current user: public




PF07931
Query: PF07931.7; Q98FG2_RHILO/59-238; Chloramphenicol phosphotransferase-like protein, from PfamA26U

Results of FFAS03 search in PfamA26U
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180
# Score Template Links and tools%idFirst ARIVLLNGVGSAGKSSIARALQTITAAPFLHVQMDSFLEMLPDALQDHADGFSYETVRQDGKPAVVIRAGPVGERTLRGMRHAIAAMAGQGNDLIVDDVLCNGELSDCVDLLSAFDFHLVGVMAPLEVLEAREARRADRLPGLARWQYERVHAGISYDLEVDTSQSTPLECARRIQQRFQLast
1 -85.100PF07931.7; Q98FG2_RHILO/59-238; Chloramphenicol phosphotransferase-like protein  ali  100  1ARIVLLNGVGSAGKSSIARALQTITAAPFLHVQMDSFLEMLPDALQDHADGFSYETVRQDGKPAVVIRAGPVGERTLRGMRHAIAAMAGQGNDLIVDDVLCNGELSDCVDLLSAFDFHLVGVMAPLEVLEAREARRADRLPGLARWQYERVHAGISYDLEVDTSQSTPLECARRIQQRFQ 180
2 -37.400PF13671.1; B2JHT3_BURP8/20-178; AAA domain  ali follow..  14  1..LVFICGHAGTGKTTLAKRLIGPLMKACCLLDKDTLYGVYSAAAIGALTG-------DPNDRDSPLFLQHFRDPEYRGLFDTAAENLRLGIGVIAVGPLSREVRERWLGVPKDAKISVVWVSTSEETARERIAARGNPNDAYKLAHWEDYRQ........................... 154
3 -27.800PF06414.7; Q8P580_XANCP/35-230; Zeta toxin  ali follow..  15  15.KAIILAGQPGSGKGSLARAADVELGRDVVLIDPDELRNAHPE-------------VSALRNAHPYTWSGYTHSDASQWADELLQVTIEGKKNLIFDTTLSNQWSAELIKDLQGYDVEVRAMAAHKLESEHGVDSRFSQ--QLDREGYGRYVPESHREVVYTRLPISLDTVHAQTTAPVR 181
4 -27.100PF08303.6; Q6CK12_KLULA/389-554; tRNA ligase kinase domain  ali follow..  11  1..LLVTIATIGCGKSTVSLTLNELFPESWGLVVNDNITSNKT-----------------------------------DYIKSALQLFKDGKQFVLADKNHQFRERAAVFEWINQYRDSYIPSPEMRALTIDRVMKRGDNHQSIKS----------------SDDQQKVLKIMQGFMNRFQ 145
5 -26.500PF00625.16; KGUA_SHIFL/3-186; Guanylate kinase  ali follow..  11  2GTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRPGEVHGEH-VNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFLD--IDWQGAQQIRQKMPHARSIFI-LPPSKIELDRRLRGRGQDSEEVIAKRMAEMSHYAEYDYLIVNDDF--DTALTDLKTIIR 182
6 -26.200PF08433.5; O46079_DROME/1-293; Chromatin associated protein KTI12  ali follow..  11  3..LVVITGLPASGKSTRARQLRDHFVERGRKISENEAVPKA------------------GFGKNSHTGDSQKEKVVRSDLKSEASRHLNQEDLVILDAGNYIKGYRYELYCMSRTTQCTVFTCIPQEEAWTFNSQRTAPDELPGDQRYEEPQSNNRWDSPLVVVLPKDTLDMEAIYKALY 191
7 -26.000PF01583.15; PAPS1_HUMAN/51-209; Adenylylsulphate kinase  ali follow..  19  2GCTVWLTGLSGAGKTTVSMALEEYLVCHGIPLDGDNIRQGLNKNLG----------------------SPEDREENVRRIAEVAKLFADAGLVCITSFISPYTQDRNNARQIASLPFFEVFVDAPLHVCEQRDKARAGEIKGFTGIDSEY-EKPEAPELVLKTDSCD............. 158
8 -23.200PF13207.1; B2WP20_PYRTR/6-173; AAA domain  ali follow..  18  1..IIGLYGISGSGKSYLLNHVKTEIALQAQRFAFYDGSEVLAHVTPGGLDSFK------------LLDAAAKQSRIEAALALITQTCLDRGETAVVAGMFWNPGVVVAVEKDWQTYTHIVYLDTAPGVIAQRISADLTR......................................... 127
9 -21.900PF01591.13; F262_BOVIN/27-250; 6-phosphofructo-2-kinase  ali follow..  15..LIVMIGLPARGKTYVSKKLTRYLNWIGVPTKVFNLGVYRRQAVKSYKSYDFFRHDNEEAMKIRKQCALVALKDVKAYLTE------ESGQIAVFDATNTTRERRDLILNFNSFKVFFVESVCDDPDVIAANILEVKVSRNRENVMDDFLKRIECYKVTYQPLDPDSHDKDLSFIKVIN 195
10 -20.700PF13238.1; A5UL64_METS3/4-148; AAA domain  ali follow..  15  1...VVLTGIPGSGSTTLLNKALEEVDYVHLNYG-DIMTEIAIEE--------------VDDRDALRKLSPDVQKEIQEKAAKRIKERSESE-NVIVDTHCTINTPSGFLPGLPIWVLLFVMIEANPDEIIYRRLNDDTR......................................... 128
11 -18.600PF01202.17; Q989Q3_RHILO/2196-2352; Shikimate kinase  ali follow..  14  1.........KGAGKSSLGRALAKRLGMRF--VDSDRKIEAKTGK-----------SVAKIVAEDGEAYFRDLEVNEIRQSLELGSAVLATGGEAFMI--------EEIRHYVGEKAVS-IWLNTSEDVIRRNLRDNIRGPKVQTADQAQTITDYTLADLTIAPQHERDLKNANACLTALH 157
12 -17.500PF13521.1; A4CIV1_ROBBH/14-173; AAA domain  ali follow..  11  2...VVLFGPESTGKTTLARELARHYGEPWVPEYAREYLQ------------------EKWDRVQQTCAPEDLLPIARGQMRLENIGAREASRLLICDETYYGGGCDPKLQAAALANDYDLYFLTDIDIPWEADDLRDHERAEMFHYFKTALRENNRRFVILSGGREA............. 159
13 -17.400PF00485.13; KPPR_SYNY3/10-192; Phosphoribulokinase / Uridine kinase family  ali follow..  11  1..LIGVAGDSGCGKSTFLRRLTDLFGEEFMTICLDDYHSLDRQGRKAAGVTALDPRANNFDLMYEQIKTLKSGQSIMKPIYNHETEKVEPNKVVVIEGLLYDERVRELVD-------FGVYLDISEEVKINWKIQRDERGHTYEDILASINARKPDFTAYIEPQ----KQYADVVIQV.. 176
14 -16.900PF00693.13; KITH_EHV1B/32-309; Thymidine kinase from herpesvirus  ali follow..  12  1.......GVYGIGKSTTGRVMASAASAYWRTLFEADVISGIYDTQNRKQQGDLAADDAASITAHYQSRFTTPYLILHDHTFGLFGGDTRPDLTVVFDGDMSMCALIAMVATLPREP-NIVVTTLNVDEHVRRLRTRARIGEQIDMKLIATLRN--VYSMLANT................. 190
15 -15.500PF04275.9; A4IGD4_DANRE/12-127; Phosphomevalonate kinase  ali follow..  11  1.....FSGKRKSGKDYVTDLIQKRLTAEICCI-SAPLKEQYAKDHNLDYEELMGSGQYKESYRADMIHWGEMKRQEDSGFFCRLAIKHATQPVWIISDCRRMSDVQWFREAFPNKCVCV............................................................. 116
16 -15.300PF03668.10; YHBJ_SHIFL/1-282; P-loop ATPase protein family  ali follow..  17  2.VLMIVSGRSGSGKSVALRALEDM------FYCVDNLPVVLLPDLAR---------TLADREISAAVSIDVRNMPESPEIFEQAMSNLPDAFSPQL-----------------------LFLDADRNTLIRRDTRRLHPLSSKNLSLESAIDKESDLDLIVDTSEMSVHELAEMLRTRL. 152
17 -14.800PF13401.1; B2UJB3_RALPJ/42-210; AAA domain  ali follow..  25  4ESILLVCGPTGAGKTTLAKFMVENAHS......................................................................................................................................................... 30
18 -14.700PF03205.9; Q9FLE2_ARATH/115-230; Molybdopterin guanine dinucleotide synthesis protein B  ali follow..  24  2..RVIIVGDIDSGKSTLAKMLLNWAVKDGTFVDLN................................................................................................................................................. 37
19 -13.700PF05707.7; Q38198_9VIRU/7-180; Zonular occludens toxin (Zot)  ali follow..  14  1.SISLLTGLPGSGKSLRIIQAIRYLMDKGAHVYVCNIDGISVPGTTPWADPHKWQD-------------------------------LPAGSILFVDEA-DPVETIKAMSTIRHDGVRLVLATQQPNYLDTYLRGLVGYHEHLLRQSGKQKTFIFRNSQIIEEVRSPLPRIKKLYDYEV. 156
20 -13.600PF00910.17; A7M6L1_9SECO/473-576; RNA helicase  ali follow..  25  1...VYAYGESRTGKTLVVDKLITDFQN......................................................................................................................................................... 24
21 -13.600PF01121.15; COAE_HAEIN/3-181; Dephospho-CoA kinase  ali follow..  12  2..IVGLTGGIGSGKTTIANLFTDL-------VDADVVAREVVAKDSPLLSKIVEHFGAQILTEQGELNRAALRERVFN------HDEDKLWLNNLLHPAIRERMKQKLAEQTAPYTLFVVVVDVSPQTQLARSAQRDEQIQRIMNSQVSQQERLKWADDVINNDAELAQ........... 179
22 -13.400PF13479.1; Q4EAN1_9RICK/15-248; AAA domain  ali follow..  3TVKMVIFGPYGIGKTSLLKTI----DEPTLCLDFEAGLLAVQDWKGDSTEIRTWNEARDNPALKSDQAYSQRHYEHVSSKYKDFSSEFSKYRCIFVDSILLAQEMMAWLNQFQHIRDKDIIIVGTLGQYLDDCNRPVWLPQCEGTKTASEIPG--IVDEVISMVGIKKDDGTEKRSFVCH 216
23 -13.400PF03266.10; NTPTH_METS5/13-164; NTPase  ali follow..  16  2...LFITGRPGVGKTTLIKGLVSELRE......................................................................................................................................................... 25
24 -13.300PF13189.1; C0EC63_9CLOT/6-188; Cytidylate kinase-like family  ali follow..  19  1..IITISRQYGSGGHEIGQRLAKELGIPFYDKELQEILESIDEDATNSLLYSLSTGAFLMGNRFAPTGDVPLNDKLFFVQFDIIRQAAQDGSCVVVDYVLRDNP-----------DALHVFVHAPMEKRVERISQKYNLSPAKAKERIVRTDKRQNYDLCIDSGT............... 183
25 -13.200PF07088.6; GVPD1_HALSA/23-536; GvpD gas vesicle protein  ali follow..  10GETLLINGAPGTGKTLFTIRGLDVLDSDVLYVSTRVDQETVHEMYFADHSSLDTTAILDLFQDPFELPLDVDVPFEKLDLDSLLEWIQEI-LTIAFDSW---------------------------ELIYEYLAVRHDDPPDIKTVTNQLAVLAREENIRL-VTETAAPSSLEYIVDGV. 169
26 -13.100PF06745.8; O29463_ARCFU/20-274; KaiC  ali follow..  15  32LAVMNITGVPDTGKSLLAEQFAAGSGYRVLYVTVESPANFLYTAMKERSEGVDFTKVESNVVVIDASESDELRENPKALMETMAYAIKEKKVTTIIDSI-ARQIVRQFFNFMKKYRQTGIFV.......................................................... 168
27 -13.000PF02223.12; KTHY_BACSU/8-199; Thymidylate kinase  ali follow..  12  1.....FEGPEGAGKTTVLQEIKNILTAE----GLQVMATREPGGIDIAEQIREVILNENNILMDPKTEALLYAAARRQHLVEKVKPALEQGFIVLCDRFIDSSLAIDEVLSINEFAIVTVYFSIDPEEGLKRIYANGSREKNRLDLEKLDFHTKVQEGYSVDAGQ-SKDLVVQDV..... 192
28 -13.000PF04665.7; A7XCQ5_9POXV/6-246; Poxvirus A32 protein  ali follow..  11  16...LALVGGSGSGKTAYLLSLFNTLVEQY-----RHIFLFTPVYNSEYDSYIWPDHVNKVSTSEELDYALITTKQKIEKYVKNRGNKNAEMFLLILDDMGDKQIKSSCLLDFRHLNTSIILLCQTYKHVPV------------------NGRTSITHFCCCNVSDSDIENMLRSMSITGS 173
29 -12.700PF03215.10; RAD17_HUMAN/83-593; Rad17 cell cycle checkpoint protein  ali follow..  49.SILLITGPPGCGKTTTLKILSKEHGIQVQEWINPVLPDFQKDDFKGMFNTESSFHMFPYQSQIAVFKEFLLRATKYNKLQMLGDDLRTDKKIILVEDLQFYRDSHTLHEVLRKY-ISNISFNPVAPTIMMKFLNRIVTIEANKNGGKITVPDKTSLELLCQGCSGDIRSAINSL..... 258
30 -12.700PF07728.9; Q82S33_NITEU/475-632; AAA domain (dynein-related subfamily)  ali follow..  2...LILQGPPGTGKTWLAKRLAFALMGQKDDSKVRAVQFHPNLSYEDFVRGWRPTGEGK-----------SLADGVFMEAIKAASKDPSSKFVVVIEEI-PAQIFGELLTLLE----------------AGKRTPNEALELCYPDADGKRRPVHIPENLYVVGTMNIADRSLALVDLALR 155
31 -12.600PF04310.7; MUKB_ECOLI/1-227; MukB N-terminal  ali follow..  32  27ELVTTLSGGNGAGKSTTMAAFVTAL........................................................................................................................................................... 51
32 -12.200PF01443.13; RDRP_TMV/829-1085; Viral (Superfamily 1) RNA helicase  ali follow..  15  1...VLVDGVPGCGKTKEILSRVNFDEDLILVPGKQAAEMIR----------------RRANSSGIIVATKDNVKTVDSFMMNFGKSTRCQFKRLFIDEGLHTGCVNFLVAMSLCEIAYVYG........................................................... 104
33 -12.100PF02367.12; Q9Z7P7_CHLPN/14-136; Uncharacterised P-loop hydrolase UPF0079 topsan  ali follow..  22  15GAVLLLFGDYGAGKTEFVRGIVSGYLGDTIAEEVAS................................................................................................................................................ 50
34 -11.900PF01745.11; IPT_RHIRD/1-235; Isopentenyl transferase  ali follow..  2.DLRLIFGPTCTGKTSTAIALAQQTGLP---LSLDRVQGRPTVEELKGTTRLYLDDRPLVKGIITAKQAHERLIAEVHNHEAKGGLILEGGSISLLRCMAQSRYWNA-----------------RWHIIRNELADEESFMSVAKTRVKQMLRPSAGLSIIQELVQLWREPRLRPILEGID 172
35 -11.900PF13555.1; Q0A6A1_ALHEH/19-80; P-loop containing region of AAA domain  ali follow..  32  23GDNSLLTGDIGSGKSTLVDAITTLL........................................................................................................................................................... 47
36 -11.300PF13481.1; Q7U700_SYNPX/79-275; AAA domain  ali follow..  14  35RTLTLVVALQKVGKSAVVCNILGELAK--IIVGTDQPLADWREVMVPNGLMIRTDLDNYRVCDPVVRLYTREHGLHLAGIEKITADCEQNPWAVLVLDAFLSQPLQNLLESIAPFNITTVLLH......................................................... 190
37 -11.200PF00406.17; KAD_ECOLI/5-187; Adenylate kinase  ali follow..  12  1.....LLGAPGAGKGTQAQFIMEKYGIPQISTG-DMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKE---------RIAQEDCRNGF--LLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGR--RVHAPSGRVYHVKFNPPKVEGKDDVTGTRKDDQEETVRKRLV 165
38 -11.100PF10649.4; A6X300_OCHA4/7-165; Protein of unknown function (DUF2478 topsan)  ali follow..  1..LAAILAAKDVPVDQLLAGVAHRARQAGLRVA--GFLQHRESNTDECCRDIEIEHIGTGVTQIISQSLGSGSAALADVAGSLLAELDSGADMLILNRF................................................................................. 102
39 -11.100PF13191.1; B3QEJ6_RHOPT/306-495; AAA ATPase domain  ali follow..  37  25TEWVLISGYSGAGKSSVVSELRKSLAP......................................................................................................................................................... 51
40 -11.000PF03976.9; O05877_MYCTU/32-260; Polyphosphate kinase 2 (PPK2)  ali follow..  10  33..VVIFEGRDGAGKGGAIKRITEYLNPRVARI--------------------------------AALPAPTDRERGQWYYQRYIAHLPAKGEIVLFDGFCTPQEYVLFLRQTDGILLRKYWFSVSDAEQLRRFKARRNDPVRQWKLSPMDLESVYRWEVESDIKKHARLNMMAHLLSTID 222
41 -10.800PF10443.4; Q5B2U3_EMENI/373-791; RNA12 protein  ali follow..  17ETFIVIHGPRGSGKRELVLDRTLKDNKYKLIIDCKQIQDAKGDTAKIARAASQVGYRPVFSWMNSISSFIDLAAQGMIGTKAGFSETLDAQLSNIWQ-----------------------NTAVALKSITLEHRKKTDPDAQLSDEEYLEAHPEVRPVVVIDNYLHNNPEATSVVYDKI. 172
42 -10.700PF13469.1; B8KQT5_9GAMM/20-206; Sulfotransferase family  ali follow..  1.RFLFIVTPPYSG-STALAELINTSSKTLFLHAGGEGQWLVPG------------MCEKPRWDPARTFDFESIKAVWLSRYQSLQSS-AGSVDTVIEKSPPNMLRLDRFVEVFDDVAIMANNRQPHAHCSSVLFRN-HGWLKRSELIAHIVEKYQAPLLTYEQFCKDPARLLDRLPLPSH 183
43 -10.600PF09439.5; SRPB_YEAST/36-221; Signal recognition particle receptor beta subunit  ali follow..  15  6...IIIAGPQNSGKTSLLTLLTTD--------SVRPTVVSQEPLSAADYDGSGVTLVDFPGHVKLRYKLSDYLKTRAKFVKGLI---------FMVDSTVDPKKLTTTAEFLV-------------DILSITESSCENGIDIL---------------IACNKSELFTARPPSKIKDALE 137
44 -10.400PF02374.10; ASNA_HUMAN/37-340; Anion-transporting ATPase  ali follow..  10  2.KWIFVGGKGGVGKTTCSCSLAVQLSKGRLIISTDP-AHNISDAFDQKFSKVPTKVKGYDNLFAMEIDPSLGVAELPDEFFEEDNMLMMQEAMSAFPGIDEAMSYAEVMRLVKGMNFSVVVFDTAPTGHTLRLLNFPTIVERGLGRLMQIKNQISPFISQMCNMLGLGDMNADQLASKLE 187
45 -10.400PF05729.7; Q9GJD8_RAT/339-510; NACHT domain  ali follow..  33  1.QVVAVLGKAGQGKSHWARTVS.............................................................................................................................................................. 21
46 -10.300PF03193.11; RSGA_STRA5/122-274; Protein of unknown function, DUF258 topsan  ali follow..  12  28NKVTVFMGQTGVGKSTLLNKIAPELKLETGEIS................................................................................................................................................... 60
47 -10.300PF02283.11; A3JAW9_9ALTE/3-170; Cobinamide kinase / cobinamide phosphate guanyltransferase  ali follow..  13  1...TLVIGGIRSGKTALAERLARNTDGEVVYLATDEMRRRIDRHQRQRSVNWGLSEEPLA----------------LASVLALHASASQKAPCILVDCMSLAWEREEFLTQLAQYPGKLIIVSIGMDPLARRFGDELGWLNQALAERCDTV............................. 157
48 -10.200PF07475.7; HPRK_BACAN/129-299; HPr Serine kinase C-terminal domain  ali follow..  33  18GVGVLITGQSGVGKSETALELVKR............................................................................................................................................................ 41
49 -10.000PF13604.1; B9QRK8_9RHOB/353-542; AAA domain  ali follow..  14  17ERMASVVGRAGAGKTTMMKAAREVWEANGYQVVGAALAGKAAEGLEKEAG-LSWGRGEGLPDKKSVFVIDEAGMVDSRQMSVFVETIAKAGAKLVLQPIEAGAAFRSLTDRTGYAELGTIYRQREQWMRDASMDLARGDVVTAIRAYQS............................... 181
50 -10.000PF09848.4; A1A222_BIFAA/236-699; Uncharacterized conserved protein (DUF2075 topsan)  ali follow..  24  1SRLIFVQGVAGTGKTVLLSHLFYRI........................................................................................................................................................... 25
51 -9.970PF06048.6; A5ID95_LEGPC/25-306; Domain of unknown function (DUF927 topsan)  ali follow..  14  191..GFHFRGASSSGKSTALKVAASVWGNP-GLLILDELSQMEPKEAGEAAYLLANGQGKTRASRHGTAKPSSR............................................................................................................ 282
52 -9.810PF07015.6; Q1M9M0_RHIL3/1-231; VirC1 protein  ali follow..  10  4..VTCCSFKGGAGKTTALMGLCSALAADGALFEAD-----------ENRPLSKWKENATRRNAWDPLCEIFITDELPLLEVAYEEAAGRGFDYCLVE--THHGSSELNNTVIASSNLLLIPTMLTPLDADE................................................. 122
53 -9.810PF06309.6; O45271_CAEEL/5-130; Torsin  ali follow..  17  54..VLSFHGGPGTGKNYVTEIIAKNT........................................................................................................................................................... 76
54 -9.800PF00004.24; LON_BRECH/351-493; ATPase family associated with various cellular activities (AAA)  ali follow..  22  1...LCLVGPPGVGKTSLARSVARALGREFVRISLGGVRD............................................................................................................................................. 36
55 -9.800PF13166.1; Q63PW4_BURPS/9-780; AAA domain  ali follow..  17  25KKMNVIYGRNYSGKTTLSRIIRS............................................................................................................................................................. 47
56 -9.620PF13476.1; C4P4D4_ARATH/25-232; AAA domain  ali follow..  20.WVNFITGQNGSGKSAILTALCVAFGCRARGTRAATLKDFIKTGCSYALVYVELKNQGEDAFKPEIYGDTLIIERRISDSTSLTVLKDHQGRKISSRVIMSQDKSREFLHSGNDKDKFKFFYKATLLQQVDDILQSIGTKLNSANALLDE----------MEKTIKPIEKEINELLEKIK 208
57 -9.490PF13175.1; A9A6W0_METM6/4-391; AAA ATPase domain  ali follow..  29  23DNITILAGMNESGKTSVLEALEDFNVG......................................................................................................................................................... 49
58 -9.350PF09140.6; A5EKW2_BRASB/13-276; ATPase MipZ  ali follow..  13  3..VVLGNEKGGSGKSTTALHIAVALLKAGATIDLDSRQQSFTHYINNRSAWARRTGLHLELKLGQTLQIDENEKAEFQQFMEAVCSVEHAFDFIVVD--TPGNDSYLMRLAHSMADTLVTPINDS....................................................... 132
59 -9.270PF01637.13; Q9UZH9_PYRAB/7-205; Archaeal ATPase  ali follow..  20AELIIIYGRRRIGKTYLLQKFLAEVGGIYLLAEESETVLEDFSERLAEYFNDPF--------------LKENPLRNWGAFFAYLAGKSSERLVVVIDEV-FLSTLQKYWDLYLSDTKIMLILCGSLVSFMEGILSAKSPIYGRRTGAWKV--EEMDFFNAWKFHDVDAETVVHIYS.... 187
60 -9.230PF13173.1; B3JIH1_9BACE/17-152; AAA domain  ali follow..  18  3.KPLILNGARQVGKTWLLHEFAKLEYKKEAYVV................................................................................................................................................... 34
61 -9.220PF01057.12; Q7TG44_9VIRU/193-485; Parvovirus non-structural protein NS1  ali follow..  20  136.NTLWLFGHATTGKTNIAEAIAHAVPFYGCVNWTNE................................................................................................................................................ 170
62 -9.210PF10923.3; A6V9P6_PSEA7/4-411; P-loop Domain of unknown function (DUF2791 topsan)  ali follow..  49SAFRVVIGEYGAGKTFFLNLVRAIAMERKLVTMHADLNPDRRLHATGGQARSLYAELAKNMSTRTKPDGGALQGIVEKFIAQAKAEAKSSGKSSVIRSHLDELTEMVNGYDFADVIAIYCKGFEEGNEQLKADAIR------LRGEFTTKTDARAALGVRTIIDDASVYDQLKLLSRFVR 225
63 -9.150PF10662.4; A5ZM04_9FIRM/1-141; Ethanolamine utilisation - propanediol utilisation  ali follow..  42  4...VFLMGRSEAGKTSLTQALKGE............................................................................................................................................................ 24
64 -9.070PF07652.9; Q32ZD8_9FLAV/1675-1822; Flavivirus DEAD domain  ali follow..  14  4KQLIVLDPHPGAGKTRVAAEMAEALNGLPVRYLT.................................................................................................................................................. 62
65 -9.060PF08298.6; YEAG_ECOLI/19-380; PrkA AAA domain  ali follow..  13  86.QILYLLGPVGGGKSSLAERLKSLMQLVPIY----SANGERSPVNDHPFCLFNPQEDAQILEKEYGIPRRYLGTIMSPWAAKRLHEFGGDITKFRVVKVWPSILQQIAIAKTEPGDENNQDISALVGKVDIRKLEHYAQNDPDAYGYSGALCRANQGIMEFVEMFKAPIKVLHPLLTATQ 262
66 -9.030PF04548.11; Q8R379_MOUSE/9-219; AIG1 family  ali follow..  28  3...IVLVGKTGSGKSATANTILGQ............................................................................................................................................................ 23

FFAS is supported by the NIH grant R01-GM087218-01
6 2 7 2 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Godzik A. VISSA: a program to visualize structural features from structure sequence alignment. Bioinformatics. 2006 Apr 1;22(7):887-8. Epub 2006 Jan 24.