current user: public

anford Burnham Prebys Medical Discovery Institute

Query: PF11302.6; Q7V7X2_PROMM/20-87; Protein of unknown function (DUF3104 topsan), from PfamA30U

Results of FFAS03 search in PfamA30U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .
1 -52.900PF11302.6; Q7V7X2_PROMM/20-87; Protein of unknown function (DUF3104 topsan)  ali  100  1IFLAVTCGDVVIVQDNQRHAPESWWMGEVIHIVSGARGPDPSLFQVACIDTGVIKTVNADQVTKVVRS 68
2 -8.550PF00567.22; TDRD1_MOUSE/254-378; Tudor domain  ali follow..  18  55....PVKGEVCVAK----TVDQTWNRAIVQAV-----DVLQRKAHVLYIDYGNEEMIPIDSVHPL... 107
3 -7.860PF14604.4; A9V6E2_MONBE/1715-1765; Variant SH3 domain  ali follow..  12  13..LSFPRDAVITLGQ-KEGLDPGWLYGSYNGNTG.................................. 43
4 -7.140PF05641.10; A9NQX5_PICSI/6-67; Agenet domain  ali follow..  13  1.......GMRVEVCSSEDGYGGAWFEGVILTVTADGRRCKIRYDKFVTDDGKEEEALLHSEVRPI... 60
5 -6.130PF00018.26; YKA7_CAEEL/197-244; SH3 domain  ali follow..  20  14..MGLRIGDTVLIS---KKVDAEWFYGENQNQRTFGIVPS............................ 48
6 -5.880PF16248.3; H1Y975_9SPHI/21-103; Domain of unknown function (DUF4905 topsan)  ali follow..  16  25..FYLSNGHTNF---INLLCDERWLTG-FLHGYESALSPAHKGLIAIDGVTGITLW............ 83
7 -5.670PF06004.10; E6WLM5_PANSA/26-72; Bacterial protein of unknown function (DUF903 topsan)  ali follow..  20  8..........................GRTIVSDGKPKESDTGMLGYTDAN-GVKQQINRQEVKEVSE. 47
8 -5.590PF07039.9; A9RNU3_PHYPA/128-262; SGF29 tudor-like domain  ali follow..  14  1......SGDQVAARSGDGAENDEWIVVKLTKYDRETNR-----FEVIDEEP................. 41
9 -5.390PF12297.6; LBN_HUMAN/237-660; Ellis van Creveld protein 2 like protein  ali follow..  18  1.......GDAFAVSYAATLQAGDLGNGESLKL------PAQLTFQSSSRNRTQLK-ITAEENVTVLPH 58
10 -5.360PF07653.15; Q8MQQ3_DROME/502-564; Variant SH3 domain  ali follow..  22  16..MAFKAGDVFRVIDTLHNGVVGSWQVLKIGRGHQEMQ.............................. 51

FFAS is supported by the NIH grant R01-GM087218-01
8 9 8 1 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.