTIIDSITGLY----EHKEMMARQIVRQFFNFMKKYRQTGIFVSQKRSAQA 176
4 -17.300PF07088.9; GVPD1_HALSA/23-536; GvpD gas vesicle protein  ali follow..  12  1......................LSQFFDAGETLLINGAPGTGKTLFTIRGLDVLDRDSD-----------VLYVSTRVDQETVHEMYFALDLFQDPFELPLDVDVPFEKLDLDSLLEWIQEINAATTQL--TIAFDSWELIYEAVRHDDPPDIKTVTNQLAVLAREENIRLMLVTETAAPSS 161
5 -17.100PF13401.4; B2UJB3_RALPJ/42-210; AAA domain  ali follow..  12  2...........................SQESILLVCGPTGAGKTTLAKFMVENAHSQSHAEMELNAGVIPAIYVQAPASGETKFSWRLFYQRILNQLGDDLDSPKVAYGVDSGNSLAALRTAVERGARQVQFMVIDEAAHIFRD--TQRNSKLEVQLDTLKSLVNECGTQIVLV........ 160
6 -14.300PF13479.4; F5YIK8_TREPZ/11-202; AAA domain  ali follow..  13  6.................................ALFGPSGSGKTMTALRMAKGIAD---------TMGVPFAVIDTEARSASK--------------ADRIPFDVDDLDGKTVDHYIAAMNECVKAGYK--VLVIDSLSHAWRELTDSPWAKVNPKQKRFIDAILNFPGHIIATMRSKTE.. 143
7 -13.800PF03796.13; M4NCG5_9GAMM/198-453; DnaB-like helicase C terminal domain  ali follow..  16  16..........................LQPSDLIIVAARPSMGKTAFALNIAEAAA---------LGGKKAVVVFSMESSSQLAFRLISVSNAIALLSEAKIFIDDTP---LSPVELRSRARRLHREHGGLGLIVIDYLQLMQVGNKENRATEISEISRSLKGLAKELNVPVIALSQLNRSLE 184
8 -13.100PF01637.16; A8M939_CALMQ/15-228; ATPase domain predominantly from Archaea  ali follow..  15  11......................IEKLAEKGTPVVIYGPEGCGKSAFLKQAVEVLGE----------YDYSVVKVSPEDESNEKLRYSEELRGLFRDIMTRIPTPFNDASALIDIAISLLYDVVRRRIRRKIALLADDVFQAIG---DKAELLVKRLLNMIEYSSVDYERIVVIV........ 153
9 -12.900PF04665.10; Q6TUP8_YMTV5/6-246; Poxvirus A32 protein  ali follow..  1.................EKHFYRKSLLKHPFRIALVGGSGSGKTAYLLSLFNTFVE----------KYRHIFLFTPVYNSEYDSYIWPDHVNRVTTYEELDYSLITTKQKIE----KYVKKQGNDKTTEMFLLILD---------DMGDKQIRSSCLLDFLNHGRHLNTSIILLCQT..... 137
10 -12.000PF05707.10; Q79YX7_VIBPA/2-255; Zonular occludens toxin (Zot)  ali follow..  12  1..............................ATSFRYGHGGSYKSACAVWFDL----------LPALREGRICITNIHG----MQPLEVIEQRLGEKFPDTARLIRIS---SRNPEGFELWKYFFCWAPIGAFILIDECQQIFSVNAGFKMANI............................. 106
11 -11.800PF05621.9; S6B007_9PROT/25-277; Bacterial TniB protein  ali follow..  15  1...RIAYISRDRFISHQQAESILDEL-VRPQGRLVVGRSLMGKSTLFDEFL------RRHPADDDGDAAIIPIVSVQYPDTAKEGIYP-------------ILASLNARIPANTKAPELRRATVERQVGMRVLLIDEIHNLL----EGSANSQRKGLNSIKYLMNELHRPVITA........ 159
12 -10.700PF07728.12; Q82S33_NITEU/475-632; AAA domain (dynein-related subfamily)  ali follow..  15  3.................................ILQGPPGTGKTWLAKRLAFALMGQKD--------DSKVRAVQFHPNLSYEDFVRGWRPTGEGKLS------------LADGVFMEAIKAASKDPSSKFVVVIEEINRG------NPAQIFGELLTLLEAGKRTPNEALELCYPDADGKR 125
13 -10.200PF03266.13; NTPTH_METAC/3-167; NTPase  ali follow..  18  3.................................AVTGSPGVGKSTVVAKTAEKLAEKPGIRTAEIRKEGHREGFSIRDLATGKTGILSHVKGSGPRLGKYHVNL---------DDLERIGANAVRNALACDLVVIDEI-----GPMELISQS---FVSAVEEVLESDKPVLAVLHHSSRH.. 137
14 -9.850PF09848.7; A1A222_BIFAA/236-699; Uncharacterized conserved protein (DUF2075 topsan)  ali follow..  12  1.............................SRLIFVQGVAGTGKTVLLSHLFYRIATMDINGRINDEDDEDILETDSSLKISKEDRRKAYILVNHNQQMHVYNQIASKLGLQKHFGEVALKAIADKPRGKADVVLVDEAHLLLTQGDQGYSGK-----NMLHDLLRRAKVVIAVFDPNQ.... 161
15 -9.660PF05729.10; G3V6C0_RAT/441-610; NACHT domain  ali follow..  15  1...............................VVAVLGKAGQGKSHWARTVSHIWAQG------QLPQYDFVFYVPCQCLDRPGDTY-------------HLRDLLCPPNLQPLAMDDEVIDHIVRQPDRV-LLILDAFEELEAQDSLLHGPSLRGLLAGLFQRKLLRGCTLLLTARPR.... 136
16 -9.400PF09140.9; Q9A6C9_CAUCR/5-268; ATPase MipZ  ali follow..  11  3...............................IVVGNEKGGAGKSTIAVHLVTALLY----------GGAKVAVIDLDLRQRTSARFFENRRAWLDNKKIELPEPLALAERPEEEQVAGFEAAFARAMAECDFILIDTITRMAHGRADLVVTPMNDSFVDFDMLGTVDPVTLELTK....... 151
17 -9.290PF01443.16; RDRP_TMV/829-1085; Viral (Superfamily 1) RNA helicase  ali follow..  15  2.................................LVDGVPGCGKTKEILSRV---------------NFDEDLILVPGKQAAEMIRRRANSSGIIVATKDNVKTVDS------------MMNFGKSTRCQFKRLFIDEGLMLHTG--------------CVNFLVAMSLCEIAYV........ 102
18 -9.250PF01695.15; Y4IQ_RHISN/60-238; IstB-like ATP binding protein  ali follow..  13  42.......................DSWLAKGANILLFGPPGGGKSHLAAAIGLAL----------IENGWRVLFTRTTDLVQKLQVARRLESAIAKLDKFDLLILDDLAYVTKDQAETSVLFELISARYERRSIMI------------TANQPFGEWNRVFPDPAMTLAAVDRLVHHA..... 176

FFAS is supported by the NIH grant R01-GM087218-01
8 5 6 5 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Slabinski L, Jaroszewski L, Rychlewski L, Wilson IA, Lesley SA, Godzik A. XtalPred: a web server for prediction of protein crystallizability. Bioinformatics. 2007 Dec 15;23(24):3403-5. Epub 2007 Oct 5.