current user: public



Announcement: our server is upgraded to a faster system. If you experience any issues during this period please let us know.

PF09484
Query: PF09484.5; B0K555_THEPX/4-643; CRISPR-associated protein TM1802 (cas_TM1802), from PfamA26U

Results of FFAS03 search in PfamA26U
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .  590    .  600    .  610    .  620    .  630    .  640
# Score Template Links and tools%idFirst IIEGIVQIGDIVRENDPVKNIIVELPYKKGDNALHVLKFNFLPEENKLEIDVNEEMDEGTVFKYLYVGKILGNSPLWYASSTSSDYILTETIYNLTKMDFGEELNKKLKDIFEKFYVSIEELEPKYRYVLDLSKSGYKEKSVQDLFKEIKEDKKNENLSPNEIGKKFRKKVSKYFEGYLKKEKNIEPEEIGLYTVFIEGKPLSSYKEYVDAVIESKKPKTQKTKKAGISRGVCSICGSQDAIAFDSSKVKFKFFTTNQIIFASSLSKNNYYKNMQMCSECFSKYQAGENYISNKLSTKLTAFDVLIIPQFIHGKPISKYDLEIATDKIIDSFNTVKSYEGIERLREEIGTSLDLTDEKSYFLLNFIFYEIDSQATKILRLIKDVDPSIFERVRIALENANKDVKEILGEKYKGTITLSTVYYINPIRIKDGKAVKYRDILEIYDAILTGKNLSKKHIINNLVDGVRIIKFKKGGYNIIPEKRYIEFYLLEASMYVKFLEYMGCLKEGERLDVSQLKIDENIKTFISNMNYNEQETAMFLLGYLIGQIGNVQYKKAQKGIQDEGTPNKPILNKINFNGLDKQKIIRLTKDVFNKLNQEKILHYNEVTFYDMKRLIDSNIRNWKLNKDESLFYVLSGYSYATLast
1 -157.000PF09484.5; B0K555_THEPX/4-643; CRISPR-associated protein TM1802 (cas_TM1802)  ali  100  1IIEGIVQIGDIVRENDPVKNIIVELPYKKGDNALHVLKFNFLPEENKLEIDVNEEMDEGTVFKYLYVGKILGNSPLWYASSTSSDYILTETIYNLTKMDFGEELNKKLKDIFEKFYVSIEELEPKYRYVLDLSKSGYKEKSVQDLFKEIKEDKKNENLSPNEIGKKFRKKVSKYFEGYLKKEKNIEPEEIGLYTVFIEGKPLSSYKEYVDAVIESKKPKTQKTKKAGISRGVCSICGSQDAIAFDSSKVKFKFFTTNQIIFASSLSKNNYYKNMQMCSECFSKYQAGENYISNKLSTKLTAFDVLIIPQFIHGKPISKYDLEIATDKIIDSFNTVKSYEGIERLREEIGTSLDLTDEKSYFLLNFIFYEIDSQATKILRLIKDVDPSIFERVRIALENANKDVKEILGEKYKGTITLSTVYYINPIRIKDGKAVKYRDILEIYDAILTGKNLSKKHIINNLVDGVRIIKFKKGGYNIIPEKRYIEFYLLEASMYVKFLEYMGCLKEGERLDVSQLKIDENIKTFISNMNYNEQETAMFLLGYLIGQIGNVQYKKAQKGIQDEGTPNKPILNKINFNGLDKQKIIRLTKDVFNKLNQEKILHYNEVTFYDMKRLIDSNIRNWKLNKDESLFYVLSGYSYAT 640
2 -18.800PF09709.5; Q39WR8_GEOMG/6-576; CRISPR-associated protein (Cas_Csd1)  ali follow..  24....................................FLIVLNGDGTFGDFQDTRNRSGKKLIARQFRRSGKNAWQSANLLWDHYGYVLCWPKSDSDA---------------------------------DKEMARKQHGTFVERVGELAAAYPQDKGVQAVMRFLKSDEREKLLEHPAWEECRKIPGCNLSFRLSDELSLVCESDNVREFVAKSSAQDDDEDSTTGDVEGICLVTGESATVARLHPRTPIKIVSFQKNMGFDSYGRQQS-YNAPTSKGAAFAYTTALNHLLAKESRQKLLIGSDTMVFWAGEKHRVEDLFADLFGEPAKENLDQTTQAIRSLYTAPQAGTPPLDHDLTPFFV--LGLAPNAARIAVRFWHAGTVGETARHIRQHFDDCA--------VHGPNQPEYLSLFRLLTAMQGKSENIPPNLAGDLMKSILAGTPYPQS-LLSAAIRRCRAEREITYPRVSVIKAVLARGT----------------------------RYYTSNEQEVGMALDVTNTNPGYRLGRLFAVLEKIQ--EEASPGINATIRDRFYGAASGTPVAAFPHLMKLKNHHLAKLENRGRAVNLEKIVGEIMDGLDDFPTHLSLQDQGR---FAVGY.... 562
3 -9.930PF01844.18; Q984I3_RHILO/259-314; HNH endonuclease  ali follow..  14  1........................................................................................................................................................................................................................................CEVCDMTFQKHYGDHGKGFEVHHIDPIALSEEGRRTTLAQLACVCSNCHKMLHRG................................................................................................................................................................................................................................................................................................................................................................. 56
4 -9.830PF13542.1; B2SSB8_XANOP/29-93; Helix-turn-helix domain of transposase family ISL3  ali follow..  18  1..................................................................................................................................................................................................................................SNPPGVCTACGSDRLIGHGRNEQVVRDLPTHGKRLAIYVDTRRW-----RCQSCGKTFMEPLPAVNAKRE........................................................................................................................................................................................................................................................................................................................................................ 65
5 -9.370PF06147.6; A4WC52_ENT38/128-326; Protein of unknown function (DUF968 topsan)  ali follow..  10  110.....................................................................................................................................................................................................................PKRNRWVNDKYTRWVKAQPCVCCNQQADDP----------HHLIGHGQGGMGTKAHDLFVIPLCREHHDELHADPVAFEAKYGDQ...................................................................................................................................................................................................................................................................................................................................................... 184
6 -8.600PF09986.4; Q04ZY0_LEPBL/15-282; Uncharacterized protein conserved in bacteria (DUF2225 topsan)  ali follow..  1.................................................................................................................................................................................................................................RAKEDTVCPICNEVENMFQGGGRLIAGKLTIE---LRRLYEKNKKFGRV-VCPRC------LYSSFSKDWS------------------TLDGEENEKIRSQFETRRSNLEKILGPLDFYQDRNLVLGAASYLLAIECYQNRKVTVAPTPKKAVCA------RGAWYFDDLNNDFPN-----------------------MGFDKVRDLLYQKSASWYTETMEIMQSGSEPV-DQASYLLGPDTDKN----------------------------------------------------------WAFDGVIYLSAYLTMKFKDELAPDPATKLNLLVRAKRTLSRLYGSGKGSKSKPSVIIDMAKELYDEY........................................... 268
7 -7.960PF10621.4; Q466B9_METBF/1-122; F420H2 dehydrogenase subunit FpoO  ali follow..  16  51............................................................................................................................................................................................................................INKDEISCRRNKCVLCGKKGRV-------------YPVEIQIPDFSKGVVIKKVNVCTKCLDSINETYIRFKRE.......................................................................................................................................................................................................................................................................................................................................................... 111
8 -7.920PF01363.16; A7TSD4_VANPO/12-89; FYVE zinc finger  ali follow..  20  23...................................................................................................................................................................................................................................IRKHHCRSCGG---IFCASCSDYFVRYDTDRVKVVKRWPAEEEYAPYRTCDSCYKNLL................................................................................................................................................................................................................................................................................................................................................................... 77
9 -7.500PF03691.9; A7VE29_9CLOT/112-287; Uncharacterised protein family (UPF0167 topsan)  ali follow..  4...........................................................................................................................................................................................................GLPAFRYHPYPLETGAFEE----SADGVVCDCCGKTTHVFYTNP-----FFSVEDIAY--------------LCPECIASGEAVRKYKLDELIHRTPGYSGWQQEYWRAHCGDYCAFLGYVGARELRALGVLEEVLDDPMWDEEQKDMIRESVNGGHLQ--YLFQCLHCGKHLVWMDFD.................................................................................................................................................................................................................................................................. 176
10 -7.370PF14616; Q6C221.1/287-397; Domain of unknown function (DUF4451 topsan)  ali follow..  14  21................................................................................................................................................................................................................................SKVDIHGQCRYCGERNHSYSSHMYSKHGISATTNNVLPLPTKISSIENK-GYCSICRTNVDLNERAKENEWISWF..................................................................................................................................................................................................................................................................................................................................................... 105

FFAS is supported by the NIH grant R01-GM087218-01
6 1 2 2 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.