current user: public




Query: PF06153.6; YAAQ_BACSU/1-109; Protein of unknown function (DUF970), from PfamA26U

Results of FFAS03 search in PfamA26U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
# Score Template Links and tools%idFirst MKLIVAVVQDQDSNRLLKTLTDHNFRVTKLATTGGFLKSGNTTFMIGVEDIRVNKALSLIKENGQKRDQMIAPVSPMGGNADSYVPYPVEVEVGGATVFVLPVDEFHQFLast
1 -67.600PF06153.6; YAAQ_BACSU/1-109; Protein of unknown function (DUF970)  ali  100  1MKLIVAVVQDQDSNRLLKTLTDHNFRVTKLATTGGFLKSGNTTFMIGVEDIRVNKALSLIKENGQKRDQMIAPVSPMGGNADSYVPYPVEVEVGGATVFVLPVDEFHQF 109
2 -33.700PF00543.17; O54449_AZOVI/4-105; Nitrogen regulatory protein P-II  ali   12  1...VTAIIKPFKLDDVRESLSEIGVGITVTEVKGFGRQKGHTELYRGAEY--------VVDFLPKVKIDVAIEDSQLDHVIEAITKAANTGKIGDGKIFVVNLEQAIRI 99
3 -9.690PF11582.3; Q89MS9_BRAJA/2-103; Protein of unknown function (DUF3240)  ali   14  4YVCLSLILARKLREELLDFLSEQP-GFTVSDAAGHGSGVQLPTAA------------RVKGHADQVHVQIVLPGADARRLVDQLRHSFAGCNL---VYWIAPVAEFGTI 101
4 -8.330PF09400.5; A1AEL5_ECOK1/1-112; Protein of unknown function (DUF2002)  ali   16  6.............DEVARVLEKVGFTVDVVTQKAYGYRRGENYVYVNRE-ARMGRTALVIHPTLKERSSTLAEPASDIKTCDHYQQFPL.................... 80
5 -7.350PF12146.3; A1AB21_ECOK1/17-96; Putative lysophospholipase  ali   10  17.KKVIVLFHSGRLQHIVDELAMPDTAFYAWDARGHGQTSGPRGYSPSLAR--VQDVDEFVR................................................ 80
6 -6.820PF01981.11; A2Y6L9_ORYSI/89-204; Peptidyl-tRNA hydrolase PTH2  ali   16  52.KIVLTCKNQQEMNRIKETAEHRGIPTFVVADAGRTQVQAGSKTVLAVGPGRKADIDSVTGK............................................... 112
7 -6.380PF10035.4; Q5FKF1_LACAC/225-279; Uncharacterized protein conserved in bacteria (DUF2179)  ali   18  2.........................GFTYLNALGGYKQDKKRVIYVVVSPREIATIKQLIRQ............................................... 38
8 -6.340PF06897.7; Q92YG4_RHIME/60-161; Protein of unknown function (DUF1269)  ali   16  19...LIGVALGAASGAIGGALSDVGINDNFMKELARGLQPGNAALFVLVKEMTEDKVLKDISPFGGTILRTSLDESKEQLLRDALQKA...................... 102
9 -6.010PF12796.2; A3YC40_9GAMM/544-718; Ankyrin repeats (3 copies)  ali   17  122..............EIAKLLISRGASPIAKHNTG---MLGYTPLMLAIELNEAELVKFMLDS............................................... 166
10 -5.850PF11080.3; A7MNX5_ENTS8/3-98; Protein of unknown function (DUF2622)  ali   21  21..........TDINELNNHLTRGGFQLTLADDDGKIHELGTNTFGL-VSALSEQEVAELAEGLGEAALDQKPQ------------------------VTVTTFENWLR. 93

FFAS is supported by the NIH grant R01-GM087218-01
6 6 1 8 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Berman HM, Burley SK, Chiu W, Sali A, Adzhubei A, Bourne PE, Bryant SH,Dunbrack RL Jr, Fidelis K, Frank J, Godzik A, Henrick K, Joachimiak A, HeymannB, Jones D, Markley JL, Moult J, Montelione GT, Orengo C, Rossmann MG, Rost B,Saibil H, Schwede T, Standley DM, Westbrook JD. Outcome of a workshop on archiving structural models of biological macromolecules. Structure. 2006 Aug;14(8):1211-7.