current user: public




PF03529
Query: PF03529.8; Q90XY9_SCYCA/57-141; Otx1 transcription factor, from PfamA26U

Results of FFAS03 search in PfamA26U
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .
# Score Template Links and tools%idFirst SPASISPIAPDCLSTSSSCMQRSYPMNYTQASGYTQGYAGSTSYFGGMDCGSYLSPMHHQLPAPGTALSPMSSNAVTAGHLNQSPLast
1 -65.400PF03529.8; Q90XY9_SCYCA/57-141; Otx1 transcription factor  ali  100  1SPASISPIAPDCLSTSSSCMQRSYPMNYTQASGYTQGYAGSTSYFGGMDCGSYLSPMHHQLPAPGTALSPMSSNAVTAGHLNQSP 85
2 -7.010PF00543.17; O54449_AZOVI/4-105; Nitrogen regulatory protein P-II  ali follow..  10  6KPFKLDDVRESLSEIGVQ------GITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIDVAIEDSQLDHVIEAITKAANTGK.. 82
3 -6.690PF09127.6; LKHA4_NEUCR/466-605; Leukotriene A4 hydrolase, C-terminal  ali follow..  12  39...AVQDFEEPLTVEQSQALGKAYGLSESKNAKDASAYQGVADLLGEVGRMKFVRPLFRGLNKVDRELA................ 117
4 -6.520PF02710.9; Q3HS79_9BETC/133-281; Hemagglutinin domain of haemagglutinin-esterase-fusion glycoprotein  ali follow..  17  22.PYAYGGNAKPTSICKDKTLTLNNPTFISKESNYVDYYYVSEANFTLQGCDEFIVPL............................ 77
5 -6.110PF10278.4; A7RLX2_NEMVE/18-205; Mediator of RNA pol II transcription subunit 19  ali follow..  21  1SPFYLNEPPTPTDINGSSNLLVQNGLEQSYQKFCGKKVKENLSAFGYIDEENSLRSVIDKPPIGGKELLPLPSHALSGFRLNPGP 96
6 -5.900PF09532.5; LSM14_PLEWA/294-404; FDF domain  ali follow..  26  74.....................................YDKTKSFFDNISCDD................................. 88
7 -5.780PF02806.13; GLGB_CHLPN/621-718; Alpha amylase, C-terminal all-beta domain  ali follow..  14  28...........CVHHFSASTFPSYVLRCEGVKHCELLLNTDDESFGG-NRAPVVCQDQGVAWGLDIELPPLAT............ 92
8 -5.610PF05340.7; Q8GW92_ARATH/24-595; Protein of unknown function (DUF740 topsan)  ali follow..  18  514...........MIRSNSSVSWRSSGTTGGGLQRNSVDGYISGKK-SKAENG-YLTPGKGRRRGSGN................... 572
9 -5.510PF04318.7; YAG8_YEAST/1-84; Protein of unknown function (DUF468 topsan)  ali follow..  22  3................GTCLSGLYPVPFTHNAHHYPHFDIYISFGGPKYCNTYVIPLLHHI........................ 51
10 -5.240PF13016.1; Q5MFG8_WHEAT/204-281; Cys-rich Gliadin N-terminal  ali follow..  21  3...QIPVIHPSVLQQLNPCQQQCIPVAMQRCLARSQMLQQSICHVMQRQCCQQLRQIPEQ......................... 63

FFAS is supported by the NIH grant R01-GM087218-01
6 2 0 5 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ye Y, Godzik A. FATCAT: a web server for flexible structure comparison and structure similarity searching. Nucleic Acids Res. 2004 Jul 1;32(Web Server issue):W582-5.