current user: public




PF07858
Query: PF07858.7; Q8XW85_RALSO/2-128; Limonene-1,2-epoxide hydrolase catalytic domain, from PfamA26U

Results of FFAS03 search in PfamA26U
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .
# Score Template Links and tools%idFirst PTPLETVSHFCAAFVEDGGRPAVRRWFTPDTRWVNEGVSATTGVDEAIAMIDGLETSMGISTVHFDVIAIAADGSRVLTERVDRFERADGAEIGRVTLMGIFKVEGEKIVEWRDYFDVNALQAFNAGLast
1 -74.800PF07858.7; Q8XW85_RALSO/2-128; Limonene-1,2-epoxide hydrolase catalytic domain  ali  100  1PTPLETVSHFCAAFVEDGGRPAVRRWFTPDTRWVNEGVSATTGVDEAIAMIDGLETSMGISTVHFDVIAIAADGSRVLTERVDRFERADGAEIGRVTLMGIFKVEGEKIVEWRDYFDVNALQAFNAG 127
2 -50.800PF03284.8; A2AXG8_STRCM/1-162; Phenazine biosynthesis protein A/B  ali follow..  15  18RRNRATVEQYMHTR--GQDRLRRHELFTEDGRGGLWTTDTTVGRDRLAEHAVWSLKCFPDWEWYNIQIFETQDPNHIWVECDGRGKICFGEGYYENHFLHSFELDNGKIKRNREFMNPFQQLRALG. 149
3 -41.900PF07366.7; Q82M76_STRAW/10-135; SnoaL-like polyketide cyclase  ali follow..  13  1....ALLRTAYQRL-QSGDLDACVELLTENFIANVPGTDPLHGREIWRLGAQAMLEGFPD--LQVDVEDMFSVHDKVAVRVHFRGTHAATHRPVGFRSIELYRIEGDRIAEEWVAPDLMSLMQQI.. 126
4 -22.900PF07107.6; Q9XES3_MESCR/1-119; Wound-induced protein WI12  ali follow..  24  12............................................................SSFQFNPQSIVAFGSLVLAE--------GCDPTRSISWVHAWTVTDGIITQVREYFNTSVTVTRLG. 69
5 -19.600PF13474.1; C6LX06_GIAIB/19-139; SnoaL-like domain  ali follow..  2...IAMEQAALEKW-FKGDSSAYRALWSEQSYFDSVADRRIDTHEEISAFVKSAVDGKLYDSYEFCDPRVQLGGDVAVL--TYQLHADTTLIDMHYNCIEVYRKEAAGWRVIHSTWSF......... 116
6 -18.900PF10184.4; Q9SA31_ARATH/87-199; Uncharacterized conserved protein (DUF2358 topsan)  ali follow..  13  2....VAVRTLREDLPLLFTRDLNYDIYRDDITFVDP-MNTFTGMDNYKIIFWALRFHGKIRDISLEIFRVWQPSEMILIRWNLKGVPRPWEAKGEFQGTSRYKLRNGKIYEH............... 113
7 -18.300PF08332.5; O70459_MOUSE/20-147; Calcium/calmodulin dependent protein kinase II Association  ali follow..  6...IKVTEQLIEAI-NNGDFEAYTKICDPGLTAFEPEALGVEGMDFHRFYFENALSKSKPIHTIILNPHVHLVGDDAACIAYIRLTQYMDGSTMQSEETRVWHRRDGKWQNVHFHRSGSP....... 128
8 -16.800PF11533.3; A4TPP8_YERPP/31-155; Protein of unknown function (DUF3225 topsan)  ali follow..  14  6LAVLAEVTAAFYRYEQGNDIAVLDALFWHDKRTVRFGAGDLYGIDAIREFRQNRPSVGLDRKLKNTVITTFGEDTAVA-----STEFYREGSTRVGRQMQTWVKLPCRIVAAH.............. 119
9 -16.700PF12680.2; A2SP57_METPP/26-134; SnoaL-like domain  ali follow..  13  1......VSGYALGW-DRHDVNLLLSVFHEDAEYLMPGFGDFRGADEIRRVYDQVVVAIPETWHFTTNLLLKVDGDRATGISEVNMHGTEASGRLAATYLDEFQRRAGR................... 105
10 -15.200PF12707.2; Q46KI2_PROMT/2-129; Protein of unknown function (DUF3804 topsan)  ali follow..  10  1.SSKEEILSILEAFASTRMGSFFLDNATADFLFIRPS-GNPLDAKGFENMWSSGDLVLESAEITKVHKFELLGSNAAICVFTLGSKFTYKGTQNDPTVTSIFKKIDEKVAWMQ.............. 116
11 -14.800PF12893.2; Q2KDJ8_RHIEC/2-116; Putative lumazine-binding  ali follow..  18  7...EQTVHLYVEGM-AFANAAALKKAFHPKSSIIGYYQNAVETRDEFIAAILAEEPAPPGTQPFMDIQNVDVEGDAASVK............................................... 84
12 -14.000PF13577.1; Q0FX44_9RHOB/19-150; SnoaL-like domain  ali follow..  12  10...RALRQHYSALL-DGNQADRIGEVFTDDAEVIV-TVGSMKGLDEIKTSLRGAYQMFDSRKAGHFPFVHAIANHEITLTGRDT----ATGSCYLLDFVTDRPGTQHPFLLLGRYVD.......... 117
13 -11.400PF05223.6; Q8Y9T2_LISMO/43-163; NTF2-like N-terminal transpeptidase domain  ali follow..  2.NALAAAETFTSNI-AKEKYDKLGGSVSSESL-----KKVEFTKKEMEDKYQAVYDGIGAKNIKVKNLKSVDKENKFNLTYELEMRTSLGKLATQKYKTTISKQDDDWKIDWK.............. 109

FFAS is supported by the NIH grant R01-GM087218-01
6 0 3 5 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Grynberg M, Jaroszewski L, Godzik A. Domain analysis of the tubulin cofactor system: a model for tubulin folding and dimerization. BMC Bioinformatics. 2003 Oct 10;4(1):46.