current user: public




Query: PF05634.9; I1MQ97_SOYBN/64-263; APO RNA-binding, from PfamA30U

Results of FFAS03 search in PfamA30U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200
# Score Template Links and tools%idFirst PKGTVWRRKTLPQNEDLPPILPKNKKKPYPIPFKEIKQAGREDRKLAHMGIEKPLEPPKNGLLVPDLVPVAYEVFDAWKLLIEGLAQLLHVIPAHGCSECSEVHVAQTGHHIRDCSGTNGRQRRSSHAWVKGSVNDILVPIESYHLFDPFGRRIKHDTRFEYDRIPAVVELCIQAGVDIPEYPSRRRTNPIRMLGRRVIDLast
1 -113.000PF05634.9; I1MQ97_SOYBN/64-263; APO RNA-binding  ali  100  1PKGTVWRRKTLPQNEDLPPILPKNKKKPYPIPFKEIKQAGREDRKLAHMGIEKPLEPPKNGLLVPDLVPVAYEVFDAWKLLIEGLAQLLHVIPAHGCSECSEVHVAQTGHHIRDCSGTNGRQRRSSHAWVKGSVNDILVPIESYHLFDPFGRRIKHDTRFEYDRIPAVVELCIQAGVDIPEYPSRRRTNPIRMLGRRVID 200
2 -8.880PF14319.4; C4ZML2_THASP/10-118; Transposase zinc-binding domain  ali follow..  10  1....................................................DIFRAFGPAWRLAQHGHLSLGQLKVMSAIEQ-CRTAALGGHVLRCEACEQIDISYNSCRNRHCPKCQARAAQ---RWLEARQADLLPVEYVFTLPAPISAFAYTNKALVY...................................... 109
3 -7.040PF09412.8; B8LDL9_THAPS/223-504; Endoribonuclease XendoU  ali follow..  10  56........QVRPTFKAFRALLDNYSSYCGDEEEISEKELQEIRVFLDAIMDTAVMKYCHQYCLAKEASYEGEAIPESEYGFKKVLNSIFELYSRSGGGGRRGRKMDSSGFEHVFVGEVKNGQISGFHNWVQFYLEEVLTLQFSWN------GVEKFVGTSFIGVSPALYTMAFLTG........................ 248
4 -7.020PF13098.4; D9SD62_GALCS/101-221; Thioredoxin-like domain  ali follow..  1................................................................................VKGNGKRKLAYFTDPQCGYCKKLELYPIFPGSEEIVRNVRCAKDPAKTWDDLMLKGIAAASIACKTPTDKVMAFGREKQ--VNGTPNLI---FADGTQVPGYLPAEELEKHL........ 121
5 -6.960PF12660.5; S7ZRM5_PENO1/600-697; Putative zinc-finger of transcription factor IIIC complex  ali follow..  10  12..............................................................................................ERCEICDA-GISWTSANDARC--------VEGHLFVRCGLSFLAIQETEYINEETIAQIHEGSLCPLFKSVFGAFDTCLYCG........................ 95
6 -6.440PF02253.13; M1FBT8_9ALTE/121-381; Phospholipase A1  ali follow..  22..........RPNYILPVTWSDHPNQAPTSPRLGVTGYDYDLKQEEAKYQISFKVPLFTGLMDKRTTLWFGYTQKSFWQLYNQDESA-----PFRETNYEPELFLNIGPGRLDTLYVGINHQSNGQRSWNRIVGKRWLFMVKPWIRLPEGSTDDNNDIESYLGHGSYHA............................... 192
7 -6.360PF12963.5; R7EKX0_9FIRM/6-110; Protein of unknown function (DUF3852 topsan)  ali follow..  26....................................................................DVAGAIESTWNAAKSQIQTVVNNVVFPVCDMILAILF------VKVGTAYFDYRKHGQFEFAAPCI-TLTAPLYIWSI...................................................... 104
8 -6.150PF10795.7; F7YKP9_VIBA7/3-97; Protein of unknown function (DUF2607 topsan)  ali follow..  1.....................................................................FTRLRCPHYRAQSIALCAMLLMLWLNVAYVDHHLDTNPAHHAQHHCQLFS----GFQNGLSSALPILPVISGSEIRSSVEKTQRRPSVHYAYLARSP.................................. 93
9 -5.960PF15961.3; ZN839_HUMAN/7-805; Domain of unknown function (DUF4764 topsan)  ali follow..  12  112TRHTEKLKKSLKVKTRSGRVSRPPKYKAKDYKFIKTEDLADGHLSDSDDYSELCVEEDEDQRERHALFDLSSCSLRP---------------KSFKCQTCEKSYIGKGG---------RHFKLNPGHG........................................................................ 217
10 -5.730PF04473.10; Q5JHU4_THEKO/395-551; Transglutaminase-like domain  ali follow..  27...................................IDENIEYEYTKADYVDALVYNWSKLTSEQKELYDNLTRLYAPNDIIVYK-KGICGDYAILTAAMLLDS-----GVSPVYLLDISFENSKVGHAAVAVKIEG-------LFVLDQH.................................................. 129

FFAS is supported by the NIH grant R01-GM087218-01
8 5 8 4 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Zmasek CM, Zhang Q, Ye Y, Godzik A. Surprising complexity of the ancestral apoptosis network. Genome Biol. 2007 Oct 24;8(10):R226 [Epub ahead of print]