current user: public




PF11582
Query: PF11582.3; Q89MS9_BRAJA/2-103; Protein of unknown function (DUF3240 topsan), from PfamA26U

Results of FFAS03 search in PfamA26U
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
# Score Template Links and tools%idFirst TSEYVCLSLILARKLREELLDFLSEQPGQTSGFTVSDAAGHGSGVQLPTAAERVKGHADQVHVQIVLPGADARRLVDQLRHSFAGCNLVYWIAPVAEFGTIALast
1 -61.100PF11582.3; Q89MS9_BRAJA/2-103; Protein of unknown function (DUF3240 topsan)  ali  100  1TSEYVCLSLILARKLREELLDFLSEQPGQTSGFTVSDAAGHGSGVQLPTAAERVKGHADQVHVQIVLPGADARRLVDQLRHSFAGCNLVYWIAPVAEFGTIA 102
2 -20.900PF00543.17; O54449_AZOVI/4-105; Nitrogen regulatory protein P-II  ali follow..  14  1......VTAIIKPFKLDDVRESLSEI--GVQGITVTEVKGFGRQKGHTELAEYVVDFLPKVKIDVAIEDSQLDHVIEAITKAANTGKIKIFVVNLEQAIRI. 99
3 -10.600PF02641.10; Y448_AQUAE/1-95; Uncharacterized ACR, COG1993  ali follow..  18  2..KEVLMRIYSKEENLEDYINKL--FEGGIRGAVVLQIAGFGKGREFHSEEIEVLSYELPVVIEVVEDREKLLNFLKENRETFKNCYITFERVKV....... 94
4 -9.680PF06153.6; YAAQ_BACSU/1-109; Protein of unknown function (DUF970 topsan)  ali follow..  14  1...MKLIVAVVQDQDSNRLLKTLTDHN----RVTKLATTGGFLKSGNTTFM-SLIKENGQKRDQMIAPVSPMGGNADSYVPYPVEVEVTVFVLPVDEFHQF. 109
5 -8.390PF10126.4; Y1110_METTH/1-151; Uncharacterized protein, homolog of nitrogen regulatory protein PII  ali follow..  13  45...KVHLRVFIEVENLGRVMNILAD--EGVTGFYIVEYKGVSPKEDPESAISLIHDYARDVLICSVVDEELVEPIVNRFGEELASEKYTIIEIPIRR..... 145
6 -7.000PF14902; D1XXW4.1/8-147; Domain of unknown function (DUF4494 topsan)  ali follow..  10  20VTEQYVVDAYTFSEAEAEITKEMSHYISG--EFEIKAITPALYGEVFFSDSDEKTEKEKRSVTTRLVQAGSVNSAVKNVEEVMGAGLLDYSIVAITET.... 131
7 -6.880PF11316.3; A3SI17_9RHOB/7-241; Putative rhamnosyl transferase  ali follow..  55SDKNFTFGVVIGTSFPDQHRARLEALLADIPQAVIIARPPKRHRPVMKEILQELRQPTGLPSLQFRMDDDDAIHFVKRLREVAQDLS............... 143
8 -5.880PF12098.3; B4ST59_STRM5/50-160; Protein of unknown function (DUF3574 topsan)  ali follow..  16  24.........ISEAQWRAFLDKEVTPR----DGLTVFDAYGQWLFRGDASPNRLRTKVLVVLHEDTPQRRADIEAIRLAWKQQTKHQSVLWSRQPV....... 107
9 -5.590PF11296.3; A1T8E2_MYCVP/16-290; Protein of unknown function (DUF3097 topsan)  ali follow..  14  111........IYVEGRHDAELVEQVWGEDLRIEGVVVEYLGGVDDLAAIVADFRPGPGRRLGVLVDHLVAGSKEARIAEAVRRGPGGEHTLVVGHPFIDI.... 200
10 -5.380PF01984.15; Q4SIJ7_TETNG/9-112; Double-stranded DNA-binding domain  ali follow..  10  9...................................LQAKHGDASNNQQEEAKQREQDMRNSILAQVLDQSARVQINLALVKPEKAKAVENYLIQMARLGQLG 75

FFAS is supported by the NIH grant R01-GM087218-01
5 9 9 6 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Doukhanina EV, Chen S, van der Zalm E, Godzik A, Reed J, Dickman MB. Identification and functional characterization of the BAG protein family inArabidopsis thaliana. Biol Chem. 2006 Jul 7;281(27):18793-801. Epub 2006 Apr 24.