current user: public




Query: PF06251.6; Q56655_VIBCH/53-288; Capsule biosynthesis GfcC, from PfamA26U

Results of FFAS03 search in PfamA26U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .
# Score Template Links and tools%idFirst ATSLEVRVAHNNQAIHSTRLSFSEPMRLDSAVMQTLEQAGLNTQQVEWPSAGLFDLSHAFLFKRDVLLKLADQQSSAPPTQQALWASLIAQLRQAEFAKRLFISVDPDWTRIAPQHNPRLNGSWLLTLNSKSTQVSVYGAVNQPGDVIWHNRLSAKDYAHAAGLIDEQISEIVVIQPDGIAQKHAVAYWNQDFNEVAPGAIVYVPLPLKRAFFDPTVTDADLNQLVIELLRNRLPLLast
1 -89.700PF06251.6; Q56655_VIBCH/53-288; Capsule biosynthesis GfcC  ali  100  1ATSLEVRVAHNNQAIHSTRLSFSEPMRLDSAVMQTLEQAGLNTQQVEWPSAGLFDLSHAFLFKRDVLLKLADQQSSAPPTQQALWASLIAQLRQAEFAKRLFISVDPDWTRIAPQHNPRLNGSWLLTLNSKSTQVSVYGAVNQPGDVIWHNRLSAKDYAHAAGLIDEQISEIVVIQPDGIAQKHAVAYWNQDFNEVAPGAIVYVPLPLKRAFFDPTVTDADLNQLVIELLRNRLPL 236
2 -13.500PF10531.4; A3ERW5_9BACT/117-169; SLBB domain  ali follow..  21  2......................................................................................................................................FYISGAVGKPGVVPFTHNIRLLQAIILAGGATAKEDSVVLIRDNKP........................................................ 49
3 -7.240PF08007.7; Q9CP87_PASMU/26-337; Cupin superfamily protein  ali follow..  15  69.......................................................................................................................LPAQWSVLVQNLEQWSPELGQLWHAFGFIPQWQRDDIMVSYAPAGGSVDEYDVFLVQGYGHIRIFDDMGELILDEVMAPGDILYVPSRLSHYGVAQDDCLTDLFDNINKGMCQAL.. 218
4 -7.230PF02107.11; A0YG79_9GAMM/50-235; Flagellar L-ring protein  ali follow..  11  1...AEIPMANSGGIYRPGYSAGLFEDLKARRVGDIISVILSERTQSSKTADTEIKKENSVSFDAGTVLGVSPSLGDYNMQTSVTQDRELKGEAGSDQSNSLSGSIAVTIAEILPNGLMMVRGEKWMTLNRGEEFIRIQGLIR-------PEDVQPDNTILSTRLADARITY----SGTGDLANANKQGWGAR............................................ 178
5 -6.880PF11649.3; Q5QBZ0_9CAUD/1-253; Virus neck protein  ali follow..  10  39.........................................................................................................TQTLADALVAESIQMRGIELYYIPRE-NPDQLFGEDLQN---KFTKAWKFAGYLDSFEGYSGDNTYF-MMVNDEVTITINPNLFKHQCNGTEPGDLIYFPMDNSLFEINWVQPYDPFYQV........... 161
6 -6.760PF08021.6; YQJH_ECOLI/21-133; Siderophore-interacting FAD-binding domain  ali follow..  12  2...........................................................................................VLRVERISAGFQRIVLGGEALDGFTSRGFDDHSKLFFPQPDAHFVPPTVTEEGIVWPEGPRPPSRDYTPLYDELRHELAIDFFIHDGGVA-----SGWAMQ---AQPGDKLTV................................ 106
7 -5.990PF03152.9; A3LND3_PICST/23-202; Ubiquitin fusion degradation protein UFD1  ali follow..  10  13.............................................................................................................MMADNIRKDDANFGGKIFLPPSALNKLTMLHIRYPMLFELSNEAQAVRTHSGVLEFVAEEGRVYIINPGGLLKISNCDLPLGSFVKIEPNDIIEINYNDSIFGIKVLDVKPKSDSTSICVVETDLET 175
8 -5.840PF06560.6; Q8ZMP7_SALTY/31-215; Glucose-6-phosphate isomerase (GPI)  ali follow..  14  41..................................................................................................................................AADQYQYDITIIMPGTIGKERKKTSGHYHGYNDTRRNTHPEVYVIKGTAAYILQKSP--DLIVAVVKEGQSIIVP............................... 126
9 -5.790PF13780.1; B6FNS4_9CLOT/4-78; Domain of unknown function (DUF4176 topsan)  ali follow..  18  2.......................................................................................................................KPLGSVVLLKNGTKRVMIYGR-----KQILASTGELFDYVA-------------CLYPEGNIGAEYTFLFNDDDIE----EVIFEGYSDKED......................... 71
10 -5.380PF06339.7; ECTC_HAHCH/1-127; Ectoine synthase  ali follow..  12  32.....................................................................................................................................................NMGFSFHITTLYANKYQNHLESVYCISGEGEVETVA----DGEVHAIKPGTLYVLD............................... 88

FFAS is supported by the NIH grant R01-GM087218-01
6 5 1 3 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Lesley SA, Kuhn P, Godzik A., Deacon AM, Mathews I, Kreusch A, Spraggon G, Klock HE, McMullan D, Shin T, Vincent J, Robb A, Brinen LS, Miller MD, McPhillips TM, Miller MA, Scheibe D, Canaves JM, Guda C, Jaroszewski L, Selby TL, Elsliger MA, Wooley J, Taylor SS, Hodgson KO, Wilson IA, Schultz PG, Stevens RC. Structural genomics of the Thermotoga maritima proteome implemented in a high-throughput structure determination pipeline. Proc Natl Acad Sci U S A. 2002 Sep 3;99(18):11664-9. Epub 2002 Aug 22.