current user: public

anford Burnham Prebys Medical Discovery Institute

Query: PF11065.6; B2JIE5_BURP8/14-76; Protein of unknown function (DUF2866 topsan), from PfamA30U

Results of FFAS03 search in PfamA30U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60
1 -58.300PF11065.6; B2JIE5_BURP8/14-76; Protein of unknown function (DUF2866 topsan)  ali  100  1NLRGCRVSAPIQGPWGGGCRIVEWIDTAGQISRRVVAENVTADEVRETIRHHVEGRKHRLIDD 63
2 -7.410PF06234.10; F4CQX7_PSEUX/13-90; Toluene-4-monooxygenase system protein B (TmoB)  ali follow..  29  4....................VNAIFHTDFVQILVPVTTADTIAEVAEKVAYHVEGRR...... 40
3 -5.650PF13184.4; R7G7E2_9FIRM/231-297; NusA-like KH domain  ali follow..  28  26..RGTRVQVIIDELKGEKIDIFEWSDDVSEL----IKNALSPAEVLAV............... 67
4 -5.420PF12681.5; Q8TUF9_METAC/12-132; Glyoxalase-like domain  ali follow..  22  88......VHGLKEQPWGQ--RVIRFYDPDMHIVEIGEPME........................ 118
5 -5.240PF05875.10; F0XMI3_GROCL/14-282; Ceramidase  ali follow..  14  3..............WGEQTSTLNWCEEDYNITHYCAELVNTLTNLTFIW.............. 37
6 -5.180PF14893.4; G3QYD8_GORGO/1-326; PNMA  ali follow..  11  6....................LEDWCRGMDMNPRKAISQSCSVAEIEEALQAGLA......... 44
7 -5.140PF12489.6; F7A8J5_HORSE/199-329; Nuclear coactivator  ali follow..  11  42...SARACTFFSNVWGNLKGLENWLHKIAEKPSYQQSNSCSTTSSSSAEMEKVGDEELLEQDD 101
8 -5.130PF13120.4; Q81DH6_BACCR/1-126; Domain of unknown function (DUF3974 topsan)  ali follow..  15  49..KLSNKSIPFLQEFTQHPLFYRWIRTEGKKEQNTLSGQRTREQVFSMLPKEKQKKVHVM... 112
9 -5.040PF07347.10; T1ER87_HELRO/11-106; NADH:ubiquinone oxidoreductase subunit B14.5a (Complex I-B14.5a)  ali follow..  14  27...SPRSAPPPKLPPGINHKLSANLYYARDGRRQAEPMEKAETSVSSASSIPKPGSGY..... 95
10 -4.970PF09809.7; Q5AHY8_CANAL/35-132; Mitochondrial ribosomal protein L27  ali follow..  12  28...............GSWDSRGRYHINWEKVRTYVVPEGLNNTELKALVSPKSP......... 66

FFAS is supported by the NIH grant R01-GM087218-01
9 4 2 4 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Jaroszewski L, Rychlewski L, Zhang B, Godzik A. Fold prediction by a hierarchy of sequence, threading, and modeling methods. Protein Sci. 1998 Jun;7(6):1431-40.