current user: public




Query: PF13479.4; F5YIK8_TREPZ/11-202; AAA domain, from PfamA30U

Results of FFAS03 search in PfamA30U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190
# Score Template Links and tools%idFirst LYLRCALFGPSGSGKTMTALRMAKGIADTMGVPFAVIDTEARSASKYADRIPFDVDDLDGKTVDHYIAAMNECVKAGYKVLVIDSLSHAWRELTDEVDRIAQSSVSKNTFSPWAKVNPKQKRFIDAILNFPGHIIATMRSKTEWVIGEGKGGKVAPEKMGLAPEQGKGIEYEFDLLMELDQKHQATVTKDRTLast
1 -92.700PF13479.4; F5YIK8_TREPZ/11-202; AAA domain  ali  100  1LYLRCALFGPSGSGKTMTALRMAKGIADTMGVPFAVIDTEARSASKYADRIPFDVDDLDGKTVDHYIAAMNECVKAGYKVLVIDSLSHAWRELTDEVDRIAQSSVSKNTFSPWAKVNPKQKRFIDAILNFPGHIIATMRSKTEWVIGEGKGGKVAPEKMGLAPEQGKGIEYEFDLLMELDQKHQATVTKDRT 192
2 -29.200PF00154.19; RECA_ACIAD/7-268; recA bacterial DNA recombination protein  ali follow..  19  55....VEIYGPESSGKTTMTLQ-AIAQCQKAGGTCAFIDAEHALDPQYARKLGVDIDNLLVSQPDHGEQALEIADSGAIDLIVVDSVA----ALTPKAEIEGEMGDSHMGLQA-RLMSQALRKITGNAKRSNCMVIFINQIRM-----------KIGVMFGSPETTTGGNALKFYASVRLDIRRIGQVKE... 226
3 -16.500PF07088.9; GVPD1_HALSA/23-536; GvpD gas vesicle protein  ali follow..  10  13....LLINGAPGTGKTLFTIRGLDVLDR--DSDVLYVSTRVDQETVHEMYFADHSVPFEKLDLDSLLEWIEINAATTQLTIAFDSWELIYEYLAVRHDDPPD-------------IKTVTNQLAVLAREENIRLMLVTETAAP-----------------------SSLEYIVDGVVTLQTRRDLRLDKLR. 192
4 -14.900PF06745.11; O29463_ARCFU/20-274; KaiC  ali follow..  10  35....MNITGVPDTGKSLLAEQFAITQAGS-GYRVLYVTVESPANFLRSEAMGVDFTKVESENPKALMETMYAIKEKKVTNTIIDSITGLYEHKE-------------------MMARQIVRQFFNFMKKYRQTGIFVSQKRSA------------QASESAEAAGGLAVAHIVDGTIVLSILRTIRIDGCR. 229
5 -14.300PF13481.4; B2JV40_BURP8/220-401; AAA domain  ali follow..  13  34.....AVWGASAAAKSFLVLDLAAALTEFEPVPVLLVSLEGNNGLP-PARLHTLTQGFSLLDPRDTDDLCEAIETCGITVVFIDPFALATIGLEE---------------NSSADMGRAGAALNTLRERTGCTVIAVHHTGKK................................................. 180
6 -13.500PF07015.9; Q1M9M0_RHIL3/1-231; VirC1 protein  ali follow..  16  1MQLVTCCSFKGGAGKTTALMGLCSALAAD-GKTIALFEADNRPLSKWKENAT--CEIFITDELPLLEVAYEEAAGRGFDYCLVET........................................................................................................... 91
7 -13.500PF08423.9; W1Q8L5_OGAPD/106-359; Rad51  ali follow..  12  42......VFGEFRTGKSQLCHTLAVTCQGGGEGKCLYIDTEGT----FRPIRLVAIARRFGLDENETLDNVSMMTESRFSLLIVDSIMALYR---------TDYSGRGELSARQMHVAKFMRTLQRLADEFGIAVVITNQVVAQVDGGAIFNPDPKKPIGG................................ 206
8 -13.400PF04665.10; Q6TUP8_YMTV5/6-246; Poxvirus A32 protein  ali follow..  13  14..FRIALVGGSGSGKTAYLLSLFNTFVEKYRHIFLFTPVYNSEYDSYIWPDHVNRVTTYEELDYSLITTKQKIEKYVKKLLILDDMGDKQIRSSCLLDFLNHGRHLNTSI-----LLCQTYKHVPVNGRTSITHFCCCNVSDS................................................. 160
9 -13.000PF13671.4; B2JHT3_BURP8/20-178; AAA domain  ali follow..  17  2....VFICGHAGTGKTTLAKRLIGPLMKATGEACCLLDKDTLYGVYSARDSPLFLQHFRDPEYRGLFDTAAENLRLGIGV-IAVG........................................................................................................... 93
10 -12.400PF03266.13; NTPTH_METAC/3-167; NTPase  ali follow..  13  1...RIAVTGSPGVGKSTVVAKTAEKLAEKPGFKIGGIRTAEIRKE--GHREGFSIRDLATPRLGKYHVNLDDLERIGADLVVIDEIGPM------------------------ELISQSFVSAVEEVLESDKPVLAVLHHSSRHPLA--QRFRKGFEVLTVDKGNRDELPEKIT.................. 165
11 -12.100PF01695.15; Y4IQ_RHISN/60-238; IstB-like ATP binding protein  ali follow..  15  50...NILLFGPPGGGKSHLAAAIGLALI------------ENGWRVLFTRTTDLVQKLQVARRELQLESAIAKLDK--FDLLILDDLAYVFELISARYERRSIMITANQPFGEWNRVPAMTLAAVDRLVH-HATIF......................................................... 179
12 -11.900PF08303.9; Q6CK12_KLULA/389-554; tRNA ligase kinase domain  ali follow..  14  2....LVTIATIGCGKSTVSLTLNE-LFPESWGLVVNDNITSNK--------------------TDYIKSALQLFKDGKQFVLADKNNHQFRERAAVFEWINQYRDSNLQVIALCFVDEVSPEMRALTIDR-----VMKRGDNHQSIKSESDDQQKVLKI-QPFLPSKDPDNKFDFHIQLE............ 164
13 -11.800PF01443.16; RDRP_TMV/829-1085; Viral (Superfamily 1) RNA helicase  ali follow..  19  1....VLVDGVPGCGKTKEILSRVNF------DEDLILVPGKQAAEMIRRRAN-VATKDNVKTVDSFMMNFGKSTRCQFKRLFIDEGLML....................................................................................................... 83
14 -11.500PF02283.14; Q89Q74_BRADU/14-176; Cobinamide kinase / cobinamide phosphate guanyltransferase  ali follow..  13  1....ILITGGARSGKS----RRAETRTQAFPGRPVYIATAEALDAEMEDRIAKHRARRGADVPLDLVQALVETEGG--GARLVDCLT-LW----------------SNLLHSERDWSREVTHLAEVLPRLRSPVIMVTNEVGLGIVPDNALARTYRDAAG................................ 139
15 -11.300PF13521.4; A4CIV1_ROBBH/14-173; AAA domain  ali follow..  17  1...KVVLFGPESTGKTTLARELARHYGEPWVPEYAREYLQEKWDRVQQTCAPEDLLPIA----RGQMRLENIGAREASRLLICDTETKVYS..................................................................................................... 87
16 -11.200PF05729.10; G3V6C0_RAT/441-610; NACHT domain  ali follow..  10  2....VAVLGKAGQGKSHWARTVSHIWAQGQLPQYDFVCLDRPGDTYHLRDLLCPPNLQPLAMDDEVIDHI--VRQPDRVLLILDAFEEL------EAQDSLLHGPCGPLSPEPCSLRGLLAGLFQRKLLRGCTLLLTARPRGRLAQSLSKADAIFEVP-SFSTKQAQIYMRHY................... 167
17 -11.000PF07728.12; Q82S33_NITEU/475-632; AAA domain (dynein-related subfamily)  ali follow..  10  1...NLILQGPPGTGKTWLAKRLAFALMGKDDSKVRAVQFHPN------------------LSYEDFVRGWRPTGEGKLSLVVIEEINR--AQIFGELLTLLEAGKRTPNEALELCYPDADGKRRPVHIPENLYVVGTMNIADRSLALVD........................................... 151
18 -11.000PF00910.20; A7M6L1_9SECO/473-576; RNA helicase  ali follow..  13  1....VYAYGESRTGKTLVVDKLITDFQNHFGLGKDTVYSRNPIDQYWSG--------------------------RRQPIVSIDDFGA........................................................................................................ 59
19 -11.000PF09439.8; SRPB_YEAST/36-221; Signal recognition particle receptor beta subunit  ali follow..  12  3.QPSIIIAGPQNSGKTSLLTLLTTD------SVRPTVVSQEPLSAADYDGSGVTLVDFPGHV-YKLSDYLKTRAKFVKGLIMVDSTVTTAEFLVDILSITESSCENGIDINKSELFTARPPSKIKDALESEIQKVIERRKKSLNEVERKINEEDYAENTLDVLQSTDGFKFA.................... 180
20 -11.000PF07931.10; Q98FG2_RHILO/59-238; Chloramphenicol phosphotransferase-like protein  ali follow..  14  4....VLLNGVGSAGKS----SIARALQTITAAPFLHVQMDETVRQDGKPAVVIRAGPVGERTLRGMRHAIAAMAGQGND-LIVDDVL----------------------------CNGELSDCVDLLSAFDFHLVGVMAPLEVLEAREARRADRL---PGLARWQYERVHAGISYDLEVDTSQST....... 167
21 -10.800PF09140.9; Q9A6C9_CAUCR/5-268; ATPase MipZ  ali follow..  17  3....IVVGNEKGAGKSTIAVHLVTALLY-GGAKVAVIDLDLRQRTSARSDNDVALAERPEEEQVAGFEAAFARAMAECDFILIDT........................................................................................................... 107
22 -10.700PF05621.9; S6B007_9PROT/25-277; Bacterial TniB protein  ali follow..  38....RLVVGRSLMGKSTLFDEFLRRHPADDDGDIVSVQYPDTAKEGIYPEI--ARIPANTKAPELRRATVELLRQVGMRVLLIDEIHNLLEGSA-------------------NSQRKGLNSIKYLMNELHRPVITAGTIEALNAIRTDEQISSRLTPLPLVRFKDDD........................ 190
23 -10.500PF13401.4; B2UJB3_RALPJ/42-210; AAA domain  ali follow..  14  7....LLVCGPTGAGKTTLAKFMVENAHSQSHAEAIYVQAPASGETKFSWRLFYQRILNQLGDDALRTAVERGLRARQVQFMVIDEAAHIFRDTQRN-----------------SKLEVQLDTLKSLVNECGTQIVLV....................................................... 160
24 -10.300PF13604.4; Q3L956_RHOE4/579-769; AAA domain  ali follow..  12  22.....VAVGAAGAGKT-TAAKVVARAWEQTNGKVIALGPSAKAADVLGAEIDVEGRTIADILTRDQHGLATGIEKG--DLLLVDEAGMA---------------------------ARNLADLTRIATQSGAVVRLLGDPLQLASVESGGVLRDLAERTDLSKIHRFKTVGEAAASLQLRDGDESAL..... 177
25 -10.200PF01935.15; A3DEJ1_CLOTH/136-414; Domain of unknown function DUF87 topsan  ali follow..  11  26VTEHLAVLAMTGSGKSYTVGRIIERLVAEMNGTVVVFDVHGEYGKAFEKGEIHFNNNLDFIEDEREKKSIQRIQENLIKMQNAGGGIKVYTPQIDSFDYKYSGKNHHLALQFDRFDMDDLSSILPGLTEAQERVL......................................................... 160
26 -10.100PF01637.16; A8M939_CALMQ/15-228; ATPase domain predominantly from Archaea  ali follow..  16  23....VVIYGPEGCGKSAFLKQAVEVLGEYDYSVVKVSPLEDESNEKLRYSEELRGLFRDIMTAISLLYDVVRRRIRRKIALLADDVFQA....................................................................................................... 122
27 -10.000PF06414.10; Q8P580_XANCP/35-230; Zeta toxin  ali follow..  14  17....IILAGQPGSGKG----SLARAADVELGRDVVLIDPDEEVSALRNAHPYTWSGYTHSDASQWADELLQVTIEGKKNLIFDTTLSN........................................................................................................ 102
28 -9.660PF01712.17; DCK_BACSU/12-212; Deoxynucleoside kinase  ali follow..  10  1....ITVAGTVGVGKSTLTKTLAKRLGFKTSLEE--VDHNPYLEKFYHDFERWSFHLQIYFLAERFKEQKTIFEAGGG---FVQDRSIYEDTGIFAKMHADKGTMSKVDYKTYTSL---EAMVMTPYFPHPDVLIYLEGDLENILNRIEQRGREMELQTSRSYWEEMHTRYENWIVLKLRIEDYDLLNDENS 188
29 -9.640PF00485.16; KPPR_SYNY3/10-192; Phosphoribulokinase / Uridine kinase family  ali follow..  15  2....IGVAGDSGCGKSTFLRRLTDLFGEEFMTVIC-LDDYHSLDRQGRKAAGVTALDPRANNFDLMYEQIKTLKSGQSKVVVIEGLHPLYDERVRELDMAERGHTYEDILASINARKPDFTAYIEPQKQYADVVI......................................................... 174
30 -9.620PF08433.8; O46079_DROME/1-293; Chromatin associated protein KTI12  ali follow..  4....VVITGLPASGKSTRARQLRDHFVER-GRKVHLISENEAVPKAFGKNSHTGDSQKEKVVRSDLKSEASRHLNQE-DLVILDAGNYI....................................................................................................... 87
31 -9.240PF06564.10; A7MKN7_CROS8/1-234; Cellulose biosynthesis protein BcsQ  ali follow..  16  4....LALQGVRGGGTTSLTAALGWALHQ-LGESVLVIDASPDQSTAWRYAPGLDVLPYGALRQTERENDVTLKASGQWRWILLDL........................................................................................................... 123
32 -9.170PF02374.13; ASNA_HUMAN/37-340; Anion-transporting ATPase  ali follow..  11  4....IFVGGKGGVGKTTCSCSLAVQLSKG-RESVLIIDPAHNISDAFDQKFSKVPTKVKGYEAMSYAEVMRLVKGMNFSVVVFDTLMQIKNQISPFISQMCNMMNADQLASKLEETLPVIRSVSEQFKDPEQTTFICVCIAEFLSLYETERLIQELAKCKIDT............................. 236
33 -9.070PF07652.12; Q32ZD8_9FLAV/1675-1822; Flavivirus DEAD domain  ali follow..  14  7....IVLDPHPGAGKTRKVLPEFIRQAVERRLWTLALAPTRVVAAEMAEALNVRYLTPAVIQQHTGKEIVDLMCHANYNMFIMDE........................................................................................................... 103
34 -9.000PF02702.15; B8ET99_METSB/24-233; Osmosensitive K+ channel His kinase sensor domain  ali follow..  10  4.RLKVFFGAVPGVGKTYEMLTAAHARKAEGVDVVIGVVESHGRPETEALIRGLEIVPLRQIAYKGRT--LDAILKRRPQLVLMDELAHT-PESRHPKRYLDVEELLNAGIDVYTTLNVQHLESLNDVVAQITRVRVQEKIPDSILDRADEIELIDLTPKDLIQRLHEGKVY..................... 177

FFAS is supported by the NIH grant R01-GM087218-01
8 2 9 5 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Grynberg M, Erlandsen H, Godzik A. HEPN: a common domain in bacterial drug resistance and human neurodegenerative proteins. Trends Biochem Sci. 2003 May;28(5):224-6. Review.