current user: public




Query: PF10164.7; H3AX96_LATCH/28-133; Uncharacterized conserved protein (DUF2367 topsan), from PfamA30U

Results of FFAS03 search in PfamA30U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
# Score Template Links and tools%idFirst SYGTIPAAQVGFQPPPPYPYPAAPGFSGGPPPASVQPPYSSTYTIIQQPATTSVVVVGGCPACRVGVLEDDFTCLGILCAIVFFPIGILFCLALRQRRCPNCGATFLast
1 -50.100PF10164.7; H3AX96_LATCH/28-133; Uncharacterized conserved protein (DUF2367 topsan)  ali  100  1SYGTIPAAQVGFQPPPPYPYPAAPGFSGGPPPASVQPPYSSTYTIIQQPATTSVVVVGGCPACRVGVLEDDFTCLGILCAIVFFPIGILFCLALRQRRCPNCGATF 106
2 -10.500PF10601.7; G2QUW3_THITE/67-133; LITAF-like zinc ribbon domain  ali follow..  21  8...........................................................CPFCHRRTLTREGTSMQILAGILCCLFCVCLACVETIYVCTQCNKKV 65
3 -9.470PF10176.7; M1VXF7_CLAP2/112-320; Protein of unknown function (DUF2370 topsan)  ali follow..  11  2LSDSRPRVVGGGVGSDGVFANLSAKPDRTESEKDELPPSYEQAAADAAPPYWETTILAPGIGGLDEVYVDGMPVWNGMISTSFQLVGFLLTYLLHSTHAAKNGSR. 113
4 -9.010PF05808.9; F6ZBL8_HORSE/19-167; Podoplanin  ali follow..  10  51SAGLTALVPTNTESITDIHTEVLPTPGNTVHAQEETQITTPNVVASHSMEKVGEETQTTVEDNGLVTVTLVRIRVGVLLAIGFIS-RVIIVVMKRSGRYS...... 149
5 -8.610PF15347.4; PHAG1_HUMAN/2-432; Phosphoprotein associated with glycosphingolipid-enriched  ali follow..  25  16.........................................................................LWGSLAAVAIFFVITFLIFL-----CSSC.... 39
6 -8.470PF15616.4; Q5NWS3_AROAE/221-349; TerY-C metal binding domain  ali follow..  19  50................................EKDYYELSDPRAMARTINTDALIGAPGCPHCGNRF------------GLAMCGCGIFCVSGTGEATCPGCNQT. 111
7 -8.380PF11023.6; Y906_OCEIH/6-116; Zinc-ribbon containing domain  ali follow..  37  40.......................................................................FFILGTLMVIVYVWIGTLSLRA-VPVICPSCEKPT 77
8 -8.180PF02038.14; G5BXJ8_HETGA/138-184; ATP1G1/PLM/MAT8 family  ali follow..  25  11.....................................................................PTLRKQGLLVAAVLFITGIVILTSKNGIRGKG..... 42
9 -8.050PF03229.11; Q9IZ54_CHV1/1-129; Alphavirus glycoprotein J  ali follow..  16  20....TPKAALATGANATAGVANATATAGVANATDAEATSPGAAATSAAVVTPPPTDSTQTAETPGPSPPTDFAVIGGLCALTLAAMGAGALL---RRRCRRAA... 118
10 -7.900PF14353.4; R6EE02_9BACE/9-141; CpXC protein  ali follow..  17  2..........................................................TCSQCGKEHDIQTYPNINIKDGTLF------------LWTCPDCGQVN 47

FFAS is supported by the NIH grant R01-GM087218-01
8 2 7 8 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Godzik A. Fragnostic: walking through protein structure space. Nucleic Acids Res. 2005 Jul 1;33(Web Server issue):W249-51.