current user: public




Query: PF07931.10; Q98FG2_RHILO/59-238; Chloramphenicol phosphotransferase-like protein, from PfamA30U

Results of FFAS03 search in PfamA30U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180
# Score Template Links and tools%idFirst ARIVLLNGVGSAGKSSIARALQTITAAPFLHVQMDSFLEMLPDALQDHADGFSYETVRQDGKPAVVIRAGPVGERTLRGMRHAIAAMAGQGNDLIVDDVLCNGELSDCVDLLSAFDFHLVGVMAPLEVLEAREARRADRLPGLARWQYERVHAGISYDLEVDTSQSTPLECARRIQQRFQLast
1 -96.400PF07931.10; Q98FG2_RHILO/59-238; Chloramphenicol phosphotransferase-like protein  ali  100  1ARIVLLNGVGSAGKSSIARALQTITAAPFLHVQMDSFLEMLPDALQDHADGFSYETVRQDGKPAVVIRAGPVGERTLRGMRHAIAAMAGQGNDLIVDDVLCNGELSDCVDLLSAFDFHLVGVMAPLEVLEAREARRADRLPGLARWQYERVHAGISYDLEVDTSQSTPLECARRIQQRFQ 180
2 -30.200PF13671.4; B2JHT3_BURP8/20-178; AAA domain  ali follow..  14  1..LVFICGHAGTGKTTLAKRLIGPLMKACCLLDKDTLYGVYSAAAIGALTGDPNDRDSPLFLQHFRDPE-------YRGLFDTAAENLRLGIGVIAVGPLSREVRERWLGVPKDAKISVVWVSTSEETARERIAARGNPNDAYKLAHWEDYRQ........................... 154
3 -28.300PF01583.18; PAPS1_HUMAN/51-209; Adenylylsulphate kinase  ali follow..  18  2GCTVWLTGLSGAGKTTVSMALEEYLGIPCYTLDGDNIRQGLNKNLGFSPEDREEN---------------------VRRIAEVAKLFADAGLVCITSFISPYTQDRNNARQIASLPFFEVFVDAPLHVCEQRDKARAGEIKGFTGID-SEYEKPEAPELVLKTDSCDV............ 159
4 -22.800PF08433.8; O46079_DROME/1-293; Chromatin associated protein KTI12  ali follow..  12  3..LVVITGLPASGKSTRARQLRDHFVERGRKISENEAVPKA------------------GFGKNSHTGDSQKEKVVRSDLKSEASRHLNQEDLVILDAGNYIKGYRYELYCMSRTTQCTVFTCIPQEEAWTFNSQRTAPDELPGDSERVQPVD--------NSDVPYTRETFDALCQRYE 160
5 -20.800PF06414.10; Q8P580_XANCP/35-230; Zeta toxin  ali follow..  14  15.KAIILAGQPGSGKGSLARAADVELGRDVVLIDPDELRNAHPE----------VSALRNAHPYTWSGYTHSDASQWADELLQVT---IEGKKNLIFDTTLSNQWSAELIKDLQGYDVEVRAMAAHKLESEHGVDSRFSQ--QLDREGYGRYVPESHREVVYTRLPISLDTVHAQTTAPVR 181
6 -19.800PF08303.9; Q6CK12_KLULA/389-554; tRNA ligase kinase domain  ali follow..  1..LLVTIATIGCGKSTVSLTLNELFPESWGLVVNDNITSN-------------------------------------TDYIKSALQLFKDGKQFVLAD-HQFRERAAVFEWINQYNLQVIALPEMRALTIDRVMKRGDKSESDDQQKVLKIMQGFMNRFQPFLPSKDPDNKFDFHIQ... 162
7 -18.700PF13238.4; Q5ZL96_CHICK/5-160; AAA domain  ali follow..  15  1...IGIGGVTNGGKTTLTRRLMQALPNCSV-VHQDDFFKPQDEIEVEDGEAMMSTINAWIKNPVKFERSHGINNTLDAQISPDREGRDEAVHILIVEGFLLYTY-----RPLIDVFHHRYFLSIPYEECKRRRSSRN........................................... 140
8 -17.900PF00625.19; KGUA_ECOLI/4-186; Guanylate kinase  ali follow..  12  1GTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRPGEVHGEH-VNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFLD--IDWQGAQQIRQKMPHARSIFI-LPPSKIELDRRLRGRGQDSEEVIAKRMAEMSHYAEYDYLIDDFDTALTDLKTIIRAE.. 183
9 -16.200PF02224.16; KCY_MYCPN/5-213; Cytidylate kinase  ali follow..  14  1...IAIDGPSSSGKSSVAKTVARQLG--FEYFSTGKMYRAFAYVMQVNRNNADISEVILNQEIAQLASNLATNPEVRKMAVLRQQALAKNT-NIVMDG-------RDIGTVVLKDAQLKYFLDAKPEIRAQRRAQDLGIAYDSDKAFQELVAEIKHRDIYIDSSNLTFQQVVELMVQQAR 208
10 -14.600PF01202.20; Q989Q3_RHILO/2196-2352; Shikimate kinase  ali follow..  14  1.........KGAGKSSLGRALAKRLGMRF--VDSDRKIEAKTG-----------KSVAKIVAEDGEAYFRDLEVNEIRQSLELGSAVLATGGEAFMI--------EEIRHYVGEKAVS-IWLNTSEDVIRRNLRDNIRGPKVQTADQAQTITD-TLADLTIAPQHERDLKNANACLTALH 157
11 -14.300PF01712.17; DCK_BACSU/12-212; Deoxynucleoside kinase  ali follow..  13  1...ITVAGTVGVGKSTLTKTLAKRLGFKTSLEEVDHYLEKFYHDFERWSFHLQIYFLAERFKEQKTIFEAGGGFVQDRSIYEDTGIFAK---MHADKGTMSKVDYKTYTSLFEAMPDVLIYLEGDLENILNRIEQRGREMELQTSRSY-WEEMHTRYELKLRIEDYD-ENSIENIVDQIA 197
12 -14.200PF17213.1; F6ZLU4_XENTR/1991-2193; Hydin Adenylate kinase-like domain  ali follow..  28  1..AIIVHGAPLTGKSSAAVTLAQHYNIP--CLSIDSVVL............................................................................................................................................. 35
13 -14.100PF00693.16; KITH_VZVD/19-298; Thymidine kinase from herpesvirus  ali follow..  12  1.......GAYGIGKTTAAEEFLHHFASYWRNLAGEDAICGIYGTQTRRLNGDVSPEDAQRLTAHFQSLFCSPHAIMHAKISALMDTSTEPYKIMLSDGDMSPAALPGLLFTLPAEP-NLVVCTVSLPSHLSRVSKRARPGETVNLPFVMVLRN--VYIMLINT................. 194
14 -14.000PF13401.4; B2UJB3_RALPJ/42-210; AAA domain  ali follow..  19  4ESILLVCGPTGAGKTTLAKFMVENAHSPAIYVQAPLFYQRILNQLGDDLDSPKVAYGVDSLSGRLVRPRGTSGNSLAALRTAVERGLRARQVQMVIDEA-RNSKLEVQLDTLKGTQIVLVGSYDLYHLV................................................... 169
15 -13.800PF03668.13; RAPZ_ECOLI/1-282; P-loop ATPase protein family  ali follow..  16  2.VLMIVSGRSGSGKSVALRALEDM------FYCVDNLPVVLLPDLAR---------TLADREISAAVSIDVRNMPESPEIFEQAMSNLPDAFSLLFLDADRNTLIRRYSDTRRLHPLSSKNLSLESAIDKESDLLEPLRSRA---------------DLIVDTSEMSVHELAEMLRTRL. 152
16 -13.200PF13521.4; A4CIV1_ROBBH/14-173; AAA domain  ali follow..  14  2...VVLFGPESTGKTTLARELARHYGEPWV------------PEYAREYLQEKWDRVQQTCAPEDLLPIARGQMRLENIGAREASRLLICDTDLLETKVYYGGGCDPKLQAAALANDYDLYFLTDIDIPWEADDLRDK.......................................... 128
17 -13.100PF00485.16; KPPR_SYNY3/10-192; Phosphoribulokinase / Uridine kinase family  ali follow..  1..LIGVAGDSGCGKSTFLRRLTDLFGEEFMVICLDDYHSLDRQGRKAAGVTALDPRANNFDLMYEQIKTLKSGQSIMKPIYNHETEKVEPNKVVVIEGLHP------YDERVRELVDFGVYLDISEEVKINWKIQRDERGHTYEDILASINARKPDFTAYIEPQ----KQYADVVIQ... 175
18 -12.900PF01637.16; A8M939_CALMQ/15-228; ATPase domain predominantly from Archaea  ali follow..  13  20WNPVVIYGPEGCGKSAFLKQAVEVLGEYDYSVKVSPLEDESNEKLRYSEELRGLFRDIMTRIPTPFNDASALIDIAISLLYDVVRRRIRRKIALLADDV................................................................................. 119
19 -12.800PF04665.10; Q6TUP8_YMTV5/6-246; Poxvirus A32 protein  ali follow..  11  16...IALVGGSGSGKTAYLLSLFNTFVEKYRHI----FLFTPVYNSEYDSYIWPDHVNRVTTYEELDYSLITTKQKIEKYVKKQGNDKTTEMFLLILDDMGDKQIRSSCLLDFRHLNTSIILLCQTYKHVPVNGRTSIT.......................................... 150
20 -12.800PF03266.13; NTPTH_METAC/3-167; NTPase  ali follow..  2...IAVTGSPGVGKSTVVAKTAEKLAEK-------KIGGIRTAEIRKEGHREGFSIRDLATGKTGILSHVKGSGPRLGKYHVNLDDLERIGANVVIDEIISQSFVSAVEEVLESDKPVLAVLHHSSRHPLAQRFRKGFEVLTVDKGNRDELPE........................... 162
21 -12.600PF04275.12; F8W4R0_DANRE/22-132; Phosphomevalonate kinase  ali follow..  12  1.....FSGKRKSGKDYVTDLIQKRLTAEICCI-SAPLKEQYAKDHNLDYEELMGSGQYKESYRADMIHWGEMKRQEDSGFFCRLAIKHATQPVWIISDCRRMSDVQWFREA..................................................................... 108
22 -12.200PF13207.4; E3JVW4_PUCGT/16-151; AAA domain  ali follow..  13  2.......GGPGAGKGTQCARLVDQYS--FVHLSAGDLLRAEQNRDGSTYGSMIKDYIREGKIVPMQVTIKLLENAIGAAVAQGKTRFLVDGFPRQMDQA------VKFDEDVCQSSFV-LFLTCPEETLLKRLLERGKTS........................................ 125
23 -12.100PF01443.16; RDRP_TMV/829-1085; Viral (Superfamily 1) RNA helicase  ali follow..  14  1...VLVDGVPGCGKTKEILSRVNFDEDLILKQAAEMIRRRANSS-------------------GIIVATKDNVKTVDSFMMNFGKSTRCQFKRLFIDEGLHTGCVNFLVAMSLCEIAYVYG........................................................... 104
24 -12.000PF04310.10; MUKB_ECOLI/2-227; MukB N-terminal  ali follow..  32  26ELVTTLSGGNGAGKSTTMAAFVTAL........................................................................................................................................................... 50
25 -11.400PF01121.18; COAE_HAEIN/3-181; Dephospho-CoA kinase  ali follow..  10  2..IVGLTGGIGSGKTTIANLFTDL-------VDADVVAREVVAKDSPLLSKIVEHFGAQILTEQGELNRAALRERVFNHDED------KLWLNNLLHPAIRERMKQKLAEQTAPYTLFVVPLQTQLARSAQRDNNNFEQIQRIMNSQVSQQERLKWADDVINNDAELAQ........... 179
26 -11.000PF13189.4; D4IZP7_BUTFI/8-188; Cytidylate kinase-like family  ali follow..  13  1..VISIARSYGSGGLTLAKKLGKELGLPVY-LRMASDQSGINEEMFGEVDEHVRKIHYKGLPLSPEYAAFTSDDNLFELQADVIKRIANTQSCIIVDYILKDR------------YVLSLFFYASEENCLTRLRRQVSGTDEELLKRMHDIDKARNYDFCLDTG................ 180
27 -11.000PF13479.4; F5YIK8_TREPZ/11-202; AAA domain  ali follow..  14  5...CALFGPSGSGKTRMAKGIADTMGVPFAVIDTE-------------------ARSASKYADRIPFDVDDLDGKTVDHYIAAMNECVKAGYKLVIDSLSVNPKQKRFIDAILNFPGHIIATMRSKTEWVIGEGKGGKVAMGLAPEQGKGIEYEFDLLMELDQKHQA............. 185
28 -10.900PF13555.4; Q0A6A1_ALKEH/19-80; P-loop containing region of AAA domain  ali follow..  32  23GDNSLLTGDIGSGKSTLVDAITTLL........................................................................................................................................................... 47
29 -10.700PF07088.9; GVPD1_HALSA/23-536; GvpD gas vesicle protein  ali follow..  11  10GETLLINGAPGTGKTLFTIRGLDVLDSDVLYVSTRVDQETVHEMY---------------------FADHSSLDTTAILDLFQDPFELPLDVDVPFEKLDLDSLLEWIQEINAATTQLTIAFD-SWELIYEYLAVRHDDPPDIKTVTNQLAVLAREENIRL-VTETAAPSSLEYIVDGV. 169
30 -10.600PF01591.16; F262_BOVIN/27-250; 6-phosphofructo-2-kinase  ali follow..  12  15..LIVMIGLPARGKTYVSKKLTRYLN--WIGVPTKVF------NLGVYRRQAVKSYKSYDFFRHDNEEAMKIRKQCALVALKDVKAYLESGQIAVFDATNTTRERRDLILNFNSFKVFFVESVCDDPDVIAANILEVKVSS--------------------DYPERNRENVMDDFLKRIE 170
31 -10.600PF00910.20; A7M6L1_9SECO/473-576; RNA helicase  ali follow..  25  1...VYAYGESRTGKTLVVDKLITDFQN......................................................................................................................................................... 24
32 -10.400PF01745.14; IPT_RHIRD/1-235; Isopentenyl transferase  ali follow..  15  2.DLRLIFGPTCTGKTSTAIALAQQTGLPVLSLDRVQCCPQLSTGSGRPTVEELKGTTRLVKGIITAKQAHERLIAEVHNHEAKGGLILEGGSISLLRCMAQS.............................................................................. 109
33 -10.300PF03215.13; RAD24_YEAST/58-575; Rad17 cell cycle checkpoint protein  ali follow..  11  46.RILLLSGPSGCSKSTVIKELSKILVPKYRQNSNGT-----------SFRSTPNEHKVTEFRGDCIVNDLPQMESFSEFLKGARYLVMSNLSLILIEDL-FQQLILQWLYSSEPLLPPLVICITECEIPENDNNYRKFGIDYTFSAETEILMHPRLKRIKFNPNSTLLKKHLKFICVQ.. 226
34 -10.200PF06745.11; O29463_ARCFU/20-274; KaiC  ali follow..  13  32LAVMNITGVPDTGKSLLAEQFAAGSGYRVLYVTVESPANFLYTAMKERSEAMGVDFTKVEIDASESDELRENPKALMETMAYAIKEKKVT--NTIIDSITGRQIVRQFFNFMKKYRQTGIFV.......................................................... 168
35 -10.200PF05707.10; Q79YX7_VIBPA/2-255; Zonular occludens toxin (Zot)  ali follow..  1.ATSFRYGHGGSYKSAVWFDLLPALRE----------RICITNIHGMQPLEVIEQRLGEKFPDTARLIRISSRNPEGFELWKYFFCWAPIGAFILIDECLPEGFSELFHSRWLTIDTSSLDNGEIDDCQRTRFDEQGRIIYPENFNNAFMEHRHYNWDIVLLTP--DFAQIPKELKGVAE 196
36 -9.650PF00005.25; YTFR_ECOLI/25-174; ABC transporter  ali follow..  12  11GEIMALLGENGAGKSTLIKALTGVYHADRGTIWLEGQAISPKNTAHAQQLGIGTVYQEVNLLPNMSVADNLFIGREPKRFGLLRRKEMEKRATELMASYGFSLDVREPLNRFSVAMQQIVAI.......................................................... 132
37 -9.510PF02283.14; Q89Q74_BRADU/14-176; Cobinamide kinase / cobinamide phosphate guanyltransferase  ali follow..  12  1...ILITGGARSGKSRRAETRTQAFPGRPVYIATAEALDAEMEDRIAKHRARRGADWIEREVPLDLVQALVETEGGGARLVDCLTLWLS---NLLHSERDWSREVTHLAEVLPRLPVIMVTNEVGLGIVPDNALAR............................................ 132
38 -9.460PF06431.9; Q8JUD5_POVJC/266-682; Polyomavirus large T antigen C-terminus  ali follow..  31  156.RYWLFKGPIDSGKTTLAAALLDLCGGKSLNVNMPL................................................................................................................................................ 190
39 -9.450PF01057.15; Q7TG44_9VIRU/193-485; Parvovirus non-structural protein NS1  ali follow..  28  136.NTLWLFGHATTGKTNIAEAIAHAVP.......................................................................................................................................................... 160
40 -9.270PF00406.20; KAD2_CAEEL/31-217; Adenylate kinase  ali follow..  13  1.....FIGPPGSGKGTQAPAFAQKYFSCHLATG-DLLRAEVASG---------------------------------SEFGKELKATMDAG-KLVSDEVVCKLIEQKLEKILDGFP-TVVEFNIADDLLVRRITGR--LFHIASGRSYHLEFKPPKVPMKDDLTGRRSDDNEETLRKRLV 169
41 -9.200PF07015.9; Q1M9M0_RHIL3/1-231; VirC1 protein  ali follow..  4..VTCCSFKGGAGKTTALMGLCSALGKTIALFEAD-----------ENRPLSKWKENATRRNAWDPLCEIFITDELPLLEVAYEEAAGRGFDYCLVE--THHGSSELNNTVIASSNLLLIPTMLTPTPMHERDAFAAMKDRGMLHLNLRNAAANSSMR-NLEAAMEDLRSLGKFVSSTVE 230
42 -9.140PF10662.7; A6TJW6_ALKMQ/1-140; Ethanolamine utilisation - propanediol utilisation  ali follow..  30  2.KKVILVGRTGSGKTSLSQRLNQQ............................................................................................................................................................ 24
43 -9.080PF05729.10; G3V6C0_RAT/441-610; NACHT domain  ali follow..  17  1..VVAVLGKAGQGKSHWARTVSHIWAQGQLP-QYDFVFYVPCQCLDRPGDTYHLRDLLCPPNLQPLAMDDEVIDHIVRQPDRVL---------LILDAF-LEAQDSLLHGPCGPLSPEPCSLRGLLAGLFQRKLLRGCTLLLTARPRGRLAQSLSKADAIFEVPSFSTKQAQIYMRHYFE 169
44 -9.070PF09140.9; Q9A6C9_CAUCR/5-268; ATPase MipZ  ali follow..  17  3..IVVGNEKGGAGKSTIAVHLVTALGAKVAVIDLDLRQRTSARAWLDNKKIELPEPLALNLSDNDVALAERPEEEQVAGFEAAFARAMAECDFILID--TPGGDSAITRMAHGRADLVVTPMNDSFVDF--------DMLGTVDPVTLELTKPSLYSLTVWEGRKQRALSGQRQAMDWV. 178
45 -9.070PF16575.3; G0MKR2_CAEBE/121-307; mRNA cleavage and polyadenylation factor CLP1 P-loop  ali follow..  28  1.......GPADVGKSTVSRIICNYSVRQGLFVDLD................................................................................................................................................. 31

FFAS is supported by the NIH grant R01-GM087218-01
8 5 6 5 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Slabinski L, Jaroszewski L, Rychlewski L, Wilson IA, Lesley SA, Godzik A. XtalPred: a web server for prediction of protein crystallizability. Bioinformatics. 2007 Dec 15;23(24):3403-5. Epub 2007 Oct 5.