current user: public




Query: PF09484.5; B0K555_THEPX/4-643; CRISPR-associated protein TM1802 (cas_TM1802), from PfamA26U

Results of FFAS03 search in PfamA26U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .  590    .  600    .  610    .  620    .  630    .  640
# Score Template Links and tools%idFirst IIEGIVQIGDIVRENDPVKNIIVELPYKKGDNALHVLKFNFLPEENKLEIDVNEEMDEGTVFKYLYVGKILGNSPLWYASSTSSDYILTETIYNLTKMDFGEELNKKLKDIFEKFYVSIEELEPKYRYVLDLSKSGYKEKSVQDLFKEIKEDKKNENLSPNEIGKKFRKKVSKYFEGYLKKEKNIEPEEIGLYTVFIEGKPLSSYKEYVDAVIESKKPKTQKTKKAGISRGVCSICGSQDAIAFDSSKVKFKFFTTNQIIFASSLSKNNYYKNMQMCSECFSKYQAGENYISNKLSTKLTAFDVLIIPQFIHGKPISKYDLEIATDKIIDSFNTVKSYEGIERLREEIGTSLDLTDEKSYFLLNFIFYEIDSQATKILRLIKDVDPSIFERVRIALENANKDVKEILGEKYKGTITLSTVYYINPIRIKDGKAVKYRDILEIYDAILTGKNLSKKHIINNLVDGVRIIKFKKGGYNIIPEKRYIEFYLLEASMYVKFLEYMGCLKEGERLDVSQLKIDENIKTFISNMNYNEQETAMFLLGYLIGQIGNVQYKKAQKGIQDEGTPNKPILNKINFNGLDKQKIIRLTKDVFNKLNQEKILHYNEVTFYDMKRLIDSNIRNWKLNKDESLFYVLSGYSYATLast
1 -157.000PF09484.5; B0K555_THEPX/4-643; CRISPR-associated protein TM1802 (cas_TM1802)  ali  100  1IIEGIVQIGDIVRENDPVKNIIVELPYKKGDNALHVLKFNFLPEENKLEIDVNEEMDEGTVFKYLYVGKILGNSPLWYASSTSSDYILTETIYNLTKMDFGEELNKKLKDIFEKFYVSIEELEPKYRYVLDLSKSGYKEKSVQDLFKEIKEDKKNENLSPNEIGKKFRKKVSKYFEGYLKKEKNIEPEEIGLYTVFIEGKPLSSYKEYVDAVIESKKPKTQKTKKAGISRGVCSICGSQDAIAFDSSKVKFKFFTTNQIIFASSLSKNNYYKNMQMCSECFSKYQAGENYISNKLSTKLTAFDVLIIPQFIHGKPISKYDLEIATDKIIDSFNTVKSYEGIERLREEIGTSLDLTDEKSYFLLNFIFYEIDSQATKILRLIKDVDPSIFERVRIALENANKDVKEILGEKYKGTITLSTVYYINPIRIKDGKAVKYRDILEIYDAILTGKNLSKKHIINNLVDGVRIIKFKKGGYNIIPEKRYIEFYLLEASMYVKFLEYMGCLKEGERLDVSQLKIDENIKTFISNMNYNEQETAMFLLGYLIGQIGNVQYKKAQKGIQDEGTPNKPILNKINFNGLDKQKIIRLTKDVFNKLNQEKILHYNEVTFYDMKRLIDSNIRNWKLNKDESLFYVLSGYSYAT 640
2 -18.800PF09709.5; Q39WR8_GEOMG/6-576; CRISPR-associated protein (Cas_Csd1)  ali   24....................................FLIVLNGDGTFGDFQDTRNRSGKKLIARQFRRSGKNAWQSANLLWDHYGYVLCWPKSDSDA---------------------------------DKEMARKQHGTFVERVGELAAAYPQDKGVQAVMRFLKSDEREKLLEHPAWEECRKIPGCNLSFRLSDELSLVCESDNVREFVAKSSAQDDDEDSTTGDVEGICLVTGESATVARLHPRTPIKIVSFQKNMGFDSYGRQQS-YNAPTSKGAAFAYTTALNHLLAKESRQKLLIGSDTMVFWAGEKHRVEDLFADLFGEPAKENLDQTTQAIRSLYTAPQAGTPPLDHDLTPFFV--LGLAPNAARIAVRFWHAGTVGETARHIRQHFDDCA--------VHGPNQPEYLSLFRLLTAMQGKSENIPPNLAGDLMKSILAGTPYPQS-LLSAAIRRCRAEREITYPRVSVIKAVLARGT----------------------------RYYTSNEQEVGMALDVTNTNPGYRLGRLFAVLEKIQ--EEASPGINATIRDRFYGAASGTPVAAFPHLMKLKNHHLAKLENRGRAVNLEKIVGEIMDGLDDFPTHLSLQDQGR---FAVGY.... 562
3 -9.930PF01844.18; Q984I3_RHILO/259-314; HNH endonuclease  ali   14  1........................................................................................................................................................................................................................................CEVCDMTFQKHYGDHGKGFEVHHIDPIALSEEGRRTTLAQLACVCSNCHKMLHRG................................................................................................................................................................................................................................................................................................................................................................. 56
4 -9.830PF13542.1; B2SSB8_XANOP/29-93; Helix-turn-helix domain of transposase family ISL3  ali   18  1..................................................................................................................................................................................................................................SNPPGVCTACGSDRLIGHGRNEQVVRDLPTHGKRLAIYVDTRRW-----RCQSCGKTFMEPLPAVNAKRE........................................................................................................................................................................................................................................................................................................................................................ 65
5 -9.370PF06147.6; A4WC52_ENT38/128-326; Protein of unknown function (DUF968)  ali   10  110.....................................................................................................................................................................................................................PKRNRWVNDKYTRWVKAQPCVCCNQQADDP----------HHLIGHGQGGMGTKAHDLFVIPLCREHHDELHADPVAFEAKYGDQ...................................................................................................................................................................................................................................................................................................................................................... 184
6 -8.600PF09986.4; Q04ZY0_LEPBL/15-282; Uncharacterized protein conserved in bacteria (DUF2225)  ali   1.................................................................................................................................................................................................................................RAKEDTVCPICNEVENMFQGGGRLIAGKLTIE---LRRLYEKNKKFGRV-VCPRC------LYSSFSKDWS------------------TLDGEENEKIRSQFETRRSNLEKILGPLDFYQDRNLVLGAASYLLAIECYQNRKVTVAPTPKKAVCA------RGAWYFDDLNNDFPN-----------------------MGFDKVRDLLYQKSASWYTETMEIMQSGSEPV-DQASYLLGPDTDKN----------------------------------------------------------WAFDGVIYLSAYLTMKFKDELAPDPATKLNLLVRAKRTLSRLYGSGKGSKSKPSVIIDMAKELYDEY........................................... 268
7 -7.960PF10621.4; Q466B9_METBF/1-122; F420H2 dehydrogenase subunit FpoO  ali   16  51............................................................................................................................................................................................................................INKDEISCRRNKCVLCGKKGRV-------------YPVEIQIPDFSKGVVIKKVNVCTKCLDSINETYIRFKRE.......................................................................................................................................................................................................................................................................................................................................................... 111
8 -7.920PF01363.16; A7TSD4_VANPO/12-89; FYVE zinc finger  ali   20  23...................................................................................................................................................................................................................................IRKHHCRSCGG---IFCASCSDYFVRYDTDRVKVVKRWPAEEEYAPYRTCDSCYKNLL................................................................................................................................................................................................................................................................................................................................................................... 77
9 -7.500PF03691.9; A7VE29_9CLOT/112-287; Uncharacterised protein family (UPF0167)  ali   4...........................................................................................................................................................................................................GLPAFRYHPYPLETGAFEE----SADGVVCDCCGKTTHVFYTNP-----FFSVEDIAY--------------LCPECIASGEAVRKYKLDELIHRTPGYSGWQQEYWRAHCGDYCAFLGYVGARELRALGVLEEVLDDPMWDEEQKDMIRESVNGGHLQ--YLFQCLHCGKHLVWMDFD.................................................................................................................................................................................................................................................................. 176
10 -7.370PF14616; Q6C221.1/287-397; Domain of unknown function (DUF4451)  ali follow..  14  21................................................................................................................................................................................................................................SKVDIHGQCRYCGERNHSYSSHMYSKHGISATTNNVLPLPTKISSIENK-GYCSICRTNVDLNERAKENEWISWF..................................................................................................................................................................................................................................................................................................................................................... 105

FFAS is supported by the NIH grant R01-GM087218-01
6 6 1 9 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Berman HM, Burley SK, Chiu W, Sali A, Adzhubei A, Bourne PE, Bryant SH,Dunbrack RL Jr, Fidelis K, Frank J, Godzik A, Henrick K, Joachimiak A, HeymannB, Jones D, Markley JL, Moult J, Montelione GT, Orengo C, Rossmann MG, Rost B,Saibil H, Schwede T, Standley DM, Westbrook JD. Outcome of a workshop on archiving structural models of biological macromolecules. Structure. 2006 Aug;14(8):1211-7.