current user: public




Query: PF10126.7; F4BUV1_METCG/1-107; Uncharacterized protein, homolog of nitrogen regulatory protein PII, from PfamA30U

Results of FFAS03 search in PfamA30U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
# Score Template Links and tools%idFirst MKTMVKIFVDHEHLVRVINSLTELGITGFYLIEYQGMAPTNWKSFQLSEDPDMALKAIRDHSEPGVMVNTVVGPDKCQRLIKELEEALKGIRFTIIGHQVNSIKVKGLast
1 -70.800PF10126.7; F4BUV1_METCG/1-107; Uncharacterized protein, homolog of nitrogen regulatory protein PII  ali  100  1MKTMVKIFVDHEHLVRVINSLTELGITGFYLIEYQGMAPTNWKSFQLSEDPDMALKAIRDHSEPGVMVNTVVGPDKCQRLIKELEEALKGIRFTIIGHQVNSIKVKG 107
2 -8.390PF11582.6; Q89MS9_BRADU/2-103; Protein of unknown function (DUF3240 topsan)  ali follow..  12  4.YVCLSLILARKLREELLDFLSPGQTSGFTVSDAAGHGSGVQLPTAAER------------HADQVHVQIVLPGADARRLVDQLRHSFAGCNLVYWIAPVAE..... 97
3 -7.540PF02763.12; Q6NK15_CORDI/26-212; Diphtheria toxin, C domain  ali follow..  14  3...........DDVVDSSKSFVMENFSSYHKSGTQGNYDDDWKGFYSTDNKYDAAGYSVDNGKAGGVVKVTYPGLTKVLALKVDNAETIKKELGL............ 108
4 -6.870PF03197.11; Y14D_BPT4/26-128; Bacteriophage FRD2 protein  ali follow..  14  46................................DYFELSEEEFYCFREYKEPTSEEDEVKDKVSGVTKIHCIVDENNVDEIIELLRKTFK.................. 102
5 -6.270PF12444.6; F6XIA1_MONDO/22-100; Sox developmental protein N terminal  ali follow..  13  51........................................................................DDRFPACIRDAVSQVLKGYDWSLVPMPVR...... 79
6 -6.190PF00543.20; C1DJ64_AZOVD/4-105; Nitrogen regulatory protein P-II  ali follow..  18  1....VTAIIKPFKLDDVRESLSEIGVQGITVTEVKGFGRQKGHT-ELYRGAEYVVDFL-----PKVKIDVAIEDSQLDHVIEAITKAANTGK............... 82
7 -5.920PF04168.10; K0I8G2_9BURK/1-314; A predicted alpha-helical domain with a conserved ER motif.  ali follow..  16  12...MSRYTERAENTARMLNVLSISELIPAYTAKHGEVTPAHVLEFMVGNNPSSILSCLRAARENARAVRGALTTEVWETQNQT........................ 114
8 -5.610PF03445.11; A1VJH4_POLNA/291-424; Putative nucleotidyltransferase DUF294 topsan  ali follow..  7ISLLQRSGTHINMIARLVQELNAKLFERAWQLIAPPDLVANSCLFVMGSEGRGEQLLKTDQDNGLVLRDGYEPACDVAAVCRRFSAALADFGYPPCPGNIM...... 107
9 -5.300PF01374.16; C6WIU3_ACTMD/193-402; Glycosyl hydrolase family 46  ali follow..  102.......ERDRVYFTPSVNQAKSDGLR-YDAIVMHGGGTDQASFGTIRRKAMARAKTPAQGGDETAYLHAFLDEHEDTSRVDTAQRVFLNNGNLDLNTPL....... 210
10 -5.250PF09813.7; B0JZX9_XENTR/1-100; Coiled-coil domain-containing protein 56  ali follow..  15  52..................NLVTGLVIGGIYGYTFYSVSQEKFLDELEVEAKAARASYPKTSAN............................................ 100

FFAS is supported by the NIH grant R01-GM087218-01
8 2 8 7 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Jaroszewski L, Ye Y, Godzik A. The interplay of fold recognition and experimental structure determination in structural genomics. Curr Opin Struct Biol. 2004 Jun;14(3):307-12.