current user: public




Query: PF11065.3; A4JK10_BURVG/20-84; Protein of unknown function (DUF2866 topsan), from PfamA26U

Results of FFAS03 search in PfamA26U
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .
# Score Template Links and tools%idFirst LPVQSCRVSVEMLRPWGRPYRLVEWTMHLDAPARRQIVPAESTDEQIAEVVASHVPGRLYGDGRLLast
1 -59.300PF11065.3; A4JK10_BURVG/20-84; Protein of unknown function (DUF2866 topsan)  ali  100  1LPVQSCRVSVEMLRPWGRPYRLVEWTMHLDAPARRQIVPAESTDEQIAEVVASHVPGRLYGDGRL 65
2 -7.540PF00610.16; DVL2_XENTR/427-496; Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP)  ali follow..  2LEVRDRMWLKITIPNAFLGSDMVDWLYHHVEGFQDRREARKFASNLLKAGLIRHTVNKIFSEQCY 67
3 -7.180PF06234.7; Q1LNS8_RALME/1-85; Toluene-4-monooxygenase system protein B (TmoB)  ali follow..  34  20....................................AVDTENTMDEVAAAAAHHSVGRR...... 42
4 -7.140PF04796.7; Q04559_9ZZZZ/74-235; Plasmid encoded RepA protein  ali follow..  14  2..............PYGSMPRTL-WICTEAVRTKDPVLNLGRSQSEFLQRLGMHTDGRYTAT... 50
5 -6.170PF13184.1; A8R7M5_9FIRM/231-299; NusA-like KH domain  ali follow..  20  23IGPRGTRVQVIIDELKGEKIDIFEWSDDVSELIKNALSPAEVLA..................... 66
6 -5.960PF00543.17; O54449_AZOVI/4-105; Nitrogen regulatory protein P-II  ali follow..  17  43...................YRGAEYVVDFLPKVKIDVAIEDSQLDHVIEAITKAANTGKIGDGKI 88
7 -5.960PF05367.6; A0ZXJ0_9CAUD/1-149; Phage endonuclease I  ali follow..  108....................SYAEFCEKHGILFADKLIPVAWLKEASRPVPFDKLKTKKEKN... 149
8 -5.810PF04037.8; Q9P5R7_NEUCR/162-290; Domain of unknown function (DUF382 topsan)  ali follow..  13  21VQIKAQRNIVPVPSHWSPPFKLPKFIAETGITEMRDAVLEKQAEQTLKQKQRERVQPK....... 92
9 -5.670PF08348.6; Q7W918_BORPA/13-128; YheO-like PAS domain  ali follow..  18  7....................QIAAGLGETLAPFTEVVVHDLRTPRHAILAIHNNLSGRTVGDP.. 49
10 -5.450PF00525.13; Q6EWH9_ORNAN/1-66; Alpha crystallin A chain, N terminal  ali follow..  15  1.......MDIAIHHPW---IRRPFWPFPTSSRIFDQGFGEHLLDSDLFPTSFPAFP......... 46

FFAS is supported by the NIH grant R01-GM087218-01
4 7 1 8 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.