current user: public




Query: PF06153.9; YAAQ_BACSU/1-109; Cyclic-di-AMP receptor, from PfamA30U

Results of FFAS03 search in PfamA30U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
# Score Template Links and tools%idFirst MKLIVAVVQDQDSNRLLKTLTDHNFRVTKLATTGGFLKSGNTTFMIGVEDIRVNKALSLIKENGQKRDQMIAPVSPMGGNADSYVPYPVEVEVGGATVFVLPVDEFHQFLast
1 -73.900PF06153.9; YAAQ_BACSU/1-109; Cyclic-di-AMP receptor  ali  100  1MKLIVAVVQDQDSNRLLKTLTDHNFRVTKLATTGGFLKSGNTTFMIGVEDIRVNKALSLIKENGQKRDQMIAPVSPMGGNADSYVPYPVEVEVGGATVFVLPVDEFHQF 109
2 -9.690PF00543.20; C1DJ64_AZOVD/4-105; Nitrogen regulatory protein P-II  ali follow..  12  1...VTAIIKPFKLDDVRESLSEIGVQGITVTEVKGF-QKGHTELYRGAE---------VVDFLPKVKIDVAIEDSQLDHVIEAITKAANTGKIGDGKIFVVNLEQAIRI 99
3 -6.670PF09153.8; H3ZKP7_THELN/1-86; Domain of unknown function (DUF1938 topsan)  ali follow..  13.EIQIAVIYEEKIQGIAFSLDGEEFLRERIRGLVKHLQKRGVNVDLREKESDFPQLV.................................................... 68
4 -6.430PF13420.5; B9DJI0_STACT/4-159; Acetyltransferase (GNAT) domain  ali follow..  17  100LNSVVEFCQEMNIEKILAPVASNNIGAMVFYSEYGFSKAGFETNSRKYGDHYIDEHW.................................................... 156
5 -6.230PF03709.13; Q92ZT9_RHIME/22-134; Orn/Lys/Arg decarboxylase, N-terminal domain  ali follow..  14  2........SNLETKRLLAHIVAENFEVELRGSYNADVSEDASAYIGTVEGGRLEDARKFVRAVRDIGFRTPLWALADSHGIADIAAIKMAGEVDGFVYLGQQTPAF... 101
6 -5.920PF06174.9; I0DS19_PROSM/1-65; Protein of unknown function (DUF987 topsan)  ali follow..  16  1....MNIIRKSAAMKIHQQHLGSRLA-----CRGKYKWVGNSEHYIGKEVPDCRGVLAVYVERRQDR.......................................... 60
7 -5.830PF06897.10; Q92YG4_RHIME/60-159; Protein of unknown function (DUF1269 topsan)  ali follow..  18  19...LIGVALGAASGAIGGALSDVGINDNFMKELARGLQPGNAALFVLVKEMTEDKVLKDISP............................................... 77
8 -5.730PF06189.10; G0A2Y9_METMM/38-307; 5`-nucleotidase  ali follow..  16  194IKTSIITARSAPAHRVVTTLKAWGVSADESFFLGGILKVLKPHLFFDDQRSHLHSAAGEI................................................. 259
9 -5.660PF09867.7; F4GWM3_PUSST/14-146; Uncharacterized protein conserved in bacteria (DUF2094 topsan)  ali follow..  12  5............................KMPANGDFLHRRLSRELVQWWDKWLQMGVAGLHQRDAASAEVAYQDAPLWNFAIPAGFGSGIVQLG---CIGPSRDRVGR. 81
10 -5.650PF03229.11; Q9IZ54_CHV1/1-129; Alphavirus glycoprotein J  ali follow..  20  1MRSLLFVV----VLAAVTDLTPKAALATGANATAG---VANATATAGVANATDAEATS--GAAATSAAVVTPPPTDSTQTAETPGPSPLPLVIGGLCALTL........ 101

FFAS is supported by the NIH grant R01-GM087218-01
8 3 0 7 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Lesley SA, Kuhn P, Godzik A., Deacon AM, Mathews I, Kreusch A, Spraggon G, Klock HE, McMullan D, Shin T, Vincent J, Robb A, Brinen LS, Miller MD, McPhillips TM, Miller MA, Scheibe D, Canaves JM, Guda C, Jaroszewski L, Selby TL, Elsliger MA, Wooley J, Taylor SS, Hodgson KO, Wilson IA, Schultz PG, Stevens RC. Structural genomics of the Thermotoga maritima proteome implemented in a high-throughput structure determination pipeline. Proc Natl Acad Sci U S A. 2002 Sep 3;99(18):11664-9. Epub 2002 Aug 22.