current user: public




PF07726
Query: PF07726.6; Q87G66_VIBPA/36-166; ATPase family associated with various cellular activities (AAA), from PfamA26U

Results of FFAS03 search in PfamA26U
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130
# Score Template Links and tools%idFirst HILVEGPPGLAKTRAVKSLSDCVEGDFHRIQFTPDLLPADLTGTDIFRPETGEFTFQSGPIFNSLILADEINRAPAKVQAAMLEAMAEKQVTAGRHTYALPELFLVMATQNPIEQEGTYPLPEAQLDRFLLLast
1 -102.000PF07726.6; Q87G66_VIBPA/36-166; ATPase family associated with various cellular activities (AAA)  ali  100  1HILVEGPPGLAKTRAVKSLSDCVEGDFHRIQFTPDLLPADLTGTDIFRPETGEFTFQSGPIFNSLILADEINRAPAKVQAAMLEAMAEKQVTAGRHTYALPELFLVMATQNPIEQEGTYPLPEAQLDRFLL 131
2 -23.900PF07728.9; Q82S33_NITEU/475-632; AAA domain (dynein-related subfamily)  ali follow..  23  1NLILQGPPGTGKTWLAKRLAFALDSKVRAVQFHPNLSYEDFVR-GWRPTGEGKLSLADGVFMEFVVVIEEINRGNAQIFGELLTLLEAGKADGKRRPVHIPENLYVVGTMNIADR--SLALVDLALRR... 156
3 -17.600PF08298.6; YEAG_ECOLI/19-380; PrkA AAA domain  ali follow..  21  88.LYLLGPVGGGKSSLAERLKSLMQIAKTEPGDENNQDISALVGLEHYAQNDPDAYGYSGAL-QGIMEFVEMFKAPIKVLHPLLTATQEGNYNGTEGISALPFNGIILAHSNESEWVTNNKNNEAFLDRV.. 306
4 -16.500PF00158.21; Q8E8E7_SHEON/154-320; Sigma-54 interaction domain  ali follow..  21  25.VLIQGESGTGKELVARQLHLLSGRQGPFVPVNCGSIAPELLESELFGHTAGAFT-REGLF-GGTIFLDEIGEMPLKMQTALLRVLEQKAIRPVGSEKEVNIDVRVIAATN.................... 141
5 -15.600PF00493.18; Q8SRS4_ENCCU/268-615; MCM2/3/5 family  ali follow..  23  58NVLLLGDPGMAKSQLLKFMELVS----PVGVYTSGKGSSAALTASVIRDSGGEFYLEGGALVNGICCIDEFDKMDEHDRVAIHEAMEQQTISIAGITTMLNTRTSILAAANPV---GRYEFGATILSRF.. 196
6 -13.700PF05496.7; RUVB_SOLUE/5-238; Holliday junction DNA helicase ruvB N-terminus  ali follow..  24  52HVLLYGPPGLGKTTLASIIAEELQVQFTPTSGPVLQKKLDLTGILSNIRL------------HQVFFIDEIHRLLPDVEEMLYSALEDFRVDIGARTHSLPMPKFTAIGATTRQGLVSAPL----RGRF.. 170
7 -13.600PF00004.24; LON_BRECH/351-493; ATPase family associated with various cellular activities (AAA)  ali follow..  22  1.LCLVGPPGVGKTSLARSVARALGREFVRISLGGVRDEAEIRG-----HRRTYVGALPGRIIQGVFLLDEIDKLASDFRSALLEVLDPNQNDKFSDHY---TNVMFITTANSLD-----TIPRPLLDRM.. 135
8 -11.900PF00910.17; A7M6L1_9SECO/473-576; RNA helicase  ali follow..  11  1.VYAYGESRTGKTLVVDKLITDFQNHFGLGKDTVYSRNPIDQYWSGYRRQP-------------IVSIDDFGAVTCDPSAQMIPLVSSAPLPLTMAAIEEKGMMFIFCSSN.................... 103
9 -11.700PF01443.13; RDRP_TMV/829-1085; Viral (Superfamily 1) RNA helicase  ali follow..  15  1.VLVDGVPGCGKTKEILSRVNF-----EDLILVPEMIRRRANSSGIIVATKDNVKTVDSFMMNKRLFIDEGLMLHTGCVNFLVAMSLCEIAYVYGDTQQIP.............................. 110
10 -11.600PF03266.10; NTPTH_METS5/13-164; NTPase  ali follow..  13  1RLFITGRPGVGKTTLIKGLVSELRELKIAGFYTEEVRERRVGRYFVVDSLTLLPQVKQRLEVADLVIMDEIGP---------MEKKIGDLWKLIQGVLSSNKPVVASVHRSMNIEGKRYELTPVNRDRVR. 148
11 -11.300PF05707.7; Q38198_9VIRU/7-180; Zonular occludens toxin (Zot)  ali follow..  17  3.SLLTGLPGSGKSLRIIQAIRYLMDKGAHVYVC-NIDGISVPGTTPWADPHKWQDLPAG----SILFVDEAARRGGDPVETIKAMSTIRHDGVR----------LVLATQQP................... 103
12 -11.300PF01078.16; Q8EJV7_SHEON/193-396; Magnesium chelatase, subunit ChlI  ali follow..  24  24NLLMLGPPGTGKTMLASRMMALL----------PALNYEEALEVAAIHSVAGINI-KPGEIHRGVLFLDEVAEFPRKVLDCLREPMETGEVVISRAAAKLTFLFQLIAAMNP................... 158
13 -10.900PF01695.12; Y4IQ_RHISN/60-238; IstB-like ATP binding protein  ali follow..  15  50NILLFGPPGGGKSHLAAAIGLALIENGWRVLFTR----TDLVQKLQVARRELQLESAIAKL-FDLLILDDLAYVTKDQAETLFELISARY----------ERRSIMITANQPFGE-PDPAMTLAAVDRLV. 173
14 -10.800PF08303.6; Q6CK12_KLULA/389-554; tRNA ligase kinase domain  ali follow..  15  2.LVTIATIGCGKSTVSLTLNELFPESWGLVV------NDNITSNKTDYIKSALQLFKDG---KQFVLADKNN-HQFRERAAVFEWINQYRDSY...................................... 83
15 -10.100PF07724.9; Q7PAG5_RICSI/595-759; AAA domain (Cdc48 subfamily)  ali follow..  19  7..LFLGPTGVGKTELTKALAGFLDDRNAILRIDMSEYMEKHAISRLIGAPPGYIGYDQGGVLTQVILFDEVEKAHPDIFNIMLQILDEGRLTDSQGITVDFKNTIIVLTSN.................... 124
16 -10.100PF13177.1; B3XQR6_LACRE/12-172; DNA polymerase III, delta subunit  ali follow..  18  23..LFVGPGGSGKMSIAQWLSLRLFCLHPQ---HPDIVYAAPEGRQIIRHLKAEFSKSAVEGNKKIFIIKDADKMTNGAANSLLKFIEE----------PGAGVYIFMLTTNKSAVLPT............. 147
17 -9.950PF03215.10; RAD17_HUMAN/83-593; Rad17 cell cycle checkpoint protein  ali follow..  16  51.LLITGPPGCGKTTTLKILSKEHGIQVQE-PVLPDFQKDDFKGMFNTESSFHMFPYQS----KKIILVEDLPNQFYRDSHTLHEVLRK--------VRIGRCPLIFIISDSLSGDNNQRLLFPKEI..... 194
18 -9.720PF12774.2; DYHC_TRIGR/1814-2044; Hydrolytic ATP binding site of dynein motor region D1  ali follow..  20  30HLVMSGAPGTGKTETTKDLGRALGIM-----------------VYVFNCSEQMDYKSCGNIYKGLSQTDEFNRISVEVLSVVAVQVKKERFNFMGEEISLIPSVGIFITMNP--YAGRTELPENLKALF.. 159
19 -9.670PF13604.1; B9QRK8_9RHOB/353-542; AAA domain  ali follow..  14  20.ASVVGRAGAGKTTMMKAAREVWEANGYQVVGAA---EAGIASRTLASWQLSWGRGEGLPDKKSVFVIDEAGMVDSRQMSVFVETIAKAKLVLVGDAEQLQPIEAGAAFRSLTDRTGYAELGTIYRQR... 156
20 -9.090PF08433.5; O46079_DROME/1-293; Chromatin associated protein KTI12  ali follow..  12  4.VVITGLPASGKSTRARQLRDHFVERGRKVH----LISENEAVPKAGFGKNSHTGDSQKEKVVRSDLKSEASRHLNQEDLVILDAIKGYRYELYCMSKVSRTTQCTVFTCIPQEE................ 116
21 -9.040PF13238.1; A5UL64_METS3/4-148; AAA domain  ali follow..  13  1.VVLTGIPGSGSTTLLNKALEEVDYVH-----YGDIMTEIAIEEKIVDDRDALRKLS----------PDVQKEIQEKAAKRIKERSESENVIVDT.................................... 81

FFAS is supported by the NIH grant R01-GM087218-01
6 1 0 6 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Godzik A. Functional differentiation of proteins: implications for structural genomics. Structure. 2007 Apr;15(4):405-15.