current user: public




Query: PF03529.11; M3ZUI9_XIPMA/174-274; Otx1 transcription factor, from PfamA30U

Results of FFAS03 search in PfamA30U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
# Score Template Links and tools%idFirst SPAPISPAPAPANLPDPVAPTSASCMQRSATSSSNGGAASYPVSYSQTAAAYSQGYPASASGSYFSGVECGSYLAPMHSHHHPHQLSPMTGSSMTGHPHHHLast
1 -73.300PF03529.11; M3ZUI9_XIPMA/174-274; Otx1 transcription factor  ali  100  1SPAPISPAPAPANLPDPVAPTSASCMQRSATSSSNGGAASYPVSYSQTAAAYSQGYPASASGSYFSGVECGSYLAPMHSHHHPHQLSPMTGSSMTGHPHHH 101
2 -6.600PF16021.3; W5K5W0_ASTMX/233-544; Programmed cell death protein 7  ali follow..  11  279..........................DQFLVPVDHPDGTSIPPCW-----------PDPPADDVW-----ATAL........................... 312
3 -6.500PF10114.7; H6LEQ7_ACEWD/9-173; Sensory domain found in PocR  ali follow..  16  50..................SNNRDCCYQSDAHGGIESARSGKPSIYICHGGLVDLAVPIMVKGNYLGAIMAGQVK........................... 105
4 -6.250PF16314.3; Q5LHM9_BACFN/5-659; Domain of unknown function (DUF4954 topsan)  ali follow..  21  201GTCRLYNGSINSNESAPVHIGHGVICDDFIISSGSHVDDGAMLTRCFVGQACQLGHNYSASDSLFFGEACAIFAGPYTVTHHKSTLNAGSGSNQSNHMYK. 316
5 -6.050PF10843.6; RGI1_CANAL/5-200; Respiratory growth induced protein 1  ali follow..  10  14...NIKPMDHLQPVPKTRSSSITSIESADEPGTMKQVLLPPTIKEFDELEQFESFVRDETWDNDFDYFHGRHYYPPFSCQNNLEKIKPTMNKKFRRDLQHH 118
6 -5.900PF04863.11; M4F6N0_BRARP/33-89; Alliinase EGF-like domain  ali follow..  12  8...........................IEAEDAASVSCSGHGRAYVDGIGVLGGKQPSCECNNCYTGKDCSILLS.......................... 55
7 -5.860PF03838.12; G8PDE9_PEDCP/29-194; Recombination protein U  ali follow..  17  3...........MSLEEELNSSNQYYLSRGLGVIHKKPTPIQIVKVKRSAARITEAYFRQASTTDYNGVYKGHYLDFDAKETTNLTSFPL--KNFHTHQITH 93
8 -5.820PF06637.9; F1MHE4_BOVIN/1-440; PV-1 protein (PLVAP)  ali follow..  20  2..................................................GLAMEHGSPYSRAGSSSRGCWYYL........................... 25
9 -5.790PF00674.16; E7Q3W1_YEASB/73-171; DUP family  ali follow..  32..................QDFKINLLVEVIKRKPAVKGKEWRTITYNMNQYLFDHRLWNTPYCFYDDEDCHHYFL.......................... 88
10 -5.570PF09665.8; Q1ATV9_RUBXD/11-526; Type II restriction endonuclease (RE_Alw26IDE)  ali follow..  14  180...SVLSPGVMSNAPDRLDSFNICCRGIRDKGRSKENLQSYTTVFEYWVDG-LNGHPGPCSADHIGPISLGPEFQFLCKACNSGKNNRMYASDV....... 302

FFAS is supported by the NIH grant R01-GM087218-01
8 5 6 5 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Slabinski L, Jaroszewski L, Rychlewski L, Wilson IA, Lesley SA, Godzik A. XtalPred: a web server for prediction of protein crystallizability. Bioinformatics. 2007 Dec 15;23(24):3403-5. Epub 2007 Oct 5.