current user: public

Query: PF11302.3; Q05ZY3_9SYNE/7-82; Protein of unknown function (DUF3104 topsan), from PfamA26U

Results of FFAS03 search in PfamA26U
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .
2 -8.740PF00567.19; TDRD1_MOUSE/254-378; Tudor domain  ali follow..  22  55.....PVKGEVCVAK--------TVDQTWNRAIVQAVDVLQRK------AHVLYIDYGNEEMIPIDSVHPL..... 107
4 -7.600PF14604; A9V6E2.1/1715-1765; Variant SH3 domain  ali follow..  13...LSFPRDAVITL-----GQKEGLDPGWLYGSYNGNTG..................................... 43
5 -7.240PF10009.4; Q1LQ26_RALME/75-478; Uncharacterized protein conserved in bacteria (DUF2252 topsan)  ali follow..  18  16SPFTFYR-GSAIIQAHDLAGTPNSSLTMQICGDCLMNFGGFATPERALLFDVNDFDETSPGPWEWDLKRLAASFVV 91
6 -6.850PF07653.12; Q91VM1_MOUSE/239-294; Variant SH3 domain  ali follow..  17  18...LALEVGELVKV-------TKINVSGQWEGECNGKRG..................................... 46
7 -6.690PF12019.3; Q129K1_POLSJ/62-187; Type II transport protein GspH  ali follow..  11  16....AIKRNSRMTVCKSADGLSCTEGGGWQQGWIVFHDNAAKDDTEVMVHQSPALPASFQLVGNSNVATYV..... 85
8 -6.290PF06003.7; O93420_DANRE/15-285; Survival motor neuron protein (SMN)  ali follow..  11  68......QVGDSCYAF--------SEDGNLYTATITSFDQEKGT------CVVFYTDYGNEEEQNLSDLLTE..... 119
9 -5.910PF00855.12; MSH6_HUMAN/89-162; PWWP domain  ali follow..  19  1....DFSPGDLVWAKMEGYP--------WWPCLVYNHPFDGTFIREKGKSVRVHVDSPTRGWVSKRLLKPY..... 63
10 -5.900PF14603; O15117.2/695-783; Helically-extended SH3 domain  ali follow..  17  33...LQVKPGESLEV--------QTTDDTKVLCR........................................... 55

FFAS is supported by the NIH grant R01-GM087218-01
6 1 9 0 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page

Selected papers from Godzik Lab

Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Bourne PE, Allerston CK, Krebs W, Li W, Shindyalov IN, Godzik A.,Friedberg I, Liu T, Wild D, Hwang S, Ghahramani Z, Chen L, Westbrook J. The status of structural genomics defined through the analysis of current targets and structures. Pac Symp Biocomput. 2004;:375-86.