current user: public




PF06153
Query: PF06153.6; YAAQ_BACSU/1-109; Protein of unknown function (DUF970 topsan), from PfamA26U

Results of FFAS03 search in PfamA26U
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
# Score Template Links and tools%idFirst MKLIVAVVQDQDSNRLLKTLTDHNFRVTKLATTGGFLKSGNTTFMIGVEDIRVNKALSLIKENGQKRDQMIAPVSPMGGNADSYVPYPVEVEVGGATVFVLPVDEFHQFLast
1 -67.600PF06153.6; YAAQ_BACSU/1-109; Protein of unknown function (DUF970 topsan)  ali  100  1MKLIVAVVQDQDSNRLLKTLTDHNFRVTKLATTGGFLKSGNTTFMIGVEDIRVNKALSLIKENGQKRDQMIAPVSPMGGNADSYVPYPVEVEVGGATVFVLPVDEFHQF 109
2 -33.700PF00543.17; O54449_AZOVI/4-105; Nitrogen regulatory protein P-II  ali follow..  12  1...VTAIIKPFKLDDVRESLSEIGVGITVTEVKGFGRQKGHTELYRGAEY--------VVDFLPKVKIDVAIEDSQLDHVIEAITKAANTGKIGDGKIFVVNLEQAIRI 99
3 -9.690PF11582.3; Q89MS9_BRAJA/2-103; Protein of unknown function (DUF3240 topsan)  ali follow..  14  4YVCLSLILARKLREELLDFLSEQP-GFTVSDAAGHGSGVQLPTAA------------RVKGHADQVHVQIVLPGADARRLVDQLRHSFAGCNL---VYWIAPVAEFGTI 101
4 -8.330PF09400.5; A1AEL5_ECOK1/1-112; Protein of unknown function (DUF2002 topsan)  ali follow..  16  6.............DEVARVLEKVGFTVDVVTQKAYGYRRGENYVYVNRE-ARMGRTALVIHPTLKERSSTLAEPASDIKTCDHYQQFPL.................... 80
5 -7.350PF12146.3; A1AB21_ECOK1/17-96; Putative lysophospholipase  ali follow..  10  17.KKVIVLFHSGRLQHIVDELAMPDTAFYAWDARGHGQTSGPRGYSPSLAR--VQDVDEFVR................................................ 80
6 -6.820PF01981.11; A2Y6L9_ORYSI/89-204; Peptidyl-tRNA hydrolase PTH2  ali follow..  16  52.KIVLTCKNQQEMNRIKETAEHRGIPTFVVADAGRTQVQAGSKTVLAVGPGRKADIDSVTGK............................................... 112
7 -6.380PF10035.4; Q5FKF1_LACAC/225-279; Uncharacterized protein conserved in bacteria (DUF2179 topsan)  ali follow..  18  2.........................GFTYLNALGGYKQDKKRVIYVVVSPREIATIKQLIRQ............................................... 38
8 -6.340PF06897.7; Q92YG4_RHIME/60-161; Protein of unknown function (DUF1269 topsan)  ali follow..  16  19...LIGVALGAASGAIGGALSDVGINDNFMKELARGLQPGNAALFVLVKEMTEDKVLKDISPFGGTILRTSLDESKEQLLRDALQKA...................... 102
9 -6.010PF12796.2; A3YC40_9GAMM/544-718; Ankyrin repeats (3 copies)  ali follow..  17  122..............EIAKLLISRGASPIAKHNTG---MLGYTPLMLAIELNEAELVKFMLDS............................................... 166
10 -5.850PF11080.3; A7MNX5_ENTS8/3-98; Protein of unknown function (DUF2622 topsan)  ali follow..  21  21..........TDINELNNHLTRGGFQLTLADDDGKIHELGTNTFGL-VSALSEQEVAELAEGLGEAALDQKPQ------------------------VTVTTFENWLR. 93

FFAS is supported by the NIH grant R01-GM087218-01
5 9 8 8 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Jaroszewski L, Rychlewski L, Li Z, Li W, Godzik A. FFAS03: a server for profile--profile sequence alignments. Nucleic Acids Res. 2005 Jul 1;33(Web Server issue):W284-8.