current user: public

Query: PF11065.3; A4JK10_BURVG/20-84; Protein of unknown function (DUF2866 topsan), from PfamA26U

Results of FFAS03 search in PfamA26U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .
1 -59.300PF11065.3; A4JK10_BURVG/20-84; Protein of unknown function (DUF2866 topsan)  ali  100  1LPVQSCRVSVEMLRPWGRPYRLVEWTMHLDAPARRQIVPAESTDEQIAEVVASHVPGRLYGDGRL 65
2 -7.540PF00610.16; DVL2_XENTR/427-496; Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP)  ali follow..  2LEVRDRMWLKITIPNAFLGSDMVDWLYHHVEGFQDRREARKFASNLLKAGLIRHTVNKIFSEQCY 67
3 -7.180PF06234.7; Q1LNS8_RALME/1-85; Toluene-4-monooxygenase system protein B (TmoB)  ali follow..  34  20....................................AVDTENTMDEVAAAAAHHSVGRR...... 42
4 -7.140PF04796.7; Q04559_9ZZZZ/74-235; Plasmid encoded RepA protein  ali follow..  14  2..............PYGSMPRTL-WICTEAVRTKDPVLNLGRSQSEFLQRLGMHTDGRYTAT... 50
5 -6.170PF13184.1; A8R7M5_9FIRM/231-299; NusA-like KH domain  ali follow..  20  23IGPRGTRVQVIIDELKGEKIDIFEWSDDVSELIKNALSPAEVLA..................... 66
6 -5.960PF00543.17; O54449_AZOVI/4-105; Nitrogen regulatory protein P-II  ali follow..  17  43...................YRGAEYVVDFLPKVKIDVAIEDSQLDHVIEAITKAANTGKIGDGKI 88
7 -5.960PF05367.6; A0ZXJ0_9CAUD/1-149; Phage endonuclease I  ali follow..  108....................SYAEFCEKHGILFADKLIPVAWLKEASRPVPFDKLKTKKEKN... 149
8 -5.810PF04037.8; Q9P5R7_NEUCR/162-290; Domain of unknown function (DUF382 topsan)  ali follow..  13  21VQIKAQRNIVPVPSHWSPPFKLPKFIAETGITEMRDAVLEKQAEQTLKQKQRERVQPK....... 92
9 -5.670PF08348.6; Q7W918_BORPA/13-128; YheO-like PAS domain  ali follow..  18  7....................QIAAGLGETLAPFTEVVVHDLRTPRHAILAIHNNLSGRTVGDP.. 49
10 -5.640PF14733; Q4N6P4.1/451-540; AP2-coincident C-terminal  ali follow..  12  57....................EVLPYINSLAHYICKGITPTDMTHFELYSLINT............ 89

FFAS is supported by the NIH grant R01-GM087218-01
7 6 8 9 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Shiryaev SA, Ratnikov BI, Chekanov AV, Sikora S, Rozanov DV, Godzik A,Wang J, Smith JW, Huang Z, Lindberg I, Samuel MA, Diamond MS, Strongin AY. Cleavage targets and the D-arginine-based inhibitors of the West Nile virus NS3 processing proteinase. Biochem J. 2006 Jan 15;393(Pt 2):503-11.